Citrus Sinensis ID: 004114


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770---
MSRSTASFLTIRSLTALSKVSSSLTSCDSTKTLYLLKNLSTAIERFDFQNPNGYYEDDSFQNDQHPNGFCTEQSSVDFQQKPNEHGLNPNGGFTERRVNDYWDNPLRQNGNCGFYGQNHGGLKQNRIDNCQKASGGYRESFSSEQQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHINEFQNNTFQQNGNFNDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQNNGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW
cccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHccccccccccccccHHHHHHHccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccHHccccHHHHHHHHHHHcHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccHcccccccccccHHHHHHccccccccccEEEcccccHccHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHccccHHHccccccccccccccccHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEccccccEcccccc
MSRSTASFLTIRSLTALSKVsssltscdstktLYLLKNLSTAIErfdfqnpngyyeddsfqndqhpngfcteqssvdfqqkpnehglnpnggfterrvndywdnplrqngncgfygqnhgglkqnridncqkasggyresfssEQQRNivgengnfkghyrqidgygkqnsngiygessrgfqqnsnefyqhhagvnseshinefqnntfqqngnfndygwynngqphpnlsgaqpqmsrsggnanvqnqygpihygpgevmqnrngfnsqRFSEslgsfngncmqdtgQHQQALsghysgnfgihqnspsfyqqdqnggqyqwdQSRRqyqqnpnegqyqsysgniqngmMASQVLnnckheddfaeasrssqnngtleQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMysecdsmdDAFSVFsnmterdltswDTMITGFaknglgedaVDIFSQFkqaglkpddqiFIGVFSACSALGDVVEGMLHFesmskdygivpsmKHYVSIVDMLGSTGYLDEALEFIekmpmepdvDVWEKLMNLCRMHGNLELGDRCAEIVEqldpsrlnekskaglvpvnaSELAKEKENKKLASQNLLEVRSKVheyragdtshpetDKIYALIRGLRAQMkeagyipetrfvlhdIDQEGKEEALLAHSERLAVShgllssparapirIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRfhhfkdglcscrdyw
msrstasfLTIRSLTalskvsssltscdstkTLYLLKNLSTAIERFDFQNPNGYYEDDSFQNDQHPNGFCTEQSSVDFQQKPNehglnpnggftERRVNDYWDNPLRQNGNCGFYGQNHGGLKQNRIDNCQKASGGYresfsseqqrNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHINEFQNNTFQQNGNFNDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEasrssqnngtleqldglvkEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVerllsplrvstYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLdpsrlnekskagLVPVNASELAKEKENKKLASQNLLEVRSKVHeyragdtshpetdKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDakrfhhfkdglcscrdyw
MSRSTASFLTIRSLTALSKVSSSLTSCDSTKTLYLLKNLSTAIERFDFQNPNGYYEDDSFQNDQHPNGFCTEQSSVDFQQKPNEHGLNPNGGFTERRVNDYWDNPLRQNGNCGFYGQNHGGLKQNRIDNCQKASGGYRESFSSEQQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHInefqnntfqqngnfnDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQNNGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVnaselakekenkklasQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW
********LTIRSLTALSKV**SLTSCDSTKTLYLLKNLSTAIERFDFQNPNGYY****************************************RRVNDYWDNPLRQNGNCGFYGQNHGGLK********************************FKGHYRQIDGY*****************************************NTFQQNGNFNDYGWYN****************************************************************************************************************************************************************GLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVE*********************************************************DKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDY*
**********IRSLTA***************TLYLLKNLSTAIER*************************************************************RQNGNCGFY************************************************************************************************************************P*MSRSGGNANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQNNGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW
********LTIRSLTALS*********DSTKTLYLLKNLSTAIERFDFQNPNGYYEDDSFQNDQHPNGFCTEQSSVDFQQKPNEHGLNPNGGFTERRVNDYWDNPLRQNGNCGFYGQNHGGLKQNRIDNCQKA***********QQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHINEFQNNTFQQNGNFNDYGWYNNGQPHPNLS***********NANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQ************SRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHED***********NGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW
***********RSLTALSKVSSSLTSCDSTKTLYLLKNLSTAIERFDFQNPNGYYEDDSFQNDQHPNGFCTEQSSVDFQQKPNEHGLNPNGGFTERRVNDYWDNPLRQNGNCGFYGQNHGGLKQNRIDNCQKASGGYRESFSSEQQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHINEFQNNTFQQNGNFNDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQNNGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSTASFLTIRSLTALSKVSSSLTSCDSTKTLYLLKNLSTAIERFDFQNPNGYYEDDSFQNDQHPNGFCTEQSSVDFQQKPNEHGLNPNGGFTERRVNDYWDNPLRQNGNCGFYGQNHGGLKQNRIDNCQKASGGYRESFSSEQQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHINEFQNNTFQQNGNFNDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQNQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQNNGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPVNASExxxxxxxxxxxxxxxxxxxxxVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query773 2.2.26 [Sep-21-2011]
Q9SUU7537 Pentatricopeptide repeat- yes no 0.623 0.897 0.477 1e-128
Q680H3615 Pentatricopeptide repeat- no no 0.508 0.639 0.544 1e-127
Q8S8Q7469 Pentatricopeptide repeat- no no 0.525 0.865 0.450 1e-104
Q9C6G2475 Pentatricopeptide repeat- no no 0.510 0.831 0.453 1e-102
Q9ZQE5579 Pentatricopeptide repeat- no no 0.474 0.633 0.399 9e-88
Q9SY02781 Pentatricopeptide repeat- no no 0.504 0.499 0.382 7e-85
Q9FIB2995 Putative pentatricopeptid no no 0.531 0.413 0.386 3e-82
Q5G1T1850 Pentatricopeptide repeat- no no 0.507 0.461 0.382 3e-82
O81767823 Pentatricopeptide repeat- no no 0.507 0.476 0.383 6e-82
Q9SHZ8786 Pentatricopeptide repeat- no no 0.423 0.416 0.431 3e-81
>sp|Q9SUU7|PP346_ARATH Pentatricopeptide repeat-containing protein At4g32450, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H63 PE=2 SV=1 Back     alignment and function desciption
 Score =  460 bits (1183), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 243/509 (47%), Positives = 321/509 (63%), Gaps = 27/509 (5%)

Query: 281 NGNCMQDTGQHQQALSGHYSGN---FGIHQNSPSFYQQDQNGGQYQWDQSRRQYQQNPNE 337
           NGN M ++  H   ++G   G     G  QNS   Y+Q  N    Q + + R YQ   N 
Sbjct: 40  NGNPMDNSSHHIGYVNGFNGGEQSLGGFQQNS---YEQSLNPVSGQ-NPTNRFYQNGYNR 95

Query: 338 GQ-YQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQNNG------------TLEQLDG 384
            Q Y  +S  I       Q  + C              N G            +L++LD 
Sbjct: 96  NQSYGEHSEIINQRNQNWQSSDGCSSYGTTGNGVPQENNTGGNHFQQDHSGHSSLDELDS 155

Query: 385 LVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLR 444
           + +EGKVK+A+E++     +   VDLP    + Q CGDA+AL+EAK VHE +   +    
Sbjct: 156 ICREGKVKKAVEIIKSWRNEGYVVDLPRLFWIAQLCGDAQALQEAKVVHEFITSSVGISD 215

Query: 445 VSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQ 504
           +S YN I++MYS C S++DA +VF++M ER+L +W  +I  FAKNG GEDA+D FS+FKQ
Sbjct: 216 ISAYNSIIEMYSGCGSVEDALTVFNSMPERNLETWCGVIRCFAKNGQGEDAIDTFSRFKQ 275

Query: 505 AGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLD 564
            G KPD ++F  +F AC  LGD+ EG+LHFESM K+YGI+P M+HYVS+V ML   GYLD
Sbjct: 276 EGNKPDGEMFKEIFFACGVLGDMNEGLLHFESMYKEYGIIPCMEHYVSLVKMLAEPGYLD 335

Query: 565 EALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGLVPV 624
           EAL F+E   MEP+VD+WE LMNL R+HG+L LGDRC ++VEQLD SRLN++SKAGLVPV
Sbjct: 336 EALRFVES--MEPNVDLWETLMNLSRVHGDLILGDRCQDMVEQLDASRLNKESKAGLVPV 393

Query: 625 NASELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIP 684
            +S+L KEK  +     N       +    AGD S PE  ++Y  ++ L+  M E GY+P
Sbjct: 394 KSSDLVKEKLQRMAKGPNY-----GIRYMAAGDISRPENRELYMALKSLKEHMIEIGYVP 448

Query: 685 ETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHSALKIIS 744
            ++  LHD+DQE K+E L  H+ER A     L +PAR+ IR+MKNLRVC DCH+ALK++S
Sbjct: 449 LSKLALHDVDQESKDENLFNHNERFAFISTFLDTPARSLIRVMKNLRVCADCHNALKLMS 508

Query: 745 KIVGRELIIRDAKRFHHFKDGLCSCRDYW 773
           KIVGRELI RDAKRFHH KDG+CSCR+YW
Sbjct: 509 KIVGRELISRDAKRFHHMKDGVCSCREYW 537





Arabidopsis thaliana (taxid: 3702)
>sp|Q680H3|PP170_ARATH Pentatricopeptide repeat-containing protein At2g25580 OS=Arabidopsis thaliana GN=PCMP-H75 PE=2 SV=2 Back     alignment and function description
>sp|Q8S8Q7|PP183_ARATH Pentatricopeptide repeat-containing protein At2g34370, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H25 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6G2|PPR63_ARATH Pentatricopeptide repeat-containing protein At1g29710, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H67 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQE5|PP153_ARATH Pentatricopeptide repeat-containing protein At2g15690 OS=Arabidopsis thaliana GN=PCMP-H66 PE=2 SV=2 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containing protein At5g09950 OS=Arabidopsis thaliana GN=PCMP-H35 PE=3 SV=1 Back     alignment and function description
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function description
>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=3 SV=2 Back     alignment and function description
>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query773
225430210807 PREDICTED: pentatricopeptide repeat-cont 0.961 0.920 0.569 0.0
147856667 1148 hypothetical protein VITISV_020760 [Viti 0.959 0.646 0.569 0.0
356510940664 PREDICTED: pentatricopeptide repeat-cont 0.774 0.902 0.568 0.0
296082000676 unnamed protein product [Vitis vinifera] 0.825 0.943 0.499 0.0
449485419731 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.926 0.979 0.486 0.0
356528308664 PREDICTED: pentatricopeptide repeat-cont 0.778 0.906 0.551 0.0
449449711671 PREDICTED: pentatricopeptide repeat-cont 0.862 0.994 0.490 0.0
49533766741 Putative selenium-binding protein, relat 0.915 0.955 0.465 1e-178
255578133548 pentatricopeptide repeat-containing prot 0.560 0.790 0.648 1e-162
357487235768 Pentatricopeptide repeat protein [Medica 0.460 0.463 0.677 1e-157
>gi|225430210|ref|XP_002282464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/837 (56%), Positives = 574/837 (68%), Gaps = 94/837 (11%)

Query: 1   MSRSTASFLTIRSLTALSKV-SSSLTSCDSTKTLYLLKNLSTAIERFDFQNPNGYYEDDS 59
           MS   A+ LTI SLTALSKV  S  +S  S+KTL LLKNLSTA ER DFQ  NG+ +++S
Sbjct: 1   MSAKRATLLTINSLTALSKVCPSPNSSSASSKTLTLLKNLSTAAERADFQISNGFQKENS 60

Query: 60  FQNDQHPNGF-CTEQSSVDFQQKPN-----------------------EHGLNPNGGFTE 95
            +N Q+P+GF    Q+ ++FQQKPN                       +  +NPNGGF E
Sbjct: 61  PENHQNPDGFDADNQNHIEFQQKPNGQSPGGYFSGSPQGFYGGNSVEAQQSINPNGGFEE 120

Query: 96  RRVNDYWDNPLRQNGNC-GFYGQNHGGLKQNRID----NCQKAS--------GGYRESFS 142
              N++  NP+ QN N  G+ GQN   L+QN       N   +S         GYRE   
Sbjct: 121 NLRNEFHRNPIGQNVNFNGYNGQNFRDLQQNPDGLYGGNSMNSSEVHQDLNPRGYREYAR 180

Query: 143 SEQQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNEFYQHHAGVNSESHI 202
           +E ++N   ++GNF  +YRQ  G               G   N NE  +       ES I
Sbjct: 181 NEFKQNPFSQSGNFSRNYRQGSG---------------GLPANQNELCR-------ESTI 218

Query: 203 NEFQNNTFQQNGNFNDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQNQYGPIHYGPGEVM 262
           NE+Q N   Q+GN N Y   N G+        Q      G N NVQN Y     G  EV 
Sbjct: 219 NEYQQNLVGQSGNINGYCGQNYGE------SLQKSNDFYGQNRNVQNSY--YSEGRAEVN 270

Query: 263 QNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGH---------------YSGNFGIHQ 307
           QNRNG   Q  SE+LG  N    ++  Q QQ+ SG+               Y  N G +Q
Sbjct: 271 QNRNGNCQQIISETLGDLNRTYGENIRQFQQSPSGYHRENLQQYQPSENMYYRENVGQYQ 330

Query: 308 NSPSF-----------YQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMASQV 356
            +P+            YQQ+ N  QYQ + +  QYQQNPN  QYQ+ S   QN M+ S  
Sbjct: 331 QNPNVGQYQQNPNIGQYQQNPNVAQYQQNPNVAQYQQNPNVAQYQTNSNEFQNSMVGSPK 390

Query: 357 LNNCKHEDDFAEASRSSQNNGTLEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQL 416
            +N K + +  EA+ SSQ +GTLE++D   K+GKVKEAIEVLGLLEKQ   VDLP + +L
Sbjct: 391 SSNYKPDGESLEAAESSQYSGTLEEVDDFCKDGKVKEAIEVLGLLEKQHTPVDLPRYLRL 450

Query: 417 MQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDL 476
           M+ACG+AKAL+EAKAVHE + + +SPL+VSTYN IL+MYS+C SMDDA++VF  M ER+L
Sbjct: 451 MKACGEAKALQEAKAVHESLIKSVSPLKVSTYNRILEMYSKCGSMDDAYAVFKKMPERNL 510

Query: 477 TSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFES 536
           TSWDTMIT FAKN LGE+A+D+F QFK++GLKPD Q+FIGVF ACS LGDV+EGMLHF S
Sbjct: 511 TSWDTMITWFAKNDLGEEAIDLFIQFKESGLKPDGQMFIGVFMACSVLGDVIEGMLHFNS 570

Query: 537 MSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLE 596
           MSKDYGIVPSMKHY S+VDMLG++GYLDEALEF+EKMP+EP VDVWE LMN+CR+ GN+E
Sbjct: 571 MSKDYGIVPSMKHYASMVDMLGNSGYLDEALEFVEKMPLEPSVDVWETLMNICRVQGNME 630

Query: 597 LGDRCAEIVEQLDPSRLNEKSKAGLVPVNASELAKEKENKKLASQNLLEVRSKVHEYRAG 656
           +GDRCAE+VE L+PSRL E+SKAGLVPV AS+L KEKE KKLASQNLLEVRS+VHEYRAG
Sbjct: 631 IGDRCAELVEHLEPSRLTEQSKAGLVPVKASDLEKEKEKKKLASQNLLEVRSRVHEYRAG 690

Query: 657 DTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLL 716
           DTSHPE DKIYA +RGL+AQMKEAGY+PETRFVLHDIDQEGKEEALLAHSERLAV++GLL
Sbjct: 691 DTSHPENDKIYAKLRGLKAQMKEAGYVPETRFVLHDIDQEGKEEALLAHSERLAVAYGLL 750

Query: 717 SSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW 773
           SSPAR+PIR++KNLRVCGDCH+ALKIISK+VGRELIIRDAKRFHHFKDGLCSCRDYW
Sbjct: 751 SSPARSPIRVIKNLRVCGDCHTALKIISKLVGRELIIRDAKRFHHFKDGLCSCRDYW 807




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147856667|emb|CAN80315.1| hypothetical protein VITISV_020760 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510940|ref|XP_003524191.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580-like [Glycine max] Back     alignment and taxonomy information
>gi|296082000|emb|CBI21005.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449485419|ref|XP_004157162.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g25580-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356528308|ref|XP_003532746.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580-like [Glycine max] Back     alignment and taxonomy information
>gi|449449711|ref|XP_004142608.1| PREDICTED: pentatricopeptide repeat-containing protein At2g25580-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|49533766|gb|AAT66765.1| Putative selenium-binding protein, related [Solanum demissum] Back     alignment and taxonomy information
>gi|255578133|ref|XP_002529936.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530566|gb|EEF32444.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357487235|ref|XP_003613905.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355515240|gb|AES96863.1| Pentatricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query773
TAIR|locus:2040135615 MEF8 "AT2G25580" [Arabidopsis 0.508 0.639 0.526 4.5e-121
TAIR|locus:2127826537 MEF8S "MEF8 similar" [Arabidop 0.635 0.914 0.474 2.4e-115
TAIR|locus:2040859469 AT2G34370 [Arabidopsis thalian 0.525 0.865 0.438 2.9e-96
TAIR|locus:2013738475 AT1G29710 "AT1G29710" [Arabido 0.509 0.829 0.447 1.1e-89
TAIR|locus:2053659579 AT2G15690 "AT2G15690" [Arabido 0.468 0.625 0.318 6.9e-83
TAIR|locus:2082886850 EMB2261 "embryo defective 2261 0.554 0.504 0.359 1.3e-77
TAIR|locus:2027554704 AT1G56690 [Arabidopsis thalian 0.499 0.548 0.376 1.8e-76
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.503 0.498 0.38 1.9e-76
TAIR|locus:2118964823 EMB2758 "embryo defective 2758 0.507 0.476 0.380 2.1e-75
TAIR|locus:2131939792 MEF29 "AT4G30700" [Arabidopsis 0.522 0.510 0.377 5.2e-75
TAIR|locus:2040135 MEF8 "AT2G25580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1102 (393.0 bits), Expect = 4.5e-121, Sum P(3) = 4.5e-121
 Identities = 208/395 (52%), Positives = 278/395 (70%)

Query:   379 LEQLDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVER 438
             +E+ D   K GKVK+A+  + +L      VDL    +L + CG+A+ L+EAK VH  +  
Sbjct:   223 IEEYDAFCKHGKVKKALYTIDILASMNYVVDLSRLLRLAKICGEAEGLQEAKTVHGKISA 282

Query:   439 LLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDI 498
              +S L +S+ + +L+MYS C   ++A SVF  M+E++L +W  +I  FAKNG GEDA+D+
Sbjct:   283 SVSHLDLSSNHVLLEMYSNCGLANEAASVFEKMSEKNLETWCIIIRCFAKNGFGEDAIDM 342

Query:   499 FSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLG 558
             FS+FK+ G  PD Q+F G+F AC  LGDV EG+LHFESMS+DYGI PS++ YVS+V+M  
Sbjct:   343 FSRFKEEGNIPDGQLFRGIFYACGMLGDVDEGLLHFESMSRDYGIAPSIEDYVSLVEMYA 402

Query:   559 STGYLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLNEKSK 618
               G+LDEALEF+E+MPMEP+VDVWE LMNL R+HGNLELGD CAE+VE LDP+RLN++S+
Sbjct:   403 LPGFLDEALEFVERMPMEPNVDVWETLMNLSRVHGNLELGDYCAEVVEFLDPTRLNKQSR 462

Query:   619 AGLVPVXXXXXXXXXXXXXXXXQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMK 678
              G +PV                  L  V+S + E+RAGDT+ PE D+++ L+R L+  M 
Sbjct:   463 EGFIPVKASDVEKESLKKRSGI--LHGVKSSMQEFRAGDTNLPENDELFQLLRNLKMHMV 520

Query:   679 EAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIMKNLRVCGDCHS 738
             E GY+ ETR  LHDIDQE KE  LL HSER+A +  +L+S  R P  ++KNLRVC DCH+
Sbjct:   521 EVGYVAETRMALHDIDQESKETLLLGHSERIAFARAVLNSAPRKPFTVIKNLRVCVDCHN 580

Query:   739 ALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW 773
             ALKI+S IVGRE+I RD KRFH  K+G C+C+DYW
Sbjct:   581 ALKIMSDIVGREVITRDIKRFHQMKNGACTCKDYW 615


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2127826 MEF8S "MEF8 similar" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040859 AT2G34370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013738 AT1G29710 "AT1G29710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053659 AT2G15690 "AT2G15690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027554 AT1G56690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131939 MEF29 "AT4G30700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-90
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-87
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-25
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 1e-22
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-20
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-18
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-16
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-10
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.002
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  299 bits (766), Expect = 1e-90
 Identities = 135/406 (33%), Positives = 221/406 (54%), Gaps = 19/406 (4%)

Query: 382 LDGLVKEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLS 441
           L G    G  +EA+ +   +    +S+D  TFS +++       LE AK  H  + R   
Sbjct: 297 LAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGF 356

Query: 442 PLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMITGFAKNGLGEDAVDIFSQ 501
           PL +     ++ +YS+   M+DA +VF  M  ++L SW+ +I G+  +G G  AV++F +
Sbjct: 357 PLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFER 416

Query: 502 FKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTG 561
               G+ P+   F+ V SAC   G   +G   F+SMS+++ I P   HY  ++++LG  G
Sbjct: 417 MIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREG 476

Query: 562 YLDEALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRLN------- 614
            LDEA   I + P +P V++W  L+  CR+H NLELG   AE +  + P +LN       
Sbjct: 477 LLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLN 536

Query: 615 -------EKSKAGLVPVNASELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDKIY 667
                  +   A +V     E  K K      +   +EV+ + H + +GD  HP++ +IY
Sbjct: 537 LYNSSGRQAEAAKVV-----ETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIY 591

Query: 668 ALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGLLSSPARAPIRIM 727
             +  L  ++ E GY+ E   +L D+D++ ++ +   HSE+LA++ GL+++    P++I 
Sbjct: 592 QKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQIT 651

Query: 728 KNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW 773
           ++ R+C DCH  +K I+ +  RE+++RDA RFHHFK G CSC DYW
Sbjct: 652 QSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 773
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.72
PRK11788389 tetratricopeptide repeat protein; Provisional 99.7
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.6
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.58
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.34
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.33
PF1304150 PPR_2: PPR repeat family 99.21
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.16
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.15
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.07
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.07
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.06
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.06
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.06
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.06
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.03
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.03
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.01
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.0
PF1304150 PPR_2: PPR repeat family 99.0
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.0
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.99
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.97
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.94
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.94
KOG1126638 consensus DNA-binding cell division cycle control 98.9
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.88
KOG1126638 consensus DNA-binding cell division cycle control 98.88
PRK14574 822 hmsH outer membrane protein; Provisional 98.8
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.76
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.7
PRK12370553 invasion protein regulator; Provisional 98.66
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.64
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.61
PRK14574 822 hmsH outer membrane protein; Provisional 98.58
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.53
KOG1129478 consensus TPR repeat-containing protein [General f 98.51
KOG2003840 consensus TPR repeat-containing protein [General f 98.51
PRK11189296 lipoprotein NlpI; Provisional 98.5
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.5
PRK12370553 invasion protein regulator; Provisional 98.49
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.46
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.46
KOG2076 895 consensus RNA polymerase III transcription factor 98.43
PF1285434 PPR_1: PPR repeat 98.42
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.4
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.29
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.28
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.26
PF1285434 PPR_1: PPR repeat 98.23
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.18
PRK11189296 lipoprotein NlpI; Provisional 98.12
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.11
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.1
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.09
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.04
KOG2003840 consensus TPR repeat-containing protein [General f 98.02
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.02
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.02
KOG1915677 consensus Cell cycle control protein (crooked neck 97.94
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.9
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.88
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.85
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.83
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.82
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.81
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.78
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.77
KOG2076 895 consensus RNA polymerase III transcription factor 97.77
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.76
KOG1125579 consensus TPR repeat-containing protein [General f 97.73
KOG1129478 consensus TPR repeat-containing protein [General f 97.72
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.71
PLN02789320 farnesyltranstransferase 97.65
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.64
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.59
KOG1128777 consensus Uncharacterized conserved protein, conta 97.56
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.54
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.51
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.48
KOG1128777 consensus Uncharacterized conserved protein, conta 97.48
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.46
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.4
PRK10370198 formate-dependent nitrite reductase complex subuni 97.4
KOG0547606 consensus Translocase of outer mitochondrial membr 97.39
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.38
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.28
KOG0547606 consensus Translocase of outer mitochondrial membr 97.27
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.27
PRK10370198 formate-dependent nitrite reductase complex subuni 97.26
PRK15359144 type III secretion system chaperone protein SscB; 97.25
PRK04841903 transcriptional regulator MalT; Provisional 97.23
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.22
PRK15359144 type III secretion system chaperone protein SscB; 97.13
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.11
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.07
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.01
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.01
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.0
PRK04841903 transcriptional regulator MalT; Provisional 97.0
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.99
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.98
KOG1915677 consensus Cell cycle control protein (crooked neck 96.97
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.93
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.92
KOG2047 835 consensus mRNA splicing factor [RNA processing and 96.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.9
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.89
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.82
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 96.8
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.76
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.73
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.72
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.71
PLN02789320 farnesyltranstransferase 96.68
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.67
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.67
KOG1125579 consensus TPR repeat-containing protein [General f 96.66
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.63
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.62
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.6
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.59
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.58
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.57
KOG4340459 consensus Uncharacterized conserved protein [Funct 96.56
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.55
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.55
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.52
KOG2047 835 consensus mRNA splicing factor [RNA processing and 96.46
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.41
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.35
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.26
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.23
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.23
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.22
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.2
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.2
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.07
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.04
KOG4340459 consensus Uncharacterized conserved protein [Funct 96.03
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.02
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.94
KOG3060289 consensus Uncharacterized conserved protein [Funct 95.9
PF12688120 TPR_5: Tetratrico peptide repeat 95.85
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.84
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.77
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.7
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.59
COG3898531 Uncharacterized membrane-bound protein [Function u 95.58
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.58
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 95.56
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.55
KOG4162799 consensus Predicted calmodulin-binding protein [Si 95.54
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.54
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.52
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.43
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.4
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.36
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.31
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.28
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.21
KOG4162799 consensus Predicted calmodulin-binding protein [Si 95.11
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.06
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.02
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.99
KOG3941406 consensus Intermediate in Toll signal transduction 94.97
COG3898531 Uncharacterized membrane-bound protein [Function u 94.95
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.87
PF12688120 TPR_5: Tetratrico peptide repeat 94.71
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.69
KOG3785557 consensus Uncharacterized conserved protein [Funct 94.68
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.67
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.66
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 94.44
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.27
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 94.27
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.27
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.14
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.14
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.95
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 93.76
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 93.69
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.49
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.35
smart00299140 CLH Clathrin heavy chain repeat homology. 93.26
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.16
KOG0553304 consensus TPR repeat-containing protein [General f 93.1
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 92.89
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.88
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.63
KOG0553304 consensus TPR repeat-containing protein [General f 92.59
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.47
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 92.35
smart00299140 CLH Clathrin heavy chain repeat homology. 92.22
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 92.1
COG4700251 Uncharacterized protein conserved in bacteria cont 92.07
KOG20411189 consensus WD40 repeat protein [General function pr 91.93
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.89
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.88
PF1337173 TPR_9: Tetratricopeptide repeat 91.85
PRK10803263 tol-pal system protein YbgF; Provisional 91.54
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.46
COG4700251 Uncharacterized protein conserved in bacteria cont 91.41
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 91.38
PRK10803263 tol-pal system protein YbgF; Provisional 91.05
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 90.96
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.82
KOG2041 1189 consensus WD40 repeat protein [General function pr 90.62
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.38
PF13281374 DUF4071: Domain of unknown function (DUF4071) 90.14
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 89.75
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 89.56
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 89.48
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.44
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.07
PF1337173 TPR_9: Tetratricopeptide repeat 89.0
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 88.98
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.8
KOG3941406 consensus Intermediate in Toll signal transduction 88.6
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 87.91
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 87.72
COG3629280 DnrI DNA-binding transcriptional activator of the 87.67
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 87.27
PF1342844 TPR_14: Tetratricopeptide repeat 86.75
PRK09687280 putative lyase; Provisional 86.73
COG3118304 Thioredoxin domain-containing protein [Posttransla 85.67
PRK15331165 chaperone protein SicA; Provisional 85.2
KOG2610491 consensus Uncharacterized conserved protein [Funct 85.16
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 84.92
PF13929292 mRNA_stabil: mRNA stabilisation 84.68
COG3118304 Thioredoxin domain-containing protein [Posttransla 84.47
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 84.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 83.82
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 83.49
PF13512142 TPR_18: Tetratricopeptide repeat 83.37
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 82.41
COG1729262 Uncharacterized protein conserved in bacteria [Fun 82.29
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 82.17
COG1747 711 Uncharacterized N-terminal domain of the transcrip 81.78
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 81.76
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.72
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 81.52
COG4235287 Cytochrome c biogenesis factor [Posttranslational 80.03
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-85  Score=785.36  Aligned_cols=443  Identities=31%  Similarity=0.567  Sum_probs=426.8

Q ss_pred             HhhchHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChhHHHHhhhh------ccHHHHHHHHHHcCCHHHHHHHHHHHHHC
Q 004114          331 YQQNPNEGQYQSYSGNIQNGMMASQVLNNCKHEDDFAEASRSSQN------NGTLEQLDGLVKEGKVKEAIEVLGLLEKQ  404 (773)
Q Consensus       331 f~~~~~~~~~m~~~gl~pd~~~~n~LI~~y~k~g~~~~A~~v~~~------~~~~~LI~a~~~~G~~~eAl~lf~~M~~~  404 (773)
                      ......++..+.+.|+.+|..++++||++|+++|++++|.++|..      ..+..||.+|++.|++++|+++|++|.+.
T Consensus       240 ~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~  319 (697)
T PLN03081        240 ARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDS  319 (697)
T ss_pred             HHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCHHHHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHc
Confidence            344466788889999999999999999999999999999998743      23446999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhCCChHHHHHHHHHhhcCCHhHHHHHHH
Q 004114          405 CISVDLPTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTERDLTSWDTMIT  484 (773)
Q Consensus       405 Gv~Pd~~ty~~LL~a~~~~g~le~A~~l~~~m~k~G~~pd~~tynaLI~ay~k~G~l~eA~~lf~~M~~~d~~tyn~LI~  484 (773)
                      |+.||..||+++|.+|++.|.+++|+++|..|++.|+.||..+|++||++|+|+|++++|+++|++|.+||+++||+||.
T Consensus       320 g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~  399 (697)
T PLN03081        320 GVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIA  399 (697)
T ss_pred             CCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHcCCChHHHHHHHHHHHHhcCCCCCcchhhhHHHHHHhCCCHH
Q 004114          485 GFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLD  564 (773)
Q Consensus       485 ay~~~G~~deAl~Lf~eM~~~Gv~Pd~~Ty~~LL~a~~~~G~~deA~~if~~M~~~~Gi~Pd~~tyn~LI~~y~r~G~l~  564 (773)
                      +|+++|+.++|+++|++|.+.|+.||.+||++||.+|++.|++++|.++|+.|.+++|+.|+..+|++||++|+++|+++
T Consensus       400 ~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~  479 (697)
T PLN03081        400 GYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLD  479 (697)
T ss_pred             HHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHH
Confidence            99999999999999999999999999999999999999999999999999999988899999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHcCCCCc-------hHHHHcCCchh--hhhHHHHHhcc
Q 004114          565 EALEFIEKMPMEPDVDVWEKLMNLCRMHGNLELGDRCAEIVEQLDPSRL-------NEKSKAGLVPV--NASELAKEKEN  635 (773)
Q Consensus       565 eA~~lf~~M~~~Pd~~ty~~LI~a~~~~G~~e~A~~~~e~m~el~p~~~-------~~y~~aG~~~~--~v~~lmk~~~l  635 (773)
                      +|.++|++|+++|+..+|++||.+|+.+|+++.|+.+++.+.+++|++.       +.|...|+|.+  .+.+.|+++++
T Consensus       480 eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~  559 (697)
T PLN03081        480 EAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGL  559 (697)
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999999999999999999999999999999999864       67999999975  45677999999


Q ss_pred             cccccccEEEEcCEEEEEEeCCCCCccHHHHHHHHHHHHHHHHHcCcccCcchheeccchhhHHHHHHHHHHHHHHHHcC
Q 004114          636 KKLASQNLLEVRSKVHEYRAGDTSHPETDKIYALIRGLRAQMKEAGYIPETRFVLHDIDQEGKEEALLAHSERLAVSHGL  715 (773)
Q Consensus       636 ~k~~~~s~ie~~~~v~~f~~g~~~hp~~~ei~~~l~~L~~~Mke~G~~Pd~~~~l~~v~~~~k~~~l~~hse~LA~a~gl  715 (773)
                      ++.|+++||++.+.+|.|.+|+.+||..++|+.++++|..+|++.||+||+.++++++++++|++.++.|||+||+||||
T Consensus       560 ~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~gy~~~~~~~~~~~~~~~~~~~~~~hsekla~a~~l  639 (697)
T PLN03081        560 SMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGL  639 (697)
T ss_pred             ccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHHHHHHHHHHcCCCCCcchhhccccHHHHHHHHHhccHHHHHHhhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCceeeeechhccccccchhHHhhhccCceEEEecCCcccccCCcccCccCCC
Q 004114          716 LSSPARAPIRIMKNLRVCGDCHSALKIISKIVGRELIIRDAKRFHHFKDGLCSCRDYW  773 (773)
Q Consensus       716 i~~~~~~~i~ivknlr~cgdch~a~k~is~~~~r~iivrd~~r~h~f~~G~csc~d~w  773 (773)
                      +.++++.||||+||||+|+|||+|+|+||++.+|+|||||.+|||||+||+|||+|||
T Consensus       640 ~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        640 INTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             ccCCCCCeEEEecCCEECCCchhhHHHHhhhcceEEEEecCCccccCCCCcccccccC
Confidence            9999999999999999999999999999999999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 74.5 bits (182), Expect = 9e-14
 Identities = 82/683 (12%), Positives = 177/683 (25%), Gaps = 231/683 (33%)

Query: 129 NCQKASGGYRESFSSEQQRNIVGENGNFKGHYRQIDGYGKQNSNGIYGESSRGFQQNSNE 188
           +C+      +   S E+  +I+       G  R       +    +              
Sbjct: 34  DCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQ------------- 80

Query: 189 FYQHHAGVNSESHINEFQNNTFQQNGNFNDYGWYNNGQPHPNLSGAQPQMSRSGGNANVQ 248
                          +F     + N     Y +                           
Sbjct: 81  ---------------KFVEEVLRIN-----YKFL-------------------------- 94

Query: 249 NQYGPIHYGPGEVMQNRNGFNSQRFSESLGSFNGNCMQDTGQHQQALSGHYSGNFGIHQN 308
               PI     +       +  QR  + L  +N N         Q  + +       + +
Sbjct: 95  --MSPIKTEQRQPSMMTRMYIEQR--DRL--YNDN---------QVFAKY-------NVS 132

Query: 309 SPSFYQQDQNGGQYQWDQSRRQYQQNPNEGQYQSYSGNIQNGMMAS--QVLNNCKHEDDF 366
               Y + +              +  P +         + +G++ S    +         
Sbjct: 133 RLQPYLKLRQA----------LLELRPAKNV-------LIDGVLGSGKTWV--------- 166

Query: 367 AEASRSSQNNGTLEQLDGLV---KEGKVKEAIEVLGLLEKQCISVDLPTFSQLMQACGDA 423
             A     +     ++D  +             VL +L+K    +D    S+   +    
Sbjct: 167 --ALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIK 224

Query: 424 KALEEAKAVHEHVERLLSPLRVSTYNGILKMYSEC-DSMDD--------AFSVFSN--MT 472
             +   +     + RLL            K Y  C   + +        AF++     +T
Sbjct: 225 LRIHSIQ---AELRRLLK----------SKPYENCLLVLLNVQNAKAWNAFNLSCKILLT 271

Query: 473 ERDLTSWDTMITGFAKN--------GLGED-AVDIFSQFKQAGLKPDD---QIFIGVFSA 520
            R     D +      +         L  D    +  ++     +P D   +        
Sbjct: 272 TRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKY--LDCRPQDLPRE-------V 322

Query: 521 CS----ALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKMPME 576
            +     L  + E +    +   ++      KH     D L +   ++ +L  +E  P E
Sbjct: 323 LTTNPRRLSIIAESIRDGLATWDNW------KHVNC--DKLTTI--IESSLNVLE--PAE 370

Query: 577 ------------PDVDVWEKLMNLCRMHGNLELGDRCAEIVEQL-DPSRLNEKSKAGLVP 623
                       P   +   L  L  +  ++   D    +V +L   S + ++ K   + 
Sbjct: 371 YRKMFDRLSVFPPSAHIPTIL--LSLIWFDVIKSD-VMVVVNKLHKYSLVEKQPKESTIS 427

Query: 624 VNA--SELAKEKENKKLASQNLLEVRSKVHEYRAGDTSHPETDK-IYALI---------- 670
           + +   EL  + EN+    +++++  +    + + D   P  D+  Y+ I          
Sbjct: 428 IPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHP 487

Query: 671 -------------RGLRAQMKEAGYIPETRF----VLHDI--------DQEGKEEALLAH 705
                        R L  +++               L  +        D + K E L+  
Sbjct: 488 ERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNA 547

Query: 706 SERLAVSHG--LLSSPARAPIRI 726
                      L+ S     +RI
Sbjct: 548 ILDFLPKIEENLICSKYTDLLRI 570


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query773
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.9
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.89
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.74
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.69
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.6
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.57
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.55
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.55
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.5
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.5
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.5
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.49
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.48
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.47
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.46
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.44
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.43
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.42
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.4
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.4
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.38
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.37
3u4t_A272 TPR repeat-containing protein; structural genomics 99.34
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.32
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.31
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.29
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.27
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.25
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.22
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.21
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.2
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.17
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.16
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.14
3u4t_A272 TPR repeat-containing protein; structural genomics 99.12
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.01
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.01
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.99
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.94
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.89
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.87
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.87
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.86
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.86
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.86
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.85
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.85
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.82
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.82
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.81
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.81
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.81
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.76
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.71
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.7
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.7
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.69
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.68
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.61
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.52
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.51
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.48
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.45
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.45
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.44
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.41
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.32
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.3
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.25
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.25
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.24
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.24
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.21
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.19
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.19
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.19
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.18
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.17
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.17
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.16
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.11
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.1
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.09
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.09
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.06
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.0
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.93
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.92
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.91
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.9
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.88
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.85
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.82
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.72
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.71
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.7
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.66
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.66
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.64
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.62
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.61
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.6
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.54
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.52
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.47
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.47
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.46
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.45
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.43
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.43
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.42
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.39
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.35
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.34
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.33
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.32
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.32
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.32
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.31
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.3
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.25
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.25
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.24
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.22
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.2
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.2
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.2
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.16
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.03
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.94
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.93
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.91
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 96.9
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.87
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.84
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.82
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.78
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.75
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.73
3k9i_A117 BH0479 protein; putative protein binding protein, 96.65
3k9i_A117 BH0479 protein; putative protein binding protein, 96.62
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.62
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 96.56
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.53
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.45
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.3
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.25
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.18
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.92
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.84
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.81
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.69
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.57
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.54
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.52
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 95.42
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.41
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.88
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.43
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.34
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.3
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.21
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.17
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.77
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.49
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.39
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 91.15
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 90.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.15
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 87.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.62
1pc2_A152 Mitochondria fission protein; unknown function; NM 86.16
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.35
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 84.91
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 84.12
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 83.72
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 83.03
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 81.75
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 80.9
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 80.6
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.96  E-value=1.3e-28  Score=282.51  Aligned_cols=198  Identities=15%  Similarity=0.187  Sum_probs=133.5

Q ss_pred             HHHHHHHHHHCCCCCCH-HHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhCCC---------hHH
Q 004114          394 AIEVLGLLEKQCISVDL-PTFSQLMQACGDAKALEEAKAVHEHVERLLSPLRVSTYNGILKMYSECDS---------MDD  463 (773)
Q Consensus       394 Al~lf~~M~~~Gv~Pd~-~ty~~LL~a~~~~g~le~A~~l~~~m~k~G~~pd~~tynaLI~ay~k~G~---------l~e  463 (773)
                      +..+.++|.+.++.+.+ .+++.+|++|++.|++++|+++|++|.+.|+.||..|||+||.+|++++.         +++
T Consensus         9 ~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~   88 (501)
T 4g26_A            9 SENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSR   88 (501)
T ss_dssp             ---------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHH
T ss_pred             HHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHH
Confidence            44455566666555443 35666777777777777777777777777777777777777777776554         566


Q ss_pred             HHHHHHHhh----cCCHhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHcCCChHHHHHHHHHHHH
Q 004114          464 AFSVFSNMT----ERDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKPDDQIFIGVFSACSALGDVVEGMLHFESMSK  539 (773)
Q Consensus       464 A~~lf~~M~----~~d~~tyn~LI~ay~~~G~~deAl~Lf~eM~~~Gv~Pd~~Ty~~LL~a~~~~G~~deA~~if~~M~~  539 (773)
                      |.++|++|.    .||++|||+||.+|++.|++++|+++|++|.+.|+.||..||++||.+|++.|++++|.++|++|.+
T Consensus        89 A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~  168 (501)
T 4g26_A           89 GFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVE  168 (501)
T ss_dssp             HHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHh
Confidence            777777776    3577777777777777777777777777777777777777777777777777777777777777765


Q ss_pred             hcCCCCCcchhhhHHHHHHhCCCHHHHHHHHHhC---CCCCCHHHHHHHHHHHHHc
Q 004114          540 DYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKM---PMEPDVDVWEKLMNLCRMH  592 (773)
Q Consensus       540 ~~Gi~Pd~~tyn~LI~~y~r~G~l~eA~~lf~~M---~~~Pd~~ty~~LI~a~~~~  592 (773)
                      . |+.||..||++||.+|++.|++++|.++|++|   ++.|+..||+.|+..|+..
T Consensus       169 ~-G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~  223 (501)
T 4g26_A          169 S-EVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSE  223 (501)
T ss_dssp             T-TCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSH
T ss_pred             c-CCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcC
Confidence            5 77777777777777777777777777777777   6677777777777777653



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query773
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.58
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.47
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.31
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.0
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.51
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.49
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.45
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.45
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.41
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.37
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.1
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.04
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.96
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.64
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.41
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.34
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.28
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.13
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.05
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.88
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.81
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.81
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.77
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.54
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.4
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.29
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.27
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.21
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.01
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.95
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.71
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.7
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.84
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 94.8
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 94.64
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.64
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.44
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.36
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.06
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 93.73
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.35
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 92.27
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 88.88
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 88.57
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 88.22
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.58  E-value=2.7e-12  Score=133.66  Aligned_cols=268  Identities=14%  Similarity=0.122  Sum_probs=211.7

Q ss_pred             CHHHHHHHHHHHHhcCChhHHHHhhhh---------ccHHHHHHHHHHcCCHHHHHHHHHHHHHCCCC------------
Q 004114          349 NGMMASQVLNNCKHEDDFAEASRSSQN---------NGTLEQLDGLVKEGKVKEAIEVLGLLEKQCIS------------  407 (773)
Q Consensus       349 d~~~~n~LI~~y~k~g~~~~A~~v~~~---------~~~~~LI~a~~~~G~~~eAl~lf~~M~~~Gv~------------  407 (773)
                      ++.++..+..+|.+.|++++|...+..         ..+..+...|.+.|++++|++.+..+.+....            
T Consensus        32 ~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~  111 (388)
T d1w3ba_          32 NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAAL  111 (388)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccccccccccccccccccccccccccccc
Confidence            566777777888888888888875321         12223667777888888888877766543211            


Q ss_pred             ------------------------------------------------------C-CHHHHHHHHHHHHhcCCHHHHHHH
Q 004114          408 ------------------------------------------------------V-DLPTFSQLMQACGDAKALEEAKAV  432 (773)
Q Consensus       408 ------------------------------------------------------P-d~~ty~~LL~a~~~~g~le~A~~l  432 (773)
                                                                            | +..++..+...+...+.+++|...
T Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~  191 (388)
T d1w3ba_         112 VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHH  191 (388)
T ss_dssp             HHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHH
Confidence                                                                  1 234455556667778899999999


Q ss_pred             HHHHHHhCCCCCHHHHHHHHHHHHhCCChHHHHHHHHHhhc---CCHhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCC
Q 004114          433 HEHVERLLSPLRVSTYNGILKMYSECDSMDDAFSVFSNMTE---RDLTSWDTMITGFAKNGLGEDAVDIFSQFKQAGLKP  509 (773)
Q Consensus       433 ~~~m~k~G~~pd~~tynaLI~ay~k~G~l~eA~~lf~~M~~---~d~~tyn~LI~ay~~~G~~deAl~Lf~eM~~~Gv~P  509 (773)
                      +...++.. +-+..++..+..+|...|++++|+..|+++..   .+...|..+...|.+.|++++|+..|++..+.  .|
T Consensus       192 ~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p  268 (388)
T d1w3ba_         192 FEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QP  268 (388)
T ss_dssp             HHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CS
T ss_pred             HHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CC
Confidence            99888864 33577888999999999999999999998764   46778888999999999999999999998875  34


Q ss_pred             C-HHHHHHHHHHHHcCCChHHHHHHHHHHHHhcCCCCCcchhhhHHHHHHhCCCHHHHHHHHHhC-CCCCC-HHHHHHHH
Q 004114          510 D-DQIFIGVFSACSALGDVVEGMLHFESMSKDYGIVPSMKHYVSIVDMLGSTGYLDEALEFIEKM-PMEPD-VDVWEKLM  586 (773)
Q Consensus       510 d-~~Ty~~LL~a~~~~G~~deA~~if~~M~~~~Gi~Pd~~tyn~LI~~y~r~G~l~eA~~lf~~M-~~~Pd-~~ty~~LI  586 (773)
                      + ..++..+..++...|++++|..++......  .+.+...+..+..+|.+.|++++|.+.|++. .+.|+ ..+|..+.
T Consensus       269 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la  346 (388)
T d1w3ba_         269 HFPDAYCNLANALKEKGSVAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLA  346 (388)
T ss_dssp             SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence            4 567888899999999999999999988665  4556788889999999999999999999876 55665 67888899


Q ss_pred             HHHHHcCChhHHHHHHHHHHHcCCCCchHHHHcCC
Q 004114          587 NLCRMHGNLELGDRCAEIVEQLDPSRLNEKSKAGL  621 (773)
Q Consensus       587 ~a~~~~G~~e~A~~~~e~m~el~p~~~~~y~~aG~  621 (773)
                      .++...|++++|...++...+++|+++.++...|.
T Consensus       347 ~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~  381 (388)
T d1w3ba_         347 SVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGN  381 (388)
T ss_dssp             HHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Confidence            99999999999999999999999998766655443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure