Citrus Sinensis ID: 004225

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------
MSCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGVIGRGR
cccccccccEEEEEccccccccccHHHHcccccccEEEEEccccccEEEEEcccccccccccccccccEEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccEEEEEccccccccccccccccEEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccHHHHccccccEEEEccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccEEEEcccccccHHcccccccccccccccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHccccccEEEccccHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHcccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccc
ccccHHHHHHHHHHHHHHHHHHcccccccHHEEEEEEEEcccHHHHHHHHEccHHHHHHcEEEcHHHHHEEHccHHHHHccccccccHHccccHHHHEccccccEEEEEccHHHHcccccHHHcEEcccEEEccccccccHHHHHHHHHHHHHHHHHHHHEcccccccccHHHHccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEcccccccHHHccHHHEEccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccEEEEEEEccccHHHHHHHHHHHHHHcccccccccHHccEEEEcccccEEEEcccEEEEEEEcccHHHHHHHHcccccccccccHcHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccccccEEcHHHHHHccccccccHHHccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccc
mscgiqnltrltlsccmnlrclfssstvssFVQLQCIeivgcpvleELIVMDNQEErkknivmfpqlqylkmsdlekftsfctgdldilefpslkelriskcpefmvrttsiftervfpnlekLKVDAKHvvtnkyhlgdertiLSLGDFLQRLHTMKVLQiggysaslpyekvenGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCdhlvnlvppstsfqnltNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRIteivqgddvvakdEVITFRELKELKLVDLerltsfcsgncafkfpslerlvvddcpdmkifsegklstpklhkverHGEACWAWKDDLNTTIQKLVSLpgmlagvwsddsglqlEATTWFRklllppsekviqSGVVARFVEFLTREDNPQLQLEAARALTNiasentnvvidgGAVPIFVKLlsspsddvREKAVWALGNiarssprdrdlvLSEKALIPLLAQLnkhakpsmlRNATKTLSRfcqgkpeppfdqvrpalPALAQLVHSNDNDVLRYACEALsclsdgtndKIQAVIEADVCPRLVKLllhplpfpfgltpplwtvRYIVKGDGFLTQCTGIAKEACRTisnitagnREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKgcikplcdlllyadpEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDlkrhdsngicEKAVKILEIYWScgvigrgr
MSCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVtnkyhlgdertILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKScdriteivqgddvvakdevitfrelkelklvdleRLTSfcsgncafkfpslerlvVDDCPDMKIFsegklstpklhkVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLllppsekviQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWAlgniarssprdrdlVLSEKALIPLLAqlnkhakpsMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKiedlkrhdsngicEKAVKILEIywscgvigrgr
MSCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCprlvklllhplpfpfgltpplWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGVIGRGR
***GIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIAR******DLVLSEKALIPLLAQLN********************************ALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGVIG***
MSCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPY*KVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSC*******
MSCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGVIGRGR
*SCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAW******TIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSC*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCGIQNLTRLTLSCCMNLRCLFSSSTVSSFVQLQCIEIVGCPVLEELIVMDNQEERKKNIVMFPQLQYLKMSDLEKFTSFCTGDLDILEFPSLKELRISKCPEFMVRTTSIFTERVFPNLEKLKVDAKHVVTNKYHLGDERTILSLGDFLQRLHTMKVLQIGGYSASLPYEKVENGMWVEIREAFHLEHILIRESSVTNNLVILRVKGCDHLVNLVPPSTSFQNLTNMVVSRCNNLKIVLTSLIAKTLVRLRYMKIKSCDRITEIVQGDDVVAKDEVITFRELKELKLVDLERLTSFCSGNCAFKFPSLERLVVDDCPDMKIFSEGKLSTPKLHKVERHGEACWAWKDDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLLPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIASENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGVIGRGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query767 2.2.26 [Sep-21-2011]
Q71VM4526 Importin subunit alpha-1a yes no 0.520 0.758 0.659 1e-149
O22478527 Importin subunit alpha OS N/A no 0.521 0.759 0.645 1e-144
Q96321532 Importin subunit alpha-1 no no 0.521 0.751 0.641 1e-143
Q9SLX0534 Importin subunit alpha-1b no no 0.520 0.747 0.638 1e-142
O04294531 Importin subunit alpha-2 no no 0.542 0.783 0.575 1e-130
Q76P29516 Importin subunit alpha-B yes no 0.514 0.765 0.520 1e-104
O35345536 Importin subunit alpha-7 yes no 0.509 0.729 0.516 1e-98
Q5ZML1538 Importin subunit alpha-1 no no 0.509 0.726 0.518 7e-98
Q5RBV0536 Importin subunit alpha-7 yes no 0.509 0.729 0.514 2e-97
O60684536 Importin subunit alpha-7 yes no 0.509 0.729 0.514 2e-97
>sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 Back     alignment and function desciption
 Score =  528 bits (1359), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 283/429 (65%), Positives = 325/429 (75%), Gaps = 30/429 (6%)

Query: 356 QKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLL----PPSEKVIQSGVVARFVEFLTRED 411
           +KL SLP M+ GV+SDD+ LQLEATT FRKLL     PP E+VIQSGVV RFV+FLTRED
Sbjct: 69  KKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTRED 128

Query: 412 NPQLQLEAARALTNIAS---ENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARS 468
            PQLQ EAA ALTNIAS   ENT VVID GAVPIFVKLL S SDDVRE+AVWALGN+A  
Sbjct: 129 FPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGD 188

Query: 469 SPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALA 528
           SP+ RDLVL+  AL+PLLAQLN+H K SMLRNAT TLS FC+GKP+P F+Q RPALPALA
Sbjct: 189 SPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFEQTRPALPALA 248

Query: 529 QLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLW 588
           +L+HSND +VL  AC ALS LSDGTNDKIQAVIEA VCPRLV+LLLH  P P  L P L 
Sbjct: 249 RLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLH--PSPSVLIPALR 306

Query: 589 TVRYIVKGDGFLTQC-------------------TGIAKEACRTISNITAGNREQIQVVI 629
           TV  IV GD   TQC                     I KEAC TISNITAGN++QIQ VI
Sbjct: 307 TVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVI 366

Query: 630 DAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADP 689
           +AG+IGPLV+LLQ AEF  KKEAA AISNA SGG+H+QIKYLV +GCIKPLCDLL+  D 
Sbjct: 367 NAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDI 426

Query: 690 EIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEK 749
            IVT+CL+GLENILKVGE +      +   N ++++++ AEG +KIE+L+ HD+N I EK
Sbjct: 427 RIVTVCLEGLENILKVGETDKTLAAGD--VNVFSQMIDEAEGLEKIENLQSHDNNEIYEK 484

Query: 750 AVKILEIYW 758
           AVKILE YW
Sbjct: 485 AVKILEAYW 493
Functions in nuclear protein import. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Promotes docking of import substrates to the nuclear envelope.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 Back     alignment and function description
>sp|Q96321|IMA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=KAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 Back     alignment and function description
>sp|O04294|IMA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=KAP2 PE=1 SV=2 Back     alignment and function description
>sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 Back     alignment and function description
>sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZML1|IMA1_CHICK Importin subunit alpha-1 OS=Gallus gallus GN=KPNA1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 Back     alignment and function description
>sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query767
225431871529 PREDICTED: importin subunit alpha-1 [Vit 0.526 0.763 0.692 1e-154
224130302529 predicted protein [Populus trichocarpa] 0.521 0.756 0.692 1e-153
356564581530 PREDICTED: importin subunit alpha-1-like 0.526 0.762 0.682 1e-153
119866037529 Impa2 [Nicotiana benthamiana] 0.522 0.758 0.686 1e-152
356556046531 PREDICTED: importin subunit alpha-1-like 0.521 0.753 0.692 1e-152
356529274531 PREDICTED: importin subunit alpha-1-like 0.521 0.753 0.687 1e-152
255542844531 importin alpha, putative [Ricinus commun 0.522 0.755 0.680 1e-152
224110258529 predicted protein [Populus trichocarpa] 0.521 0.756 0.682 1e-152
357441839533 Importin subunit alpha-1 [Medicago trunc 0.526 0.757 0.674 1e-152
356535026532 PREDICTED: importin subunit alpha-1-like 0.521 0.751 0.675 1e-152
>gi|225431871|ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera] gi|296083287|emb|CBI22923.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  552 bits (1423), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 300/433 (69%), Positives = 330/433 (76%), Gaps = 29/433 (6%)

Query: 352 NTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLL----PPSEKVIQSGVVARFVEFL 407
           +T  +KL SLP M+AGVWSD+S LQLEATT FRKLL     PP E+VIQSGVV RFVEFL
Sbjct: 65  STVEKKLESLPSMVAGVWSDNSSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVEFL 124

Query: 408 TREDNPQLQLEAARALTNIAS---ENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGN 464
            RED PQLQ EAA ALTNIAS   ENT VVID GAVPIFVKLL SPSDDVRE+AVWALGN
Sbjct: 125 VREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAVWALGN 184

Query: 465 IARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPAL 524
           +A  SPR RDLVL   ALIPLLAQLN+HAK SMLRNAT TLS FC+GKP+PPFDQV+PAL
Sbjct: 185 VAGDSPRCRDLVLGHGALIPLLAQLNEHAKLSMLRNATWTLSNFCRGKPQPPFDQVKPAL 244

Query: 525 PALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLT 584
           PAL +LVHS+D +VL  AC ALS LSDGTNDKIQAVIEA VCPRLV+LLLH  P P  L 
Sbjct: 245 PALERLVHSSDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLH--PSPSVLI 302

Query: 585 PPLWTVRYIVKGDGFLTQC-------------------TGIAKEACRTISNITAGNREQI 625
           P L TV  IV GD   TQ                      I KEAC TISNITAGN+EQI
Sbjct: 303 PALRTVGNIVTGDDIQTQSIINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQI 362

Query: 626 QVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLL 685
           Q VI+AGVI PLV LLQ AEF  KKEAA AISNA SGGTHEQIKYLV +GCIKPLCDLL+
Sbjct: 363 QAVIEAGVIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLV 422

Query: 686 YADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNG 745
             DP IVT+CL+GLENILKVGEAE   G +    N+YA+L++ AEG +KIE+L+ HD+N 
Sbjct: 423 CPDPRIVTVCLEGLENILKVGEAEKTLGNSGD-VNYYAQLIDDAEGLEKIENLQSHDNNE 481

Query: 746 ICEKAVKILEIYW 758
           I EKAVKILE YW
Sbjct: 482 IYEKAVKILETYW 494

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224130302|ref|XP_002328576.1| predicted protein [Populus trichocarpa] gi|222838558|gb|EEE76923.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356564581|ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Back     alignment and taxonomy information
>gi|119866037|gb|ABM05488.1| Impa2 [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|356556046|ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Back     alignment and taxonomy information
>gi|356529274|ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Back     alignment and taxonomy information
>gi|255542844|ref|XP_002512485.1| importin alpha, putative [Ricinus communis] gi|223548446|gb|EEF49937.1| importin alpha, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110258|ref|XP_002315463.1| predicted protein [Populus trichocarpa] gi|222864503|gb|EEF01634.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357441839|ref|XP_003591197.1| Importin subunit alpha-1 [Medicago truncatula] gi|355480245|gb|AES61448.1| Importin subunit alpha-1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356535026|ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query767
TAIR|locus:505006475535 IMPA-2 "importin alpha isoform 0.352 0.504 0.610 2.4e-127
TAIR|locus:2083313532 IMPA-1 "importin alpha isoform 0.346 0.5 0.590 1.9e-125
TAIR|locus:2195351538 IMPA-4 "AT1G09270" [Arabidopsi 0.275 0.392 0.651 4.2e-117
TAIR|locus:2132238531 MOS6 "MODIFIER OF SNC1, 6" [Ar 0.362 0.523 0.527 3.8e-114
TAIR|locus:2196140539 IMPA-6 "importin alpha isoform 0.340 0.484 0.525 6.4e-108
TAIR|locus:2155929519 IMPA-5 "importin alpha isoform 0.279 0.412 0.588 2.3e-97
TAIR|locus:2078122528 IMPA-7 "importin alpha isoform 0.264 0.384 0.611 3.7e-97
ASPGD|ASPL0000045550553 kapA [Emericella nidulans (tax 0.285 0.396 0.578 7.7e-97
UNIPROTKB|G4MZS0551 MGG_15072 "Importin subunit al 0.281 0.392 0.588 1.9e-91
DICTYBASE|DDB_G0272318516 DDB_G0272318 "putative importi 0.516 0.767 0.501 3.6e-89
TAIR|locus:505006475 IMPA-2 "importin alpha isoform 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 766 (274.7 bits), Expect = 2.4e-127, Sum P(2) = 2.4e-127
 Identities = 171/280 (61%), Positives = 199/280 (71%)

Query:   352 NTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLL----PPSEKVIQSGVVARFVEFL 407
             +T  +KL SLP M+ GVWSDD  LQLEATT FRKLL     PP E+VI +GVV RFVEFL
Sbjct:    70 STVEKKLESLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAGVVPRFVEFL 129

Query:   408 TREDNPQLQLEAARALTNIAS---ENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGN 464
             TRED PQLQ EAA ALTNIAS   ENT VVI+ GAVPIFV+LL+S SDDVRE+AVWALGN
Sbjct:   130 TREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVREQAVWALGN 189

Query:   465 IARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPAL 524
             +A  SPR RDLVL + ALIPLL+QLN+HAK SMLRNAT TLS FC+GKP+PPFDQVRPAL
Sbjct:   190 VAGDSPRCRDLVLGQGALIPLLSQLNEHAKLSMLRNATWTLSNFCRGKPQPPFDQVRPAL 249

Query:   525 PALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCXXXXXXXXXXXXXXXXXX 584
             PAL +L+HS D +VL  AC ALS LSDGTNDKIQ+VIEA V                   
Sbjct:   250 PALERLIHSTDEEVLTDACWALSYLSDGTNDKIQSVIEAGVVPRLVELLQHQSPSVLIPA 309

Query:   585 XXXWTVRYIVKGDGFLTQCTGIAKEACRTISNITAGNREQ 624
                 ++  IV GD   TQC  I+  A  ++ ++   N ++
Sbjct:   310 LR--SIGNIVTGDDLQTQCV-ISHGALLSLLSLLTHNHKK 346
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006606 "protein import into nucleus" evidence=IEA;ISS
GO:0006886 "intracellular protein transport" evidence=ISS
GO:0008565 "protein transporter activity" evidence=IEA;ISS
GO:0005730 "nucleolus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
TAIR|locus:2083313 IMPA-1 "importin alpha isoform 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195351 IMPA-4 "AT1G09270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132238 MOS6 "MODIFIER OF SNC1, 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196140 IMPA-6 "importin alpha isoform 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155929 IMPA-5 "importin alpha isoform 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078122 IMPA-7 "importin alpha isoform 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000045550 kapA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MZS0 MGG_15072 "Importin subunit alpha" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272318 DDB_G0272318 "putative importin subunit alpha B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033097001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (529 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query767
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-124
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-25
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-18
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 9e-17
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-15
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-11
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 1e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 4e-09
pfam1364688 pfam13646, HEAT_2, HEAT repeats 4e-09
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 8e-08
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-07
COG1413335 COG1413, COG1413, FOG: HEAT repeat [Energy product 2e-05
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 1e-04
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 3e-04
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 3e-04
pfam1364688 pfam13646, HEAT_2, HEAT repeats 3e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-04
pfam0298531 pfam02985, HEAT, HEAT repeat 0.001
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 0.002
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.003
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information 
 Score =  382 bits (982), Expect = e-124
 Identities = 211/433 (48%), Positives = 257/433 (59%), Gaps = 33/433 (7%)

Query: 356 QKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLL----PPSEKVIQSGVVARFVEFLTRED 411
           Q    LP +   ++SDD   QL+A   FRKLL     PP + VI +GVV RFVEF+    
Sbjct: 68  QFYSELPQLTQQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFMDEIQ 127

Query: 412 NPQLQLEAARALTNIAS---ENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARS 468
              LQ EAA ALTNIAS   + T VV+D GAVP+F++LLSS  DDVRE+AVWALGNIA  
Sbjct: 128 RDMLQFEAAWALTNIASGTTQQTKVVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGD 187

Query: 469 SPRDRDLVLSEKALIPLLAQLNKHAKP-SMLRNATKTLSRFCQGK-PEPPFDQVRPALPA 526
           S   RD VL   AL PLL  L   A   SMLRNAT TLS  C+GK P P +  +  ALP 
Sbjct: 188 SEGCRDYVLQCGALEPLLGLLLSSAIHISMLRNATWTLSNLCRGKNPPPDWSNISQALPI 247

Query: 527 LAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPP 586
           LA+L++S D +VL  AC A+S LSDG N+KIQAV++  +  RLV+LL H        TP 
Sbjct: 248 LAKLIYSRDPEVLVDACWAISYLSDGPNEKIQAVLDVGIPGRLVELLSHESAKI--QTPA 305

Query: 587 LWTVRYIVKGDGFLTQCT------------------GIAKEACRTISNITAGNREQIQVV 628
           L +V  IV G    TQ                     I KEAC TISNITAGN EQIQ V
Sbjct: 306 LRSVGNIVTGSDDQTQVIINCGALKAFRSLLSSPKENIRKEACWTISNITAGNTEQIQAV 365

Query: 629 IDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTH--EQIKYLVRKGCIKPLCDLLLY 686
           IDA +I PL+ LL +AE+  KKEA  AISNA SGG +  + I+YLV +G IKPLCDLL  
Sbjct: 366 IDANLIPPLIHLLSSAEYKIKKEACWAISNATSGGLNRPDIIRYLVSQGFIKPLCDLLDV 425

Query: 687 ADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGI 746
            D +I+ + L  +ENILKVGE +      N   N YA  VE A G   I  L+   +  I
Sbjct: 426 VDNKIIEVALDAIENILKVGEQDRLRYGKN--INIYAVYVEKAGGMDAIHGLQDSVNRTI 483

Query: 747 CEKAVKILEIYWS 759
            +KA  I+E ++ 
Sbjct: 484 YDKAYSIIEKFFG 496

Length = 526
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|202500 pfam02985, HEAT, HEAT repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 767
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.96
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.95
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
PF05804708 KAP: Kinesin-associated protein (KAP) 99.87
KOG1048717 consensus Neural adherens junction protein Plakoph 99.8
PLN032101153 Resistant to P. syringae 6; Provisional 99.76
PLN032101153 Resistant to P. syringae 6; Provisional 99.75
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.74
KOG1048717 consensus Neural adherens junction protein Plakoph 99.67
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.62
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.62
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.61
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.59
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.58
PRK09687280 putative lyase; Provisional 99.57
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.56
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.56
KOG1293 678 consensus Proteins containing armadillo/beta-caten 99.56
PRK09687280 putative lyase; Provisional 99.55
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.53
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.52
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.52
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.51
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.51
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.46
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.45
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.44
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.4
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.39
KOG4341483 consensus F-box protein containing LRR [General fu 99.36
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.36
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.28
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.27
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.27
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.25
KOG4341483 consensus F-box protein containing LRR [General fu 99.24
PTZ00429 746 beta-adaptin; Provisional 99.24
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.24
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.23
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.2
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.19
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.18
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.16
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.13
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.1
KOG1293 678 consensus Proteins containing armadillo/beta-caten 99.08
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 99.07
PTZ00429 746 beta-adaptin; Provisional 99.07
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.05
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 99.03
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.96
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.95
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 98.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.88
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.86
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.84
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.83
COG5369743 Uncharacterized conserved protein [Function unknow 98.82
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.82
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.82
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.82
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 98.82
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.81
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.81
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.77
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.72
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.61
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.6
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.56
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.56
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.56
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.54
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.47
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.46
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.46
KOG1242569 consensus Protein containing adaptin N-terminal re 98.44
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.44
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.43
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.41
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.39
KOG1242 569 consensus Protein containing adaptin N-terminal re 98.39
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.38
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.36
TIGR02270410 conserved hypothetical protein. Members are found 98.34
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.33
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.24
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.23
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 98.22
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.21
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.2
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.2
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.19
TIGR02270 410 conserved hypothetical protein. Members are found 98.18
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.18
KOG0212 675 consensus Uncharacterized conserved protein [Funct 98.18
PF05536543 Neurochondrin: Neurochondrin 98.16
KOG0617264 consensus Ras suppressor protein (contains leucine 98.16
KOG2259 823 consensus Uncharacterized conserved protein [Funct 98.13
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.11
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.09
COG5369743 Uncharacterized conserved protein [Function unknow 98.08
PRK15386426 type III secretion protein GogB; Provisional 98.08
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.08
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.07
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.06
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.06
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.04
PRK15386426 type III secretion protein GogB; Provisional 98.04
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.04
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.0
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.95
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.95
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 97.93
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.93
KOG4646173 consensus Uncharacterized conserved protein, conta 97.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.9
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.88
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.86
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.85
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.8
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.8
KOG0212675 consensus Uncharacterized conserved protein [Funct 97.78
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.76
KOG4646173 consensus Uncharacterized conserved protein, conta 97.75
KOG0617264 consensus Ras suppressor protein (contains leucine 97.74
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.73
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.72
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.7
PF05536 543 Neurochondrin: Neurochondrin 97.69
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.67
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.65
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.63
KOG4535728 consensus HEAT and armadillo repeat-containing pro 97.63
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.63
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.57
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 97.55
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.54
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.53
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.53
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.53
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.48
KOG0567289 consensus HEAT repeat-containing protein [General 97.45
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.43
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.43
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.39
KOG4535728 consensus HEAT and armadillo repeat-containing pro 97.38
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.37
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.33
KOG0567289 consensus HEAT repeat-containing protein [General 97.32
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.3
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 97.27
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.26
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 97.24
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.2
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.19
KOG4237498 consensus Extracellular matrix protein slit, conta 97.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.18
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.16
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.16
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 97.12
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.05
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 96.97
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.94
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.92
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.91
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 96.73
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 96.72
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.7
COG5656 970 SXM1 Importin, protein involved in nuclear import 96.63
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.58
PF05004309 IFRD: Interferon-related developmental regulator ( 96.58
KOG2062 929 consensus 26S proteasome regulatory complex, subun 96.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.48
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.48
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.47
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 96.4
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 96.39
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.36
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.24
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.23
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.22
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.2
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 96.13
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.12
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.11
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.11
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 96.08
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 96.0
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.94
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 95.82
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.81
KOG2032533 consensus Uncharacterized conserved protein [Funct 95.8
KOG2025 892 consensus Chromosome condensation complex Condensi 95.79
PF05004309 IFRD: Interferon-related developmental regulator ( 95.74
KOG4237498 consensus Extracellular matrix protein slit, conta 95.68
KOG04141251 consensus Chromosome condensation complex Condensi 95.62
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 95.62
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 95.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.55
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.5
KOG4653982 consensus Uncharacterized conserved protein [Funct 95.48
PRK14707 2710 hypothetical protein; Provisional 95.45
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 95.45
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.35
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.32
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.24
KOG3036293 consensus Protein involved in cell differentiation 95.22
PLN03150623 hypothetical protein; Provisional 95.13
KOG4653982 consensus Uncharacterized conserved protein [Funct 95.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.02
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.01
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.01
KOG2956516 consensus CLIP-associating protein [General functi 95.01
PRK14707 2710 hypothetical protein; Provisional 94.95
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.89
KOG2062 929 consensus 26S proteasome regulatory complex, subun 94.75
KOG3036293 consensus Protein involved in cell differentiation 94.59
KOG0414 1251 consensus Chromosome condensation complex Condensi 94.58
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 94.45
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 94.35
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 94.3
PF14500262 MMS19_N: Dos2-interacting transcription regulator 94.18
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 94.13
KOG2137700 consensus Protein kinase [Signal transduction mech 94.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.08
COG50981128 Chromosome condensation complex Condensin, subunit 94.01
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.91
PLN03150623 hypothetical protein; Provisional 93.85
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 93.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.71
KOG2025 892 consensus Chromosome condensation complex Condensi 93.68
COG5116 926 RPN2 26S proteasome regulatory complex component [ 93.46
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 93.26
PF13251182 DUF4042: Domain of unknown function (DUF4042) 93.18
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 93.13
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 93.09
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.07
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 93.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.94
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 92.93
KOG1243 690 consensus Protein kinase [General function predict 92.83
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 92.79
KOG1243690 consensus Protein kinase [General function predict 92.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 92.67
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 92.57
KOG2956516 consensus CLIP-associating protein [General functi 92.52
PF11701157 UNC45-central: Myosin-binding striated muscle asse 92.45
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 92.18
KOG0413 1529 consensus Uncharacterized conserved protein relate 92.0
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 91.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 91.87
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 91.76
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 91.75
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 91.58
KOG2032533 consensus Uncharacterized conserved protein [Funct 91.47
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 91.31
KOG1566342 consensus Conserved protein Mo25 [Function unknown 91.26
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 91.22
PF14500262 MMS19_N: Dos2-interacting transcription regulator 91.18
PF08045257 CDC14: Cell division control protein 14, SIN compo 90.97
KOG2123388 consensus Uncharacterized conserved protein [Funct 90.95
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 90.73
COG50981128 Chromosome condensation complex Condensin, subunit 90.7
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 90.47
KOG1566342 consensus Conserved protein Mo25 [Function unknown 90.44
COG5116926 RPN2 26S proteasome regulatory complex component [ 90.44
PF11701157 UNC45-central: Myosin-binding striated muscle asse 90.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.24
KOG2123388 consensus Uncharacterized conserved protein [Funct 90.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.73
COG5656 970 SXM1 Importin, protein involved in nuclear import 89.64
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 89.55
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 89.14
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 89.13
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 89.09
KOG0413 1529 consensus Uncharacterized conserved protein relate 89.0
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.99
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 88.65
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 88.47
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 88.06
KOG2933334 consensus Uncharacterized conserved protein [Funct 87.86
KOG2137700 consensus Protein kinase [Signal transduction mech 87.7
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 87.68
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 87.52
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 87.47
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 87.33
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 87.15
KOG2933334 consensus Uncharacterized conserved protein [Funct 86.72
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 86.51
PF1036392 DUF2435: Protein of unknown function (DUF2435) 86.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 86.41
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 86.37
KOG1848 1610 consensus Uncharacterized conserved protein [Funct 86.34
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 86.28
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 86.28
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 85.99
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 85.71
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 85.71
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 85.48
PF13251182 DUF4042: Domain of unknown function (DUF4042) 85.24
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 84.49
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 84.28
smart00638574 LPD_N Lipoprotein N-terminal Domain. 84.05
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 83.81
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.8
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 83.24
cd03561133 VHS VHS domain family; The VHS domain is present i 83.05
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 83.01
PF1036392 DUF2435: Protein of unknown function (DUF2435) 82.92
PF08167165 RIX1: rRNA processing/ribosome biogenesis 82.87
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 82.35
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 81.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 81.83
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 81.53
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 81.35
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 80.12
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 80.1
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information 
Probab=100.00  E-value=6.9e-55  Score=405.39  Aligned_cols=399  Identities=52%  Similarity=0.717  Sum_probs=373.5

Q ss_pred             CHHHHHhhhcCCCHHHHHHHHHHHHHhc----CCChHHHHhcCchHHHHhhccCCCCHHHHHHHHHHHHHHHh---hhhH
Q 004225          360 SLPGMLAGVWSDDSGLQLEATTWFRKLL----LPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIAS---ENTN  432 (767)
Q Consensus       360 ~i~~l~~~l~s~~~~~~~~a~~~L~~l~----~~~~~~i~~~g~i~~L~~ll~~~~~~~~~~~a~~~L~~l~~---~~~~  432 (767)
                      .+|.+...+.|+|.+.+.+|...++++.    +++.+.++..|++|.++++++.......+.+|+|+|.|+++   ...+
T Consensus        72 elp~lt~~l~SdDie~q~qav~kFR~~LS~E~~PPIq~VIdaGvVpRfvefm~~~q~~mlqfEAaWalTNiaSGtt~QTk  151 (526)
T COG5064          72 ELPQLTQQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFMDEIQRDMLQFEAAWALTNIASGTTQQTK  151 (526)
T ss_pred             hhHHHHHHHhhhHHHHHHHHHHHHHHHhccccCCCchhHHhccccHHHHHHHHhcchhHHHHHHHHHHhhhccCcccceE
Confidence            6899999999999999999999999988    78899999999999999999655436889999999999999   6677


Q ss_pred             HHHhCCChHHHHHhhCCCCHHHHHHHHHHHHHHhcCCchhHHHHHhcCCHHHHHHHHccC-CChHHHHHHHHHHHhhcCC
Q 004225          433 VVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKH-AKPSMLRNATKTLSRFCQG  511 (767)
Q Consensus       433 ~~~~~~~l~~L~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~ll~~~-~~~~~~~~~~~~L~~l~~~  511 (767)
                      .+++.|++|.++++|.+++.++++++.|+|+|++.+++.+|+.+++.|++++++.++.++ .+..+.+++.|+|+|+|++
T Consensus       152 vVvd~~AVPlfiqlL~s~~~~V~eQavWALGNiAGDS~~~RD~vL~~galeplL~ll~ss~~~ismlRn~TWtLSNlcRG  231 (526)
T COG5064         152 VVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLLSSAIHISMLRNATWTLSNLCRG  231 (526)
T ss_pred             EEEeCCchHHHHHHHcCchHHHHHHHHHHhccccCCchhHHHHHHhcCchHHHHHHHHhccchHHHHHHhHHHHHHhhCC
Confidence            788999999999999999999999999999999999999999999999999999999533 3468999999999999999


Q ss_pred             C-CCCCccchhchHHHHHHHhcCCCHHHHHHHHHHHHhhccCChhHHHHHHhcCcHHHHHHHhcCCCCCCcccchHHHHH
Q 004225          512 K-PEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLWTV  590 (767)
Q Consensus       512 ~-~~~~~~~~~~~i~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~lL~~~~~~~~v~~~a~~~L  590 (767)
                      . |.+....+..++|.|.+++.+.|+++..+|+|++++++++..+.++.+++.|+.+.|+++|.+++.  .++.+|++.+
T Consensus       232 knP~P~w~~isqalpiL~KLiys~D~evlvDA~WAiSYlsDg~~E~i~avld~g~~~RLvElLs~~sa--~iqtPalR~v  309 (526)
T COG5064         232 KNPPPDWSNISQALPILAKLIYSRDPEVLVDACWAISYLSDGPNEKIQAVLDVGIPGRLVELLSHESA--KIQTPALRSV  309 (526)
T ss_pred             CCCCCchHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHHhccCcHHHHHHHHhcCCcHHHHHHhcCccc--cccCHHHHhh
Confidence            8 888999999999999999999999999999999999999999999999999999999999999999  9999999999


Q ss_pred             hhhhccCCcceeeh------------------hhhHHHHHHHhhhccCCHHHHHHHHHcCCHHHHHHHHhcCCchhHHHH
Q 004225          591 RYIVKGDGFLTQCT------------------GIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKKEA  652 (767)
Q Consensus       591 ~~l~~~~~~~~~~l------------------~v~~~a~~~l~nl~~~~~~~~~~~~~~~~i~~L~~ll~~~~~~v~~~a  652 (767)
                      +|+..+++.+++.+                  .++++|||+++||++++.++++++++++++|+|+.+|...+..+|++|
T Consensus       310 GNIVTG~D~QTqviI~~G~L~a~~~lLs~~ke~irKEaCWTiSNITAGnteqiqavid~nliPpLi~lls~ae~k~kKEA  389 (526)
T COG5064         310 GNIVTGSDDQTQVIINCGALKAFRSLLSSPKENIRKEACWTISNITAGNTEQIQAVIDANLIPPLIHLLSSAEYKIKKEA  389 (526)
T ss_pred             cCeeecCccceehheecccHHHHHHHhcChhhhhhhhhheeecccccCCHHHHHHHHhcccchHHHHHHHHHHHHHHHHH
Confidence            99999999999887                  899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCC--CHHHHHHHHHcCChHHHHhhhcCCCHHHHHHHHHHHHHHHHhhhhhhccCCccccccHHHHHHHhhc
Q 004225          653 ARAISNAISGG--THEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAE  730 (767)
Q Consensus       653 ~~~L~nl~~~~--~~~~~~~l~~~~~i~~L~~ll~~~~~~v~~~al~aL~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~g  730 (767)
                      |||+.|...++  -|+.++++++.|++++|+++|.-.+..+.+.++.++.++.+.++......  |-.++.|+.+++++|
T Consensus       390 CWAisNatsgg~~~PD~iryLv~qG~IkpLc~~L~~~dNkiiev~LD~~eniLk~Ge~d~~~~--~~nin~ya~~vE~Ag  467 (526)
T COG5064         390 CWAISNATSGGLNRPDIIRYLVSQGFIKPLCDLLDVVDNKIIEVALDAIENILKVGEQDRLRY--GKNINIYAVYVEKAG  467 (526)
T ss_pred             HHHHHhhhccccCCchHHHHHHHccchhHHHHHHhccCccchhhhHHHHHHHHhhhhHHHHhc--cCCccHHHHHHHhcc
Confidence            99999999876  58899999999999999999999998999999999999999877665443  226788999999999


Q ss_pred             hHHHHHHHhcCCChHHHHHHHHHHHHhcCCCc
Q 004225          731 GFKKIEDLKRHDSNGICEKAVKILEIYWSCGV  762 (767)
Q Consensus       731 ~~~~l~~l~~~~~~~v~~~a~~~l~~~~~~~~  762 (767)
                      +++.++.++++.|..++.+|..++++||..|+
T Consensus       468 gmd~I~~~Q~s~n~~iy~KAYsIIe~fFgeeD  499 (526)
T COG5064         468 GMDAIHGLQDSVNRTIYDKAYSIIEKFFGEED  499 (526)
T ss_pred             cHHHHHHhhhccccHHHHHHHHHHHHHcccch
Confidence            99999999999999999999999999998764

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1848 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query767
4b8j_A528 Rimp_alpha1a Length = 528 1e-140
2yns_A490 Rimp_alpha_b54nls Length = 490 1e-139
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 3e-91
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 3e-91
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 2e-84
1wa5_B530 Crystal Structure Of The Exportin Cse1p Complexed W 2e-84
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 4e-84
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 9e-84
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-83
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 2e-83
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 2e-83
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 1e-67
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 1e-67
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 2e-67
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 2e-67
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 2e-67
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 3e-67
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 3e-67
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 3e-67
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 3e-67
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 4e-67
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 5e-67
1ial_A453 Importin Alpha, Mouse Length = 453 5e-67
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 5e-67
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 6e-67
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 7e-67
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 8e-66
3fex_C 467 Crystal Structure Of The Cbc-Importin Alpha Complex 2e-04
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 3e-23
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 2e-17
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 6e-18
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 2e-17
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 1e-12
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 3e-09
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 2e-17
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 3e-15
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 2e-17
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 6e-13
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure 
Iteration: 1

 Score =  496 bits (1276), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 270/429 (62%), Positives = 311/429 (72%), Gaps = 30/429 (6%)
Query: 356 QKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLL----PPSEKVIQSGVVARFVEFLTRED 411
           +KL SLP M+ GV+SDD+ LQLEATT FRKLL     PP E+VIQSGVV RFV+FLTRED
Sbjct: 71  KKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRFVQFLTRED 130
Query: 412 NPQLQLEAARALTNIAS---ENTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARS 468
            PQLQ EAA ALTNIAS   ENT VVID GAVPIFVKLL S SDDVRE+AVWALGN+A  
Sbjct: 131 FPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVWALGNVAGD 190
Query: 469 SPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPPFDQVRPALPALA 528
           SP+ RDLVL+  AL+PLLAQLN+H K SMLRNAT TLS FC+GKP+P F+Q RPALPALA
Sbjct: 191 SPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFEQTRPALPALA 250
Query: 529 QLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCXXXXXXXXXXXXXXXXXXXXXW 588
           +L+HSND +VL  AC ALS LSDGTNDKIQAVIEA VC                      
Sbjct: 251 RLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALR-- 308
Query: 589 TVRYIVKGDGFLTQC-------------------TGIAKEACRTISNITAGNREQIQVVI 629
           TV  IV GD   TQC                     I KEAC TISNITAGN++QIQ VI
Sbjct: 309 TVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVI 368
Query: 630 DAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADP 689
           +AG+IGPLV+LLQ AEF  KKEAA AISNA SGG+H+QIKYLV +GCIKPLCDLL+  D 
Sbjct: 369 NAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDI 428
Query: 690 EIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRHDSNGICEK 749
            IVT+CL+GLENILKVGE +      +   N ++++++ AEG +KIE+L+ HD+N I EK
Sbjct: 429 RIVTVCLEGLENILKVGETDKTLAAGD--VNVFSQMIDEAEGLEKIENLQSHDNNEIYEK 486
Query: 750 AVKILEIYW 758
           AVKILE YW
Sbjct: 487 AVKILEAYW 495
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query767
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-131
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-35
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-05
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-125
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 6e-37
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 8e-29
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-121
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 3e-32
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 3e-20
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-06
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-63
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-57
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-24
4db8_A 252 Armadillo-repeat protein; solenoid repeat, de novo 8e-09
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-62
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 6e-50
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-48
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 3e-46
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-42
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-11
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-60
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-47
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-43
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-43
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-42
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-28
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-14
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-58
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-52
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-42
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-11
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-55
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-52
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-40
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-31
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-53
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 9e-47
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-42
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-42
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-25
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-21
3nmz_A458 APC variant protein; protein-protein complex, arma 9e-17
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-42
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 9e-20
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 7e-18
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 5e-14
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-39
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 7e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-17
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-10
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-33
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-20
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-12
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-32
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 9e-30
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-10
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-07
2db0_A253 253AA long hypothetical protein; heat repeats, hel 2e-18
2db0_A253 253AA long hypothetical protein; heat repeats, hel 2e-10
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 4e-16
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 6e-13
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-12
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-11
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 8e-14
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-11
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-13
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 6e-12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-11
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-12
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-08
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 6e-08
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 7e-06
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 2e-10
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 4e-10
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 2e-05
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 2e-09
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 2e-08
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 5e-08
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 2e-05
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 4e-08
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 5e-05
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 7e-08
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 5e-06
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 2e-05
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 5e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
1qgr_A 876 Protein (importin beta subunit); transport recepto 5e-05
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 1e-04
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 4e-04
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
 Score =  396 bits (1018), Expect = e-131
 Identities = 215/439 (48%), Positives = 262/439 (59%), Gaps = 31/439 (7%)

Query: 349 DDLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLLL----PPSEKVIQS-GVVARF 403
            +        V    M+  ++S     QL AT  FRKLL     PP ++VI + GVVARF
Sbjct: 10  INNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARF 69

Query: 404 VEFLTREDNPQLQLEAARALTNIAS---ENTNVVIDGGAVPIFVKLLSSPSDDVREKAVW 460
           VEFL R++N  LQ E+A  LTNIAS     T +VI  GAVPIF++LLSS  +DV+E+AVW
Sbjct: 70  VEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVW 129

Query: 461 ALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGKPEPP-FDQ 519
           ALGNIA  S   RD VL    L PLL   +K  + +M RNA   LS  C+GK  PP F +
Sbjct: 130 ALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAK 189

Query: 520 VRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPF 579
           V P L  L+ L+  +D DVL  AC ALS LSDG NDKIQAVI+A VC RLV+LL+H    
Sbjct: 190 VSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYK 249

Query: 580 PFGLTPPLWTVRYIVKGDGFLTQ------------------CTGIAKEACRTISNITAGN 621
              ++P L  V  IV GD   TQ                     I KEAC TISNITAGN
Sbjct: 250 --VVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGN 307

Query: 622 REQIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTHEQIKYLVRKGCIKPLC 681
           R QIQ VIDA +   L+ +LQ AEF T+KEAA AI+NA SGG+ EQIKYLV  GCIKPLC
Sbjct: 308 RAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLC 367

Query: 682 DLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRH 741
           DLL   D +IV + L GLENIL++GE E          N Y  L+E A G  KIE L+ H
Sbjct: 368 DLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTG--INPYCALIEEAYGLDKIEFLQSH 425

Query: 742 DSNGICEKAVKILEIYWSC 760
           ++  I +KA  ++E Y+  
Sbjct: 426 ENQEIYQKAFDLIEHYFGT 444
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Length = 591 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Length = 265 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Length = 621 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query767
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 99.98
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.98
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.98
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.97
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.97
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.97
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.96
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.96
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.96
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.96
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.92
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.92
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.88
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.86
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.86
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.86
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.86
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.84
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.8
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.72
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.69
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.67
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.65
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.65
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.65
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.65
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.65
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.64
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.64
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.63
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.63
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.63
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.63
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.62
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.62
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.62
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.6
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.59
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.58
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.58
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.56
3grl_A 651 General vesicular transport factor P115; vesicle t 99.56
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.56
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.56
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.55
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.55
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.55
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.55
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.54
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.54
3grl_A651 General vesicular transport factor P115; vesicle t 99.53
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.53
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.53
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.52
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.51
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.51
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.5
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.47
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.46
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.45
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.45
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.44
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.44
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.44
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.44
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.44
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.44
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.42
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.42
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.41
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.41
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.4
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.39
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.36
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.35
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.35
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.33
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.33
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.31
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.31
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.3
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.3
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.3
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.29
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.29
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.29
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.28
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.28
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.28
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.27
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.27
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.25
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.25
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.22
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.13
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.11
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.06
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.03
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.97
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.97
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.97
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.94
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.9
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.88
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 98.88
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.79
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.77
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 98.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.72
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.69
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 98.61
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.58
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.54
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.54
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.53
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.51
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.5
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.46
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.43
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 98.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.43
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.42
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.39
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.38
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.37
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.34
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.29
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.18
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.15
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.11
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.1
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.1
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.08
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.0
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.96
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.91
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.87
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.82
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.76
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.68
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.65
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.58
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.57
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 97.56
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.44
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.37
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 97.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.28
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.19
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.13
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.13
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.1
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.0
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.98
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.83
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.82
2x19_B 963 Importin-13; nuclear transport, protein transport; 96.8
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 96.79
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 96.73
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.73
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 96.69
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.61
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.51
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.5
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.31
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.3
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.2
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 96.19
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.13
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 96.03
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 95.84
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.76
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.64
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 95.52
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 95.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.1
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 94.9
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 94.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.44
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 94.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.0
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 94.0
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 93.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.29
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 92.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 91.96
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 91.54
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.93
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 90.86
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 90.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 90.37
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 90.24
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 89.86
1vdy_A140 Hypothetical protein (RAFL09-17-B18); structural g 88.02
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 86.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 84.68
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 83.5
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 82.87
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 82.56
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 81.42
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 81.32
3g2s_A149 C-terminal fragment of sortilin-related receptor; 81.23
3qml_C 315 Protein SLS1, nucleotide exchange factor SIL1; arm 80.52
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
Probab=100.00  E-value=3.5e-46  Score=410.24  Aligned_cols=393  Identities=44%  Similarity=0.660  Sum_probs=362.3

Q ss_pred             CHHHHHhhhcCCCHHHHHHHHHHHHHhc----CCChHHHHhcCchHHHHhhccCCCCHHHHHHHHHHHHHHHh---hhhH
Q 004225          360 SLPGMLAGVWSDDSGLQLEATTWFRKLL----LPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIAS---ENTN  432 (767)
Q Consensus       360 ~i~~l~~~l~s~~~~~~~~a~~~L~~l~----~~~~~~i~~~g~i~~L~~ll~~~~~~~~~~~a~~~L~~l~~---~~~~  432 (767)
                      .++.+++.+.|+|++.+..|+..++++.    +++.+.+++.|++|.|+++|++++++.+|..|+|+|+|++.   +++.
T Consensus        58 ~i~~~v~~l~s~d~~~q~~a~~~~rklls~e~~ppi~~ii~~G~ip~LV~lL~~~~~~~lq~~Aa~aL~nias~~~e~~~  137 (510)
T 3ul1_B           58 SVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTK  137 (510)
T ss_dssp             CHHHHHHHHTSSCHHHHHHHHHHHHHHHTCSSCCCHHHHHHTTHHHHHHHHTTCTTCHHHHHHHHHHHHHHHTSCHHHHH
T ss_pred             hHHHHHHHhcCCCHHHHHHHHHHHHHHhcCCCCchHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCHHHHH
Confidence            5899999999999999999999999987    67789999999999999999877669999999999999998   7888


Q ss_pred             HHHhCCChHHHHHhhCCCCHHHHHHHHHHHHHHhcCCchhHHHHHhcCCHHHHHHHHccCC-----ChHHHHHHHHHHHh
Q 004225          433 VVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHA-----KPSMLRNATKTLSR  507 (767)
Q Consensus       433 ~~~~~~~l~~L~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~ll~~~~-----~~~~~~~~~~~L~~  507 (767)
                      .+++.|++|.|+.+|.+++++++++|+|+|+|++.+++..++.+.+.|++++++.++. ..     ...+++.++|++++
T Consensus       138 ~vv~~GaIp~Lv~lL~s~~~~v~e~A~~aL~nLa~d~~~~r~~v~~~G~i~~Ll~lL~-~~~~~~~~~~~~~~a~~~L~n  216 (510)
T 3ul1_B          138 AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLA-VPDLSTLACGYLRNLTWTLSN  216 (510)
T ss_dssp             HHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTC-SSCGGGSCHHHHHHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHHcCCCHHHHHHHHHHHHHHHhCCHHHHHHHHHcCChHHHHHHHH-hccchhhhHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999994 43     34578999999999


Q ss_pred             hcCCC-CCCCccchhchHHHHHHHhcCCCHHHHHHHHHHHHhhccCChhHHHHHHhcCcHHHHHHHhcCCCCCCcccchH
Q 004225          508 FCQGK-PEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPP  586 (767)
Q Consensus       508 l~~~~-~~~~~~~~~~~i~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~lL~~~~~~~~v~~~a  586 (767)
                      ++.+. +........+++|.|+.++.+++++++..++|+|.+++...++..+.+.+.|+++.|+.++.+.+.  .++..|
T Consensus       217 l~~~~~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~A~~aL~~L~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~--~v~~~a  294 (510)
T 3ul1_B          217 LCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATEL--PIVTPA  294 (510)
T ss_dssp             HHCCCSSCCCHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTSSCHHHHHHHHTTTCHHHHHHHHTCSCH--HHHHHH
T ss_pred             HhhcccchhHHHHHHhHHHHHHHHHhcCCHHHHHHHHHHHHHHhhchhhhHHHHHhcccchhhhhhhcCCCh--hhhhHH
Confidence            99987 555666778999999999999999999999999999999998888889999999999999999998  999999


Q ss_pred             HHHHhhhhccCCcceeeh------------------hhhHHHHHHHhhhccCCHHHHHHHHHcCCHHHHHHHHhcCCchh
Q 004225          587 LWTVRYIVKGDGFLTQCT------------------GIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFT  648 (767)
Q Consensus       587 ~~~L~~l~~~~~~~~~~l------------------~v~~~a~~~l~nl~~~~~~~~~~~~~~~~i~~L~~ll~~~~~~v  648 (767)
                      +++++|++.+++...+.+                  .+++.|+|+++|++.++....+.+++.|+++.|+.++++++.++
T Consensus       295 l~aL~nl~~~~~~~~~~i~~~g~l~~L~~LL~~~~~~v~~~A~~aL~nl~a~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v  374 (510)
T 3ul1_B          295 LRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKT  374 (510)
T ss_dssp             HHHHHHHTTSCHHHHHHHHHTTGGGGCC-CTTCSSHHHHHHHHHHHHHHTTSCHHHHHHHHHTTHHHHHHHHHHSSCHHH
T ss_pred             HHHHHHhhcCCHHHHHHHhhccchHHHHHHhcCCCHHHHHHHHHHHHHHHcCcHHHHHHHHhcCCHHHHHHHHcCCCHHH
Confidence            999999998776554433                  88999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcCCCHHHHHHHHHcCChHHHHhhhcCCCHHHHHHHHHHHHHHHHhhhhhhccCCccccccHHHHHHHh
Q 004225          649 KKEAARAISNAISGGTHEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEA  728 (767)
Q Consensus       649 ~~~a~~~L~nl~~~~~~~~~~~l~~~~~i~~L~~ll~~~~~~v~~~al~aL~~l~~~~~~~~~~~~~~~~~~~~~~~l~~  728 (767)
                      |++|+|+|+|++.+++.+++.++++.|++++|+++++++|++++..++++|.++++.++...       ..+.++..+++
T Consensus       375 ~~~Aa~aL~Nl~~~~~~~~~~~L~~~g~i~~L~~LL~~~d~~i~~~~L~aL~nil~~~~~~~-------~~~~~~~~iee  447 (510)
T 3ul1_B          375 QKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLG-------ETEKLSIMIEE  447 (510)
T ss_dssp             HHHHHHHHHHHHHHCCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHHHHHHTTT-------CHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHccCCHHHHHHHHHCCCHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhHhcc-------chHHHHHHHHH
Confidence            99999999999998889999999999999999999999999999999999999998776433       45678999999


Q ss_pred             hchHHHHHHHhcCCChHHHHHHHHHHHHhcCCCc
Q 004225          729 AEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGV  762 (767)
Q Consensus       729 ~g~~~~l~~l~~~~~~~v~~~a~~~l~~~~~~~~  762 (767)
                      +|++++|+.|++|+|.+|+++|..+|++||+.|+
T Consensus       448 ~ggl~~ie~Lq~~~n~~i~~~A~~iie~yf~~~~  481 (510)
T 3ul1_B          448 CGGLDKIEALQRHENESVYKASLNLIEKYFSVEE  481 (510)
T ss_dssp             TTHHHHHHHGGGCSSHHHHHHHHHHHHHHCC---
T ss_pred             cCcHHHHHHHHcCCCHHHHHHHHHHHHHHCCCcc
Confidence            9999999999999999999999999999998653
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1vdy_A Hypothetical protein (RAFL09-17-B18); structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Arabidopsis thaliana} PDB: 2dcp_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 767
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-69
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-61
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-08
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-26
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 9e-15
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-10
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 8e-08
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-15
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-09
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 5e-12
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 0.002
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-11
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 8e-09
d2vgla_ 584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 1e-11
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-11
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-07
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-05
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-04
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-11
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-06
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-05
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-05
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 1e-07
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 4e-06
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 3e-04
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 5e-04
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 5e-06
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 2e-05
d1te4a_111 a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium 2e-05
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 0.004
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  234 bits (598), Expect = 2e-69
 Identities = 206/438 (47%), Positives = 261/438 (59%), Gaps = 33/438 (7%)

Query: 350 DLNTTIQKLVSLPGMLAGVWSDDSGLQLEATTWFRKLL----LPPSEKVIQSGVVARFVE 405
           D     Q    LP M   + SDD   QL AT  FR++L     PP + VIQ+GVV R VE
Sbjct: 67  DQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVE 126

Query: 406 FLTREDNPQLQLEAARALTNIASENTN---VVIDGGAVPIFVKLLSSPSDDVREKAVWAL 462
           F+       LQLEAA ALTNIAS  +    VV+D  AVP+F++LL + S +V+E+A+WAL
Sbjct: 127 FMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWAL 186

Query: 463 GNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFCQGK-PEPPFDQVR 521
           GN+A  S   RD VL   A+ P+L  L    KPS++R AT TLS  C+GK P+P +  V 
Sbjct: 187 GNVAGDSTDYRDYVLQCNAMEPIL-GLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVS 245

Query: 522 PALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPF 581
            ALP LA+L++S D + L  AC A+S LSDG  + IQAVI+  +  RLV+LL H      
Sbjct: 246 QALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQ 305

Query: 582 GLTPPLWTVRYIVKGDGFLTQCT------------------GIAKEACRTISNITAGNRE 623
             TP L  V  IV G+   TQ                     I KEAC TISNITAGN E
Sbjct: 306 --TPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTE 363

Query: 624 QIQVVIDAGVIGPLVDLLQNAEFFTKKEAARAISNAISGGTH--EQIKYLVRKGCIKPLC 681
           QIQ VIDA +I PLV LL+ AE+ TKKEA  AISNA SGG    + I+YLV +GCIKPLC
Sbjct: 364 QIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLC 423

Query: 682 DLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEAAEGFKKIEDLKRH 741
           DLL  AD  I+ + L  LENILK+GEA+      N   N  A  +E A G +KI + +++
Sbjct: 424 DLLEIADNRIIEVTLDALENILKMGEADKEARGLN--INENADFIEKAGGMEKIFNCQQN 481

Query: 742 DSNGICEKAVKILEIYWS 759
           +++ I EKA KI+E Y+ 
Sbjct: 482 ENDKIYEKAYKIIETYFG 499
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 111 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query767
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.96
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.96
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.72
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.69
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.59
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.58
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.19
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.17
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.12
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.11
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.1
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.08
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.08
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.06
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.06
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.05
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.05
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.03
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.02
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.02
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.97
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.96
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.96
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.84
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.77
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.73
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.69
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.66
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.48
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.29
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.15
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.1
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.09
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.09
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.97
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.82
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.67
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.13
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.12
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 96.32
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.3
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.28
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 95.12
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 94.4
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 91.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 90.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 90.43
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 89.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 89.79
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 89.71
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 89.5
d2bnxa1 343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 87.34
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 85.91
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 83.39
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 80.55
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=4.3e-38  Score=345.83  Aligned_cols=401  Identities=51%  Similarity=0.724  Sum_probs=362.2

Q ss_pred             hhcCHHHHHhhhcCCCHHHHHHHHHHHHHhc----CCChHHHHhcCchHHHHhhccCCCCHHHHHHHHHHHHHHHh---h
Q 004225          357 KLVSLPGMLAGVWSDDSGLQLEATTWFRKLL----LPPSEKVIQSGVVARFVEFLTREDNPQLQLEAARALTNIAS---E  429 (767)
Q Consensus       357 ~~~~i~~l~~~l~s~~~~~~~~a~~~L~~l~----~~~~~~i~~~g~i~~L~~ll~~~~~~~~~~~a~~~L~~l~~---~  429 (767)
                      ..+.++.++..+.++++..+..|+..++++.    .++.+.+++.|+++.|+++++.+.++.++..|+++|.+++.   .
T Consensus        74 ~~~~l~~~~~~~~s~~~~~~~~a~~~~r~~ls~~~~~~i~~ii~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~  153 (503)
T d1wa5b_          74 LQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSA  153 (503)
T ss_dssp             --CCHHHHHHHHSCSSHHHHHHHHHHHHHHTCCSSSCSHHHHHHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHH
T ss_pred             HHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHhcCCCchHHHHHHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHH
Confidence            3457999999999999999999999999987    55678899999999999999977668899999999999998   5


Q ss_pred             hhHHHHhCCChHHHHHhhCCCCHHHHHHHHHHHHHHhcCCchhHHHHHhcCCHHHHHHHHccCCChHHHHHHHHHHHhhc
Q 004225          430 NTNVVIDGGAVPIFVKLLSSPSDDVREKAVWALGNIARSSPRDRDLVLSEKALIPLLAQLNKHAKPSMLRNATKTLSRFC  509 (767)
Q Consensus       430 ~~~~~~~~~~l~~L~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~ll~~~~~~~~~~~~~~~L~~l~  509 (767)
                      ....+.+.|+++.++.+|.+++.+++..|+|+|+|++.+++..++.+.+.|+++.++.++ .+.+..+++.++|++.+++
T Consensus       154 ~~~~~~~~g~i~~l~~lL~s~~~~i~~~a~~~L~nia~~~~~~r~~l~~~~~~~~L~~ll-~~~~~~~~~~~~~~l~nl~  232 (503)
T d1wa5b_         154 QTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-NSNKPSLIRTATWTLSNLC  232 (503)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHGG-GSCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhCCChHHHHHHhcCCChhHHHHHHHHHHHHhhhhHHHHHHHHhhcccccchhhc-ccCCHHHHHHHHHHHHHHh
Confidence            677788999999999999999999999999999999999999999999999999999999 7888999999999999999


Q ss_pred             CCC-CCCCccchhchHHHHHHHhcCCCHHHHHHHHHHHHhhccCChhHHHHHHhcCcHHHHHHHhcCCCCCCcccchHHH
Q 004225          510 QGK-PEPPFDQVRPALPALAQLVHSNDNDVLRYACEALSCLSDGTNDKIQAVIEADVCPRLVKLLLHPLPFPFGLTPPLW  588 (767)
Q Consensus       510 ~~~-~~~~~~~~~~~i~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~lL~~~~~~~~v~~~a~~  588 (767)
                      ... +........+++|.+..++.++|.+++..++|++.+++...++....+.+.++++.++.++.+++.  .++..|++
T Consensus       233 ~~~~~~~~~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~~--~v~~~al~  310 (503)
T d1wa5b_         233 RGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHEST--LVQTPALR  310 (503)
T ss_dssp             CCSSSCCCHHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHGGGCSCH--HHHHHHHH
T ss_pred             cCCccchHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhccCCchhhhhhhhhhhhhhhhhcccCCch--hhhhhHHH
Confidence            876 555666778999999999999999999999999999999988888889999999999999999998  99999999


Q ss_pred             HHhhhhccCCcceeeh------------------hhhHHHHHHHhhhccCCHHHHHHHHHcCCHHHHHHHHhcCCchhHH
Q 004225          589 TVRYIVKGDGFLTQCT------------------GIAKEACRTISNITAGNREQIQVVIDAGVIGPLVDLLQNAEFFTKK  650 (767)
Q Consensus       589 ~L~~l~~~~~~~~~~l------------------~v~~~a~~~l~nl~~~~~~~~~~~~~~~~i~~L~~ll~~~~~~v~~  650 (767)
                      ++++++.+.+.....+                  .++++++|+++|++.++++....+++.|+++.+++++.+.+.+++.
T Consensus       311 ~l~nl~~~~~~~~~~~~~~~~l~~l~~ll~~~~~~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~  390 (503)
T d1wa5b_         311 AVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKK  390 (503)
T ss_dssp             HHHHHTTSCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHH
T ss_pred             HHHHHHHHHHHHHHhhhccchHHHHHHHhcCCCHHHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccCChhHHH
Confidence            9999998777655443                  7789999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCC--CHHHHHHHHHcCChHHHHhhhcCCCHHHHHHHHHHHHHHHHhhhhhhccCCccccccHHHHHHHh
Q 004225          651 EAARAISNAISGG--THEQIKYLVRKGCIKPLCDLLLYADPEIVTICLKGLENILKVGEAEMNTGTANRYFNHYARLVEA  728 (767)
Q Consensus       651 ~a~~~L~nl~~~~--~~~~~~~l~~~~~i~~L~~ll~~~~~~v~~~al~aL~~l~~~~~~~~~~~~~~~~~~~~~~~l~~  728 (767)
                      +|+|+|+|++..+  .++.+..+++.|++++|++++++.++++...++.+|.+++..++........  ..+.+...+++
T Consensus       391 ~a~~~l~nl~~~~~~~~~~~~~l~~~~~l~~l~~~L~~~d~~~~~~~L~~l~~ll~~~~~~~~~~~~--~~~~~~~~iee  468 (503)
T d1wa5b_         391 EACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGL--NINENADFIEK  468 (503)
T ss_dssp             HHHHHHHHHHHHTTTCTHHHHHHHHTTCHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHTC--SSCHHHHHHHH
T ss_pred             HHHHHHHHHHhcccccHHHHHHHHHCCcHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHhhhhcc--cchHHHHHHHH
Confidence            9999999998743  3567888999999999999999999999999999999999866543322111  45778999999


Q ss_pred             hchHHHHHHHhcCCChHHHHHHHHHHHHhcCCCc
Q 004225          729 AEGFKKIEDLKRHDSNGICEKAVKILEIYWSCGV  762 (767)
Q Consensus       729 ~g~~~~l~~l~~~~~~~v~~~a~~~l~~~~~~~~  762 (767)
                      .|+++.|+.++++++.+|+++|.+++++||+.|+
T Consensus       469 ~g~~~~i~~Lq~~~~~~i~~~A~~il~~~f~~~~  502 (503)
T d1wa5b_         469 AGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEE  502 (503)
T ss_dssp             TTHHHHHHGGGGCSCHHHHHHHHHHHHHHSSSCC
T ss_pred             CCCHHHHHHHHcCCCHHHHHHHHHHHHHHcCCcC
Confidence            9999999999999999999999999999999875
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure