Citrus Sinensis ID: 004302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760--
MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTIAQASPAESLSQSDTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQENSSSPSGLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALSTPESESNIEDETTTSDLRSEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT
cccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccEEEEEEEccccccccccccHHHHHHHccccccccccEEEEcccccccccccccEEEEEccccccccEEEEEcccEEEEcHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHccccccEEEccccccEEEcccEEEEEcccccEEEEcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEEccccEEEEEEccccEEEEEEcccccccccccccccccccEEEEEccccEEEEEcccccEEEEEEccccEEEEEcccccccccccccHHHHHcccccccccccccccccccccccccEEEEccccEEEEEEccccEEEEEEccccEEEEEEEccccEEEcccccHHHHHHcccccccccEEEEcccccEEEEEEcccccEEEEEccccEEEEcccccEEEEEcccccEEEccccccccccccccEEEccccEEEEccccccccccccccEEEcccccccEEEEccccccccEEccccccEEEEEEccccEEEEccccccccccccccHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEEEEccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEEEEEEEEEEEccccccccccccEEEEcccEEEEEEEcc
ccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccHHHHHccccccEEEEccccccccccHHHHHHHHHHcHHHcccccccEEEcccccccHHHccccEEEEEccHHHHHHHHHHcccccccHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHccccccEEEccHcHHHHHcccEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccccccccHcccccccEEEEEccccEEEEEEccccEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEccccEEEEEEccccEEEEEccccccEEEEcccccccccccccHHHHHHHHHcccccccHHHHHHccHcHcccccccccHHHHHHHccEEEEcccccEEEEEEccccccccEEEcccccccccEEEEcccHHHHcccccccccHHHHHEEEccccccEEEEEEEEcccccEHHcccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccEEEEccEEEEEEEEccccccccccccEEEcccEEEEEEEEcc
malrngclRRISrflphiysgshfQQSRRAIINSLASSlitfpreceqisrngvnfsfstiaqaspaeslsqsdtLSFIESTfnefqgphhlwfNIVEDNIHFFKRGGAFLVLAGrfvdncdsliagcgTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFpillsnknfpqmengACYLLSkdfgnarvfhenslDIGMLNKAVEELIMQQqenssspsglkctWAKQAevlkephacsSVRNLLLhfpgcisadesgnrlflsdsnhhriivfdgngkildcigscpgfedgefessklmrpaasfyhkdddclyivdsenhaiRRADMGRRVLEtvyptsgiskknNSLWAWIMEKLgferdndtksekldpqslifpwhlmkseddNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQmpqdwllhqidsscslkelpyaglisssIAFQNHILLCDIVGQRIMRLnresgvcsnfqfsnfailglpywfafPLERVYAVagghqgswtdHIQRcsllpgridikvnvdipsDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDtlalstpesesniedetttsdlrseddtvhidcavntspgtSEVIISAALYLKLrrypdqqddgrEKYAARISDILKlgrsgamqRDSFIRFLLKSNqdlrdvifvkplhvsiqfdtldhpkadnskdiiltdsnmevdvslnt
MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTIAQASPAESLSQSDTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQenssspsgLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVyptsgiskknnsLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLAlstpesesniedetttsdlrseddtVHIDcavntspgtseVIISAALYLKLRRypdqqddgreKYAARISDILklgrsgamqRDSFIRFLLKSNQDLRDVIFVKPLHVSiqfdtldhpkadnskdiiltdsnmevdvslnt
MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTIAQASPAESLSQSDTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQENSSSPSGLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALSTPESESNIEDETTTSDLRSEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT
*****GCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTI**************LSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELI************LKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFE*************SLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLAL************************VHIDCAVNTSPGTSEVIISAALYLKLRRYP********KYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLD*************************
**********ISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFST*****************FIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTI*****TRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQEN*S*P*********************SVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTA****************GVAQLWYDELDTLAL*************************HIDCAVNTSPGTSEVIISAALYLK******************ISDILKL*****MQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLN*
MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTIA***********DTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIM***********LKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALS******************SEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT
*ALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTIAQASPAESLSQSDTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQENSSSPSGLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERD***KSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALSTP**************LRSEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFPRECEQISRNGVNFSFSTIAQASPAESLSQSDTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQENSSSPSGLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALSTPESESNIEDETTTSDLRSEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query762 2.2.26 [Sep-21-2011]
Q5ZI67727 NHL repeat-containing pro yes no 0.195 0.204 0.293 1e-13
Q8BZW8725 NHL repeat-containing pro yes no 0.194 0.204 0.278 1e-11
A4IF69726 NHL repeat-containing pro yes no 0.194 0.203 0.295 6e-11
Q8NBF2726 NHL repeat-containing pro yes no 0.194 0.203 0.284 4e-10
>sp|Q5ZI67|NHLC2_CHICK NHL repeat-containing protein 2 OS=Gallus gallus GN=NHLRC2 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 28/177 (15%)

Query: 264 LHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSC-PGFEDGEFESSKLMRPA 322
           L FPG ++ D+SG RL ++D+ HHRI+V   NG+IL  IG    G +DG F  +    P 
Sbjct: 218 LLFPGKVTVDKSGERLVIADTGHHRILVTLKNGQILHTIGGPNSGRKDGRFSEAAFNSPQ 277

Query: 323 ASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERD 382
                  ++ +Y+ D+ENH IR+ D+   ++ TV   +GI  +            G +++
Sbjct: 278 GVAIK--NNVIYVADTENHLIRKIDLELEIVTTV---AGIGIQ------------GVDKE 320

Query: 383 NDTKSEKLDPQSLIFPWHLM-------KSEDDNLLIINRSFETLWIMDLASGEIKEA 432
              K E+   Q +  PW ++         EDD L I       +W + L  G++ + 
Sbjct: 321 GGAKGEE---QPISSPWDVVFGNSVSGTQEDDVLWIAMAGIHQVWALMLEGGKLPKG 374

Gallus gallus (taxid: 9031)
>sp|Q8BZW8|NHLC2_MOUSE NHL repeat-containing protein 2 OS=Mus musculus GN=Nhlrc2 PE=2 SV=1 Back     alignment and function description
>sp|A4IF69|NHLC2_BOVIN NHL repeat-containing protein 2 OS=Bos taurus GN=NHLRC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8NBF2|NHLC2_HUMAN NHL repeat-containing protein 2 OS=Homo sapiens GN=NHLRC2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
255560179767 catalytic, putative [Ricinus communis] g 0.986 0.980 0.601 0.0
359480128705 PREDICTED: uncharacterized protein LOC10 0.917 0.991 0.594 0.0
449453417836 PREDICTED: uncharacterized protein LOC10 0.981 0.894 0.490 0.0
356570396765 PREDICTED: uncharacterized protein LOC10 0.973 0.969 0.484 0.0
186509871774 NHL domain-containing protein [Arabidops 0.891 0.877 0.494 0.0
297829252771 EMB1974 [Arabidopsis lyrata subsp. lyrat 0.889 0.879 0.491 0.0
357503569816 Ribosomal protein L15 [Medicago truncatu 0.881 0.823 0.476 0.0
357503571814 Ribosomal protein L15 [Medicago truncatu 0.881 0.825 0.468 1e-177
357469427784 NHL repeat-containing protein [Medicago 0.971 0.943 0.434 1e-174
224065332525 predicted protein [Populus trichocarpa] 0.633 0.92 0.572 1e-167
>gi|255560179|ref|XP_002521107.1| catalytic, putative [Ricinus communis] gi|223539676|gb|EEF41258.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/777 (60%), Positives = 579/777 (74%), Gaps = 25/777 (3%)

Query: 1   MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINSLASSLITFP-------RECEQISRNG 53
           M+ R    R+IS+ LP I  G+   + R+A     A S I+ P       R    + R  
Sbjct: 1   MSRRYQRFRQISKLLPRILPGNQLHKCRKATSIHSAFSTISVPNSDYDGMRNTLILHRGF 60

Query: 54  VNFSFSTIAQAS-PAESLSQSDTLSFIESTFNEFQGPHHLWFNIVED-NIHFFKRGGAFL 111
            +  +STI++ S  + S    D LSFI+STFNE QGP+H W N V+  +     + G FL
Sbjct: 61  YSQRYSTISEVSHESNSPPVDDVLSFIKSTFNELQGPNHCWLNKVDHRDKDCLNKDGIFL 120

Query: 112 VLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLVEML 171
           ++AG+ ++N          V   EK+KSIQQ FPQL ++GF  G S  SA D+TRLVE++
Sbjct: 121 LIAGQLINNSQ-------IVFMIEKIKSIQQRFPQLCIVGFHCGSSIGSADDRTRLVELI 173

Query: 172 MKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQE 231
           MKE++TFP+LLS+KNF QMENGACY+L KDF N+ ++H+  LDI +LNKA+EEL MQQ  
Sbjct: 174 MKEFLTFPVLLSSKNFLQMENGACYILFKDFKNSVIYHDRDLDIEILNKAIEELHMQQ-- 231

Query: 232 NSSSPSG------LKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSN 285
           N  + SG      LK +W KQAEV KEP + S ++NL+L+FPGC+SADESG+RLFLSDSN
Sbjct: 232 NGYTNSGISNLRDLKSSWVKQAEVTKEPCSSSFLQNLVLYFPGCVSADESGDRLFLSDSN 291

Query: 286 HHRIIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRR 345
           HHRII+FDGNGKI+D IGSCPGFEDGEFES+KL+RPAASFYH  +DCLYIVD+EN AIRR
Sbjct: 292 HHRIIIFDGNGKIMDSIGSCPGFEDGEFESAKLLRPAASFYHNSEDCLYIVDAENQAIRR 351

Query: 346 ADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSE 405
           ADM RRVLET+YPT  ISK N+S+W WI+ K+GF R++D KS++ D Q L+FPWHL KS 
Sbjct: 352 ADMERRVLETLYPTCSISKNNSSVWTWIVNKMGFGRNSDMKSKEFDSQLLMFPWHLFKSV 411

Query: 406 DDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQ 465
           DD+LLIINRSFE+LWIMDLASG+IKE ++GF K+LE CG L+ EKV LLKQMP DWL  Q
Sbjct: 412 DDSLLIINRSFESLWIMDLASGKIKEIIRGFPKILETCGQLITEKVSLLKQMPNDWLQQQ 471

Query: 466 IDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLP 525
           ID+SCS + LP+A L+SS   FQNH+++CD V QR+++LNRESG+CSN QFSNF ILG P
Sbjct: 472 IDASCSPEGLPFASLLSSVTTFQNHLIMCDTVAQRVVKLNRESGICSNIQFSNFGILGFP 531

Query: 526 YWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWR 585
           YW +FPLERVY+ A    G W DH+Q  SLLPGRIDI++NVDIP D +LVE LQEGCIWR
Sbjct: 532 YWSSFPLERVYSEAPP-DGGWMDHLQSFSLLPGRIDIRLNVDIPVDVDLVEPLQEGCIWR 590

Query: 586 QARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALSTPESESNIEDETTTSDLRSEDD 645
           QARG A+ +L  E V G+ EKVGVAQ WYD+LD LA STPESE   ED   +SD++SED 
Sbjct: 591 QARGAATEILGREGVVGTSEKVGVAQQWYDDLDNLAFSTPESEMVKEDSCASSDVKSEDK 650

Query: 646 TVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRD 705
            VHIDC+VNTSPGTSEVII  ALYLKLRR PD Q+  +EKYAARI+DIL   R G + RD
Sbjct: 651 RVHIDCSVNTSPGTSEVIIYVALYLKLRRDPDSQEVSQEKYAARIADILNPARKGGIGRD 710

Query: 706 SFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT 762
           S I+ LLKSN DLRD+IF++PLHV I+ D  DHPK++N KDIILT+ ++EV+V L T
Sbjct: 711 SCIQLLLKSNADLRDLIFMRPLHVRIKMDCPDHPKSENGKDIILTNDSIEVNVMLQT 767

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359480128|ref|XP_002267331.2| PREDICTED: uncharacterized protein LOC100267131 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453417|ref|XP_004144454.1| PREDICTED: uncharacterized protein LOC101209700 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356570396|ref|XP_003553375.1| PREDICTED: uncharacterized protein LOC100806465 [Glycine max] Back     alignment and taxonomy information
>gi|186509871|ref|NP_187362.3| NHL domain-containing protein [Arabidopsis thaliana] gi|332640973|gb|AEE74494.1| NHL domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297829252|ref|XP_002882508.1| EMB1974 [Arabidopsis lyrata subsp. lyrata] gi|297328348|gb|EFH58767.1| EMB1974 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357503569|ref|XP_003622073.1| Ribosomal protein L15 [Medicago truncatula] gi|355497088|gb|AES78291.1| Ribosomal protein L15 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357503571|ref|XP_003622074.1| Ribosomal protein L15 [Medicago truncatula] gi|355497089|gb|AES78292.1| Ribosomal protein L15 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357469427|ref|XP_003604998.1| NHL repeat-containing protein [Medicago truncatula] gi|355506053|gb|AES87195.1| NHL repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224065332|ref|XP_002301778.1| predicted protein [Populus trichocarpa] gi|222843504|gb|EEE81051.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query762
TAIR|locus:2077597774 emb1974 "AT3G07060" [Arabidops 0.985 0.970 0.473 4.7e-183
TAIR|locus:20107281055 AT1G56500 [Arabidopsis thalian 0.122 0.088 0.442 9.2e-11
MGI|MGI:1914116725 Nhlrc2 "NHL repeat containing 0.119 0.125 0.382 1.5e-08
TAIR|locus:2077597 emb1974 "AT3G07060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1776 (630.2 bits), Expect = 4.7e-183, P = 4.7e-183
 Identities = 371/783 (47%), Positives = 512/783 (65%)

Query:     1 MALRNGCLRRISRFLPHIYSGSHFQQSRRAIINS---LASSL-----ITFPRECEQISRN 52
             M+ R+  L++IS     I S +   + RR+I      LA SL     I      EQ    
Sbjct:     1 MSNRSLHLKKISWLSSRILSDNVHGRFRRSITTPATCLAPSLDGDMNIGSKTLVEQRFSR 60

Query:    53 GVNFSFSTIAQASPAESLSQS----DTLSFIESTFNEFQGPHHLWFNIVEDNIHFFKRGG 108
             G   S   +++AS + S S S    D LSFI+++ ++ +GP H W N    N   FK  G
Sbjct:    61 GFA-SVRRVSRASSSSSSSPSSPHVDLLSFIKASLDKLEGPSHHWLNRDFGNKQLFKDKG 119

Query:   109 AFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQLQVIGFLHGCSTISAVDQTRLV 168
              ++VLAG  +D    L +G      FEK+K +QQ  P +  +G         A D+T L 
Sbjct:   120 TYVVLAGHLLDGTSDL-SGF-----FEKLKLLQQRSPGVCFMGIHFSDQARIADDRTALA 173

Query:   169 EMLMKEYITFPILLSNKNFPQMENGACYLLSKDFGNARVFHENSLDIGMLNKAVEELIMQ 228
             E+++KEY+TFP+LLS K FP+      Y++ KDF N  ++ E  LDI  + KA++ L+ Q
Sbjct:   174 ELILKEYLTFPVLLSEKEFPKTSGEVRYIVFKDFKNPLIYEEKDLDIASVVKALDSLLTQ 233

Query:   229 QQENSSSPSGLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHR 288
               E S S      TW+KQAE +KE H  S  ++LLL+FPGCISADE G+RLFLSD+NHHR
Sbjct:   234 DTEKSKSVRLFTNTWSKQAEAIKESHFPSFFQDLLLYFPGCISADEVGDRLFLSDTNHHR 293

Query:   289 IIVFDGNGKILDCIGSCPGFEDGEFESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADM 348
             II+F+ +GKI+D IG  PGFEDG+FES+K++RP  + Y + +DCLYIVDSENHAIRRA++
Sbjct:   294 IIIFENSGKIVDSIGCFPGFEDGDFESAKMLRPTGTLYDEAEDCLYIVDSENHAIRRANI 353

Query:   349 GRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDT------KSEKLDPQSLIFPWHLM 402
               RVLETVYP   + KK   LW+WIMEK+G  +D+DT      KSE+ D +SL+FPWH++
Sbjct:   354 NSRVLETVYPK--VIKKTGGLWSWIMEKMGLGKDDDTTVDADTKSEEFDARSLLFPWHIL 411

Query:   403 KSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWL 462
             K +D++LL+IN+SF  LWI++ ASGEI+E V+GFSK++EICG  + EK+ +L+ MP +WL
Sbjct:   412 KRDDESLLVINKSFSKLWIINFASGEIEEVVEGFSKIIEICGQSITEKLSVLEHMPSNWL 471

Query:   463 LHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAIL 522
               Q  +  S KE P A L+SS     + I++ DI  QR+++LNR+SG CS+ QFSN  IL
Sbjct:   472 QQQTAAIASFKEQPSASLLSSFTKLGDDIVMTDIACQRVLKLNRDSGACSSIQFSNSGIL 531

Query:   523 GLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGC 582
             GLPYW   PLERV+ +A G Q +   H Q   LLPG+I I++N++IP  TELVE +QE C
Sbjct:   532 GLPYWLFIPLERVFNLANGVQEAHLSHTQELRLLPGKISIRLNIEIPPCTELVEPIQESC 591

Query:   583 IWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLA--LSTPES-ESNIEDETTTSD 639
             IWRQ RG  S    A       EK+GV+Q WYDELD+LA  ++ PE+ E   E++   S+
Sbjct:   592 IWRQTRGAISEFSSAGSAVEPSEKIGVSQQWYDELDSLAKEIANPEAAEEEEEEDVNPSE 651

Query:   640 L-RSEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGR 698
             + R ED  +HIDC V TSPG+SE+I+ AALYL+L R  + +   +E+ A +I+ ILK  R
Sbjct:   652 VDREEDGRIHIDCPVKTSPGSSELIVYAALYLRLARNEETESATQEELARKIAKILKPVR 711

Query:   699 S-GAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVD 757
             +   M+ D F+  L KS ++LRD++F+KP+HV I+ D+ DHPKADNS+D+ILTDS++EVD
Sbjct:   712 NITTMKEDLFVNLLSKSKRELRDIVFIKPMHVRIRLDSKDHPKADNSRDVILTDSSVEVD 771

Query:   758 VSL 760
             VSL
Sbjct:   772 VSL 774
GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1914116 Nhlrc2 "NHL repeat containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033856001
SubName- Full=Chromosome undetermined scaffold_70, whole genome shotgun sequence; (550 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
PLN029191057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 5e-18
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information 
 Score = 88.8 bits (220), Expect = 5e-18
 Identities = 45/104 (43%), Positives = 59/104 (56%), Gaps = 5/104 (4%)

Query: 264 LHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSC--PGFEDGEFESSKLMRP 321
           L FPG ++ D   NRLF+SDSNH+RI+V D +G  +  IGS    G  DG FE +   RP
Sbjct: 567 LKFPGKLAIDLLNNRLFISDSNHNRIVVTDLDGNFIVQIGSTGEEGLRDGSFEDATFNRP 626

Query: 322 AASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKK 365
               Y+   + LY+ D+ENHA+R  D    V ETV   +G   K
Sbjct: 627 QGLAYNAKKNLLYVADTENHALREIDF---VNETVRTLAGNGTK 667

Length = 1057

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 762
PLN029191057 haloacid dehalogenase-like hydrolase family protei 100.0
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.91
PTZ00056199 glutathione peroxidase; Provisional 99.86
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.85
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.85
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.85
PLN02412167 probable glutathione peroxidase 99.85
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.84
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.83
PTZ00256183 glutathione peroxidase; Provisional 99.81
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.81
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.8
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.77
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.76
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.75
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.75
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.75
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.74
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.74
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.74
PRK14018521 trifunctional thioredoxin/methionine sulfoxide red 99.73
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.73
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.72
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.71
PRK10606183 btuE putative glutathione peroxidase; Provisional 99.71
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.69
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.68
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.68
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.68
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.66
PRK13728181 conjugal transfer protein TrbB; Provisional 99.66
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.66
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.66
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.64
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.63
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.63
PRK13190202 putative peroxiredoxin; Provisional 99.63
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.63
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.62
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.61
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.61
PRK13599215 putative peroxiredoxin; Provisional 99.59
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.58
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.53
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.52
PRK13191215 putative peroxiredoxin; Provisional 99.52
PRK15000200 peroxidase; Provisional 99.51
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.5
PTZ00253199 tryparedoxin peroxidase; Provisional 99.49
PRK13189222 peroxiredoxin; Provisional 99.49
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.41
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.41
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.41
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.34
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.27
COG3391381 Uncharacterized conserved protein [Function unknow 99.19
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.18
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.15
COG3391381 Uncharacterized conserved protein [Function unknow 99.15
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.13
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.09
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.05
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.05
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.05
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.04
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.02
PRK10996139 thioredoxin 2; Provisional 99.01
PRK09381109 trxA thioredoxin; Provisional 99.0
PHA02278103 thioredoxin-like protein 98.98
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.97
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 98.96
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 98.93
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 98.89
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 98.88
PTZ0005198 thioredoxin; Provisional 98.86
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 98.81
PRK11028330 6-phosphogluconolactonase; Provisional 98.8
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 98.79
KOG0907106 consensus Thioredoxin [Posttranslational modificat 98.76
PRK11028330 6-phosphogluconolactonase; Provisional 98.74
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.74
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 98.73
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.73
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 98.73
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 98.72
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 98.72
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 98.71
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.71
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.68
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.68
PTZ00443224 Thioredoxin domain-containing protein; Provisional 98.67
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 98.67
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.66
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 98.66
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.66
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 98.65
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.64
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.64
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 98.64
cd02962152 TMX2 TMX2 family; composed of proteins similar to 98.59
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 98.59
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.58
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 98.56
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 98.56
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.56
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.54
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.51
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.5
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.49
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.48
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.48
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 98.47
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.46
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.45
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.44
KOG1651171 consensus Glutathione peroxidase [Posttranslationa 98.42
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.41
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.41
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.41
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 98.41
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 98.39
KOG0855211 consensus Alkyl hydroperoxide reductase, thiol spe 98.36
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.35
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 98.35
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 98.34
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.34
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.31
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.3
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.27
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.23
PTZ00062204 glutaredoxin; Provisional 98.22
PTZ00102477 disulphide isomerase; Provisional 98.22
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.19
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 98.17
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.16
KOG12141289 consensus Nidogen and related basement membrane pr 98.15
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 98.13
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.12
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 98.11
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 98.09
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 98.08
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 98.06
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.03
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.01
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 98.01
KOG2792280 consensus Putative cytochrome C oxidase assembly p 97.99
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.99
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.96
PLN02309457 5'-adenylylsulfate reductase 97.95
KOG12141289 consensus Nidogen and related basement membrane pr 97.93
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 97.88
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 97.86
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 97.86
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.83
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.79
cd02958114 UAS UAS family; UAS is a domain of unknown functio 97.79
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 97.64
KOG0852196 consensus Alkyl hydroperoxide reductase, thiol spe 97.62
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.61
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.57
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.57
PTZ00102477 disulphide isomerase; Provisional 97.55
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.54
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 97.51
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.5
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 97.49
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.4
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.37
COG4232569 Thiol:disulfide interchange protein [Posttranslati 97.32
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.29
PHA0212575 thioredoxin-like protein 97.28
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 97.26
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.19
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.17
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.1
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 97.03
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 96.98
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 96.86
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.85
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 96.72
PRK02888635 nitrous-oxide reductase; Validated 96.66
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.65
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 96.52
smart00594122 UAS UAS domain. 96.48
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 96.42
PF04592238 SelP_N: Selenoprotein P, N terminal region; InterP 96.42
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 96.27
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 96.24
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.13
PF13728215 TraF: F plasmid transfer operon protein 96.13
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 96.12
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 96.12
PF05787524 DUF839: Bacterial protein of unknown function (DUF 96.08
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 96.05
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.87
PRK05137435 tolB translocation protein TolB; Provisional 95.85
PF13449326 Phytase-like: Esterase-like activity of phytase 95.72
KOG1215877 consensus Low-density lipoprotein receptors contai 95.59
PRK03629429 tolB translocation protein TolB; Provisional 95.59
PRK04922433 tolB translocation protein TolB; Provisional 95.52
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 95.5
PRK03629429 tolB translocation protein TolB; Provisional 95.48
PRK04792448 tolB translocation protein TolB; Provisional 95.45
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.37
PRK04922433 tolB translocation protein TolB; Provisional 95.33
PRK00178430 tolB translocation protein TolB; Provisional 95.32
TIGR02739256 TraF type-F conjugative transfer system pilin asse 95.29
KOG1215877 consensus Low-density lipoprotein receptors contai 95.22
PF13449326 Phytase-like: Esterase-like activity of phytase 95.21
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 95.18
KOG0291893 consensus WD40-repeat-containing subunit of the 18 95.01
PTZ00421493 coronin; Provisional 95.01
PRK02888635 nitrous-oxide reductase; Validated 94.98
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 94.98
PTZ00420568 coronin; Provisional 94.96
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 94.95
PRK04792448 tolB translocation protein TolB; Provisional 94.92
PRK02889427 tolB translocation protein TolB; Provisional 94.91
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 94.8
PF05787524 DUF839: Bacterial protein of unknown function (DUF 94.76
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 94.76
PRK13703248 conjugal pilus assembly protein TraF; Provisional 94.67
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 94.63
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 94.57
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 94.55
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 94.53
KOG0266456 consensus WD40 repeat-containing protein [General 94.47
KOG0266456 consensus WD40 repeat-containing protein [General 94.42
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 94.4
PRK05137435 tolB translocation protein TolB; Provisional 94.31
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.31
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.24
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 94.22
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 94.13
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 94.0
PRK00178430 tolB translocation protein TolB; Provisional 93.97
PRK02889427 tolB translocation protein TolB; Provisional 93.88
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.69
PRK01742429 tolB translocation protein TolB; Provisional 93.59
KOG0291893 consensus WD40-repeat-containing subunit of the 18 93.52
KOG0854224 consensus Alkyl hydroperoxide reductase, thiol spe 93.41
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 93.4
PRK01742429 tolB translocation protein TolB; Provisional 93.33
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 93.15
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.14
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 93.11
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 93.09
PRK1120085 grxA glutaredoxin 1; Provisional 93.01
PTZ00420568 coronin; Provisional 92.87
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 92.63
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 92.56
KOG0315311 consensus G-protein beta subunit-like protein (con 92.47
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 92.15
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 91.84
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 91.76
COG3211616 PhoX Predicted phosphatase [General function predi 91.68
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 91.65
PRK04043419 tolB translocation protein TolB; Provisional 91.35
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 91.13
KOG0279315 consensus G protein beta subunit-like protein [Sig 90.86
PRK04043419 tolB translocation protein TolB; Provisional 90.79
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 90.72
PLN00181793 protein SPA1-RELATED; Provisional 90.58
KOG1273405 consensus WD40 repeat protein [General function pr 90.45
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 90.45
PRK01029428 tolB translocation protein TolB; Provisional 90.14
PF05176252 ATP-synt_10: ATP10 protein; InterPro: IPR007849 Th 89.92
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 89.86
KOG0279315 consensus G protein beta subunit-like protein [Sig 89.83
KOG0315311 consensus G-protein beta subunit-like protein (con 89.55
PF05988211 DUF899: Bacterial protein of unknown function (DUF 89.51
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 89.43
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 89.27
PTZ00421493 coronin; Provisional 89.2
KOG0281499 consensus Beta-TrCP (transducin repeats containing 89.03
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 88.96
KOG0318603 consensus WD40 repeat stress protein/actin interac 88.9
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 88.89
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 88.88
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 88.73
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 88.69
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 88.6
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 88.35
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 88.23
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 88.1
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 87.72
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 87.15
KOG0281499 consensus Beta-TrCP (transducin repeats containing 86.83
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 86.62
KOG3425128 consensus Uncharacterized conserved protein [Funct 85.97
PLN00181793 protein SPA1-RELATED; Provisional 85.81
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 85.75
COG3211616 PhoX Predicted phosphatase [General function predi 85.39
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 85.23
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 84.89
KOG0289506 consensus mRNA splicing factor [General function p 83.39
KOG0318603 consensus WD40 repeat stress protein/actin interac 83.25
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 82.88
KOG0772641 consensus Uncharacterized conserved protein, conta 82.24
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 81.51
KOG2106626 consensus Uncharacterized conserved protein, conta 81.39
KOG0283712 consensus WD40 repeat-containing protein [Function 80.9
PHA02713557 hypothetical protein; Provisional 80.49
KOG0263707 consensus Transcription initiation factor TFIID, s 80.33
COG3823262 Glutamine cyclotransferase [Posttranslational modi 80.13
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information 
Probab=100.00  E-value=3.5e-48  Score=474.11  Aligned_cols=416  Identities=20%  Similarity=0.240  Sum_probs=307.5

Q ss_pred             CCCCceeecc--cCCCcccc-CCCCCCEEEEEEeccCCCCccCCCCcchhhcHHHHHHHHHCCC--eEEEEEEcCCCccC
Q 004302           86 FQGPHHLWFN--IVEDNIHF-FKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQ--LQVIGFLHGCSTIS  160 (762)
Q Consensus        86 l~g~~~~w~n--~~g~~v~L-sd~rGK~VvLnFWAtWC~pC~~p~C~~~~emP~L~~L~~~y~~--v~VvgV~~~~~~~~  160 (762)
                      .+.|+|...+  .+|+++++ ++++||+|||+|||+||+||       ++|+|.|++|+++|++  |+||+|+.+. ++.
T Consensus       395 ~~~p~f~~~~~~~~g~~~~l~~~lkGK~vll~FWAsWC~pC-------~~e~P~L~~l~~~y~~~~~~vvgV~~~~-~D~  466 (1057)
T PLN02919        395 TKVPEFPPKLDWLNTAPLQFRRDLKGKVVILDFWTYCCINC-------MHVLPDLEFLEKKYKDQPFTVVGVHSAK-FDN  466 (1057)
T ss_pred             CcCCCCcccccccCCccccchhhcCCCEEEEEEECCcChhH-------HhHhHHHHHHHHHcCCCCeEEEEEeccc-ccc
Confidence            3444454433  45678988 68999999999999999866       9999999999999986  9999998764 555


Q ss_pred             cCCHHHHHHHHHhcCCCcceeeCCCCccccccC---ce-EEEEcCCCCEEEEecCCcCHHHHHHHHHHHHHhhccC--CC
Q 004302          161 AVDQTRLVEMLMKEYITFPILLSNKNFPQMENG---AC-YLLSKDFGNARVFHENSLDIGMLNKAVEELIMQQQEN--SS  234 (762)
Q Consensus       161 e~~~~~v~~f~~k~~itfPVl~D~~~~~~~~yg---v~-t~lId~~G~iv~~~~G~~~~~~L~~~l~~ll~~~~~~--s~  234 (762)
                      +++.+++++|+++++++||++.|....+++.|+   +| +||||++|+++.++.|+...++|++.|+.++.--.+.  -+
T Consensus       467 ~~~~~~~~~~~~~~~i~~pvv~D~~~~~~~~~~V~~iPt~ilid~~G~iv~~~~G~~~~~~l~~~l~~~l~~~~~~~~~~  546 (1057)
T PLN02919        467 EKDLEAIRNAVLRYNISHPVVNDGDMYLWRELGVSSWPTFAVVSPNGKLIAQLSGEGHRKDLDDLVEAALQYYGEKKLLD  546 (1057)
T ss_pred             cccHHHHHHHHHHhCCCccEEECCchHHHHhcCCCccceEEEECCCCeEEEEEecccCHHHHHHHHHHHHHhhccccccc
Confidence            567889999999999999999998888888876   45 5999999999999999999999999999887732111  01


Q ss_pred             CCCCccchhhhhhhhccCCCCcccccCcccCCcceEEEccCCCEEEEEeCCCcEEEEEcCCCcEEEEecC-C-CCCCCCc
Q 004302          235 SPSGLKCTWAKQAEVLKEPHACSSVRNLLLHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGS-C-PGFEDGE  312 (762)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~P~gIAVD~s~g~LYVADs~nhrI~v~d~~G~i~~~iGs-G-~G~~DG~  312 (762)
                      ..+.-       .++.+++-+.  ....+|++|.+|++|+.+++|||+|++||||+++|.+|+++..+|+ | .|+.+|.
T Consensus       547 ~~~~~-------~~~~~~~~~~--~~~s~l~~P~gvavd~~~g~lyVaDs~n~rI~v~d~~G~~i~~ig~~g~~G~~dG~  617 (1057)
T PLN02919        547 STPLP-------LSLEKDNDPR--LLTSPLKFPGKLAIDLLNNRLFISDSNHNRIVVTDLDGNFIVQIGSTGEEGLRDGS  617 (1057)
T ss_pred             cCCCc-------ccccccCCcc--cccccCCCCceEEEECCCCeEEEEECCCCeEEEEeCCCCEEEEEccCCCcCCCCCc
Confidence            11111       1233333332  2235799999999997789999999999999999999999988887 5 7788999


Q ss_pred             ccccccCCcceEEEecCCCeEEEEeCCCCeEEEEeCCCCEEEEEeecCCCCCCCCchhhhhhhccCccccCCCccCCCCC
Q 004302          313 FESSKLMRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDP  392 (762)
Q Consensus       313 ~~~a~fn~P~GIavd~~~g~LYVADt~NhrIRkid~~~g~I~TiaG~G~~~~~G~~~~~~~~~~~G~~~~~~~~~~~~~~  392 (762)
                      +..++|++|+||+++++++.|||||++||+||+||+.++.++|++|+|..   |..       ..|.        .....
T Consensus       618 ~~~a~f~~P~GIavd~~gn~LYVaDt~n~~Ir~id~~~~~V~tlag~G~~---g~~-------~~gg--------~~~~~  679 (1057)
T PLN02919        618 FEDATFNRPQGLAYNAKKNLLYVADTENHALREIDFVNETVRTLAGNGTK---GSD-------YQGG--------KKGTS  679 (1057)
T ss_pred             hhccccCCCcEEEEeCCCCEEEEEeCCCceEEEEecCCCEEEEEeccCcc---cCC-------CCCC--------hhhhH
Confidence            99999999999999987778999999999999999999999999987621   110       0000        01122


Q ss_pred             CCCCCcceEEEcC-CCcEEEEECCCCEEEEEECCCCcEEEEEcCCceeeEEeceehhhhhhhhccCCccccccccCCccc
Q 004302          393 QSLIFPWHLMKSE-DDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCS  471 (762)
Q Consensus       393 ~~L~~P~gIavd~-dG~LYVAD~gN~rI~v~d~~~g~I~ti~~G~g~~~~~~G~~~~~r~~~~~~~p~~~~~~~~d~~~~  471 (762)
                      +.|++|++|++++ +|.|||+|.+||+|++||..++.+.++ .|+|......|.                        ..
T Consensus       680 ~~ln~P~gVa~dp~~g~LyVad~~~~~I~v~d~~~g~v~~~-~G~G~~~~~~g~------------------------~~  734 (1057)
T PLN02919        680 QVLNSPWDVCFEPVNEKVYIAMAGQHQIWEYNISDGVTRVF-SGDGYERNLNGS------------------------SG  734 (1057)
T ss_pred             hhcCCCeEEEEecCCCeEEEEECCCCeEEEEECCCCeEEEE-ecCCccccCCCC------------------------cc
Confidence            4589999999998 699999999999999999999887654 565521110010                        00


Q ss_pred             ccCCCCcceeeeEEecCCEEEEEECCCCEEEEEECCCCcEEEEeecc---------cc---ccCCCceeeccccceeecc
Q 004302          472 LKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSN---------FA---ILGLPYWFAFPLERVYAVA  539 (762)
Q Consensus       472 ~~~~p~~~lgsav~~~~g~LYVADt~NhRIrkidl~~~~~sti~~s~---------~G---~lG~p~~~~~pl~~v~~~~  539 (762)
                      .......|.+.++++.++.|||+|++||+|++||++++..+.+....         +|   ..|....+..|....++..
T Consensus       735 ~~~~~~~P~GIavspdG~~LYVADs~n~~Irv~D~~tg~~~~~~gg~~~~~~~l~~fG~~dG~g~~~~l~~P~Gvavd~d  814 (1057)
T PLN02919        735 TSTSFAQPSGISLSPDLKELYIADSESSSIRALDLKTGGSRLLAGGDPTFSDNLFKFGDHDGVGSEVLLQHPLGVLCAKD  814 (1057)
T ss_pred             ccccccCccEEEEeCCCCEEEEEECCCCeEEEEECCCCcEEEEEecccccCcccccccCCCCchhhhhccCCceeeEeCC
Confidence            01112234667887777789999999999999999987665443210         11   0111123444544333321


Q ss_pred             --cccCCCccccceeeecCCCcee
Q 004302          540 --GGHQGSWTDHIQRCSLLPGRID  561 (762)
Q Consensus       540 --~~~~g~~~~~~~~~~~~pG~~~  561 (762)
                        ..+.+..++.++.|++..|.+.
T Consensus       815 G~LYVADs~N~rIrviD~~tg~v~  838 (1057)
T PLN02919        815 GQIYVADSYNHKIKKLDPATKRVT  838 (1057)
T ss_pred             CcEEEEECCCCEEEEEECCCCeEE
Confidence              1235566788888988776554

>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF04592 SelP_N: Selenoprotein P, N terminal region; InterPro: IPR007671 SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma [] Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0854 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05176 ATP-synt_10: ATP10 protein; InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF05988 DUF899: Bacterial protein of unknown function (DUF899); InterPro: IPR010296 This family consists of uncharacterised bacterial proteins of unknown function which are thioredoxin-like Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query762
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 1e-11
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 1e-08
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 7e-07
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 4e-04
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 2e-11
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 6e-11
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3kya_A496 Putative phosphatase; structural genomics, joint c 8e-10
3kya_A496 Putative phosphatase; structural genomics, joint c 7e-06
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 4e-08
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 2e-07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 4e-07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 2e-04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 4e-08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 1e-06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-05
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 1e-06
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 1e-06
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 9e-05
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 3e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 5e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 4e-04
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
 Score = 66.1 bits (161), Expect = 1e-11
 Identities = 22/100 (22%), Positives = 40/100 (40%), Gaps = 5/100 (5%)

Query: 267 PGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSC--PGFEDGEFESSKLMRPAAS 324
           P  I      N  ++SD N   +     +G+     GS      +DG  E +   +P   
Sbjct: 270 PYLIYYFVDSN-FYMSDQNLSSVYKITPDGECEWFCGSATQKTVQDGLREEALFAQPNGM 328

Query: 325 FYHKDDDCLYIVDS-ENHAIRRADMGRRVLETVYPTSGIS 363
              +D +  YIVD  + + +R+ D+    + TV     ++
Sbjct: 329 TVDEDGN-FYIVDGFKGYCLRKLDILDGYVSTVAGQVDVA 367
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.88
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.88
3kya_A496 Putative phosphatase; structural genomics, joint c 99.87
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.86
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 99.86
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.86
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.86
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 99.86
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.86
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.85
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.85
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 99.85
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.85
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.85
3kya_A496 Putative phosphatase; structural genomics, joint c 99.85
3raz_A151 Thioredoxin-related protein; structural genomics, 99.85
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.85
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.85
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 99.84
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.84
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.84
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.84
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.84
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.84
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.84
4evm_A138 Thioredoxin family protein; structural genomics, n 99.83
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.83
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.83
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.83
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.83
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.83
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.83
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.83
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.83
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.83
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.83
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.83
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.83
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.83
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.82
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.82
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.82
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.82
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.82
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.82
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.82
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.82
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.82
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.82
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.82
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.81
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 99.81
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.81
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.81
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.81
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.81
3v65_B386 Low-density lipoprotein receptor-related protein; 99.81
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.81
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.81
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.81
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.81
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.81
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.81
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.81
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.8
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.8
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.8
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.8
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.8
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.8
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.8
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.8
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.79
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.79
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.79
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.79
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.79
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.79
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 99.79
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.78
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.78
2ls5_A159 Uncharacterized protein; structural genomics, unkn 99.65
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.78
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.78
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.78
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.78
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.77
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.77
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.77
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.77
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.77
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.77
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.77
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.77
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.77
3v65_B386 Low-density lipoprotein receptor-related protein; 99.76
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.76
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.76
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.76
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.76
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 99.76
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.76
3me7_A170 Putative uncharacterized protein; electron transfe 99.75
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.74
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.74
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.74
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.74
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.74
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.73
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.73
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 99.73
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.73
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.73
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.72
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.72
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.72
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.71
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.7
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.69
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.69
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.68
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.67
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.67
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.67
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 99.48
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.65
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.64
4eo3_A322 Bacterioferritin comigratory protein/NADH dehydro; 99.64
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.63
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.62
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 99.57
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.56
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.55
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.54
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 99.54
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.54
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.46
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.43
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.43
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.43
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.42
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.42
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.42
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.41
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.37
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.35
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.34
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.32
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.31
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.31
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.3
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.3
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.29
2qe8_A343 Uncharacterized protein; structural genomics, join 99.29
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.29
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.29
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.28
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.28
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.27
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.27
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.26
2qe8_A343 Uncharacterized protein; structural genomics, join 99.26
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.25
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.24
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.24
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.24
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.23
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.23
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.22
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.22
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.22
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.21
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.2
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.2
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.2
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 98.83
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.19
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.19
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.19
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.18
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.18
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.18
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.16
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.16
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.16
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.16
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.15
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.15
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.15
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.15
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.15
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.14
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.14
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.14
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.13
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.13
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.13
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.13
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.12
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.12
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.12
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.12
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.12
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.12
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.12
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.12
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.12
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.12
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.11
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.11
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.11
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.1
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.1
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.1
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.09
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.09
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.09
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.08
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.07
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.07
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.07
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.06
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.06
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.05
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.05
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.05
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.04
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.04
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.04
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.03
2qsi_A137 Putative hydrogenase expression/formation protein; 99.02
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.02
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.01
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 98.99
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 98.99
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.99
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 98.98
1wmj_A130 Thioredoxin H-type; structural genomics, program f 98.98
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 98.98
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.98
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 98.97
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 98.97
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.97
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 98.96
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 98.96
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.95
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.93
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 98.93
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 98.93
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 98.92
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.92
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.91
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.89
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.88
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.88
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.88
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 98.86
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.85
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.85
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.85
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 98.84
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.82
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.82
3ira_A173 Conserved protein; methanosarcina mazei,structural 98.81
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.8
1mek_A120 Protein disulfide isomerase; electron transport, r 98.79
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.79
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 98.27
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.77
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.75
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 98.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.74
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.74
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 98.73
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 98.72
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.72
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.69
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 98.67
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 98.66
3t58_A519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 98.66
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 98.66
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.65
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.65
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.64
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.63
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.62
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.62
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.62
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 98.61
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 98.6
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.6
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.6
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.59
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.57
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.57
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.56
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 98.56
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 98.53
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.52
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 98.5
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.5
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.49
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.47
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.47
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 98.46
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.44
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.43
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.43
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.42
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.41
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.41
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.41
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 98.4
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.4
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 98.39
3qcp_A470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 98.39
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.38
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.38
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 98.37
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 98.36
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 98.35
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.35
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 98.33
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.32
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 98.32
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.32
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 98.29
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.28
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.26
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.24
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.2
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.18
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 98.12
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.11
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.11
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 98.08
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.04
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.04
1ttz_A87 Conserved hypothetical protein; structural genomic 98.0
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.99
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.84
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.81
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.8
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.76
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.76
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 97.75
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.72
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.72
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 97.7
2ece_A462 462AA long hypothetical selenium-binding protein; 97.67
2ece_A462 462AA long hypothetical selenium-binding protein; 97.66
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 97.66
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.66
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.62
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.56
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 97.53
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.46
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.41
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 97.38
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.36
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 97.36
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.29
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.28
1z6m_A175 Conserved hypothetical protein; structural genomic 97.25
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 97.22
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.19
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 97.17
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.16
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.16
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.14
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 97.12
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.06
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.03
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 96.91
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.84
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.82
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 96.8
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 96.79
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.76
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.75
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.72
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.7
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.69
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.68
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.62
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.6
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.6
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 96.59
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.58
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 96.57
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.57
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.54
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.54
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.54
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.53
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.52
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.52
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 96.5
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.49
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.49
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.47
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 96.39
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.38
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.37
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.36
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.32
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 96.26
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.26
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.22
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 96.22
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.2
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.18
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.18
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.18
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 96.13
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 96.12
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.1
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 96.1
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.09
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.04
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.02
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.01
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.99
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.98
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.97
1kte_A105 Thioltransferase; redox-active center, electron tr 95.96
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 95.92
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.89
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.86
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.85
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.82
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 95.77
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.73
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.72
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 95.65
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 95.64
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 95.62
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 95.56
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.55
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.54
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.47
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 95.45
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.43
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.38
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 95.34
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.29
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.26
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.23
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 95.23
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.21
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.2
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.2
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.2
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.15
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.14
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.12
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.08
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 95.07
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.06
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.85
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.85
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.79
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.74
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.73
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.73
1k32_A 1045 Tricorn protease; protein degradation, substrate g 94.69
4a2l_A795 BT_4663, two-component system sensor histidine kin 94.66
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 94.61
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.58
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.53
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 94.51
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.46
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.26
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.14
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 94.08
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 94.06
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 94.0
3jrp_A379 Fusion protein of protein transport protein SEC13 93.92
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 93.87
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.85
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.84
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 93.8
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 93.76
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 93.7
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 93.69
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.66
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 93.58
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 93.56
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 93.56
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
Probab=99.88  E-value=8.5e-23  Score=193.79  Aligned_cols=141  Identities=13%  Similarity=0.073  Sum_probs=120.5

Q ss_pred             cCCCCCCCceeecc-cCCCccccCCCCCCEEEEEEeccCCCCccCCCCcchhh-cHHHHHHHHHCCC--eEEEEEEcCCC
Q 004302           82 TFNEFQGPHHLWFN-IVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVT-FEKVKSIQQSFPQ--LQVIGFLHGCS  157 (762)
Q Consensus        82 tl~~l~g~~~~w~n-~~g~~v~Lsd~rGK~VvLnFWAtWC~pC~~p~C~~~~e-mP~L~~L~~~y~~--v~VvgV~~~~~  157 (762)
                      .+..-+.|+|...+ .+|+.++|++++||+|||+|||+||+||       +.+ +|.|++++++|++  ++||+|+.+..
T Consensus         3 ~~~g~~~p~~~~~~~~~g~~~~l~~~~gk~vlv~F~a~~C~~C-------~~e~~~~l~~l~~~~~~~~v~~v~v~~~~~   75 (160)
T 3lor_A            3 SLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGC-------VNHGVPQAQKIHRMIDESQVQVIGLHSVFE   75 (160)
T ss_dssp             -CTTCCBCCCCEEEESSSCCCCHHHHTTSEEEEEEECTTCHHH-------HHTHHHHHHHHHHHSCTTTEEEEEEECCCS
T ss_pred             ccCCCcCCCcccccccCCCccCHHHhCCCEEEEEEEcCCCcch-------hhhhhHHHHHHHHHhCcCCcEEEEEecccc
Confidence            34556677777777 7888999999999999999999999877       896 9999999999986  99999998521


Q ss_pred             ccCcCCHHHHHHHHHhcCCCcceeeCCCCc------cccccCc---e-EEEEcCCCCEEEEecCCcCHHHHHHHHHHHHH
Q 004302          158 TISAVDQTRLVEMLMKEYITFPILLSNKNF------PQMENGA---C-YLLSKDFGNARVFHENSLDIGMLNKAVEELIM  227 (762)
Q Consensus       158 ~~~e~~~~~v~~f~~k~~itfPVl~D~~~~------~~~~ygv---~-t~lId~~G~iv~~~~G~~~~~~L~~~l~~ll~  227 (762)
                      ....++.+.+++|+++++++||++.|....      +...|++   | +||||++|+++.++.|..+.++|++.|+++++
T Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~v~~~P~~~lid~~G~i~~~~~g~~~~~~l~~~i~~ll~  155 (160)
T 3lor_A           76 HHDVMTPEALKVFIDEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLS  155 (160)
T ss_dssp             CGGGSCHHHHHHHHHHTTCCSCEEEECCCTTCSSCHHHHHTTCCSSSEEEEECTTSBEEEEEESCCCHHHHHHHHHHHHT
T ss_pred             ccccCCHHHHHHHHHHcCCCCcEEECCccccchhhhHHHhcccCccceEEEECCCCcEEEEecCcCCHHHHHHHHHHHHh
Confidence            111247899999999999999999998876      7777765   4 69999999999999999999999999999997


Q ss_pred             hh
Q 004302          228 QQ  229 (762)
Q Consensus       228 ~~  229 (762)
                      +.
T Consensus       156 ~~  157 (160)
T 3lor_A          156 ET  157 (160)
T ss_dssp             CC
T ss_pred             cc
Confidence            64
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 762
d1q7fa_279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 0.001
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 38.9 bits (89), Expect = 0.001
 Identities = 11/47 (23%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 264 LHFPGCISADESGNRLFLSDSNHHRIIVFDGNGKILDCIGSCPGFED 310
              P  ++ +   + + ++D+N+HRI +FD  G+     G C   + 
Sbjct: 22  FTEPSGVAVNAQND-IIVADTNNHRIQIFDKEGRFKFQFGECGKRDS 67

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query762
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.9
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.89
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.89
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.89
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.86
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.86
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.85
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.84
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.81
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.81
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.75
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.75
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.74
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.73
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.73
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.71
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.69
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.68
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.68
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.67
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.67
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.67
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.67
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 99.66
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.66
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.66
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.66
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.64
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.61
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.6
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.58
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.57
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.56
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.54
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.54
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.51
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.5
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.5
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.46
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.45
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.41
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.41
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 99.39
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.38
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 99.34
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.32
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.22
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.22
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.21
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.21
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.18
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.17
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.15
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.15
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.15
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.11
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.1
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.09
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.08
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.07
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.06
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.05
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.03
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.0
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.0
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 98.99
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.98
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 98.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.92
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 98.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.84
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.75
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 98.74
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.68
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.68
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 98.64
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.55
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.52
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.48
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 98.43
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.43
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.41
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.41
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.36
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 98.19
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.17
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 98.13
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.1
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.09
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.09
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.09
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 98.08
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 97.97
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.92
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.9
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.88
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.78
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.69
d1wjka_100 Thioredoxin-like structure containing protein C330 97.68
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 97.64
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.63
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.55
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.47
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.4
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.34
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.3
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.24
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.0
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.98
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.88
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.74
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.66
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.32
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.29
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.06
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.98
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.94
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 95.71
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.67
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.59
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.15
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.9
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.9
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.85
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 94.75
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.56
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.3
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.09
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 93.8
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.6
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.52
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.74
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 92.12
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 92.05
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 90.65
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 88.36
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 88.04
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 87.05
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 84.94
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 84.82
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 83.36
d2axoa1225 Hypothetical protein Atu2684 {Agrobacterium tumefa 80.59
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Probable thiol-disulfide isomerase/thioredoxin TTHA0593
species: Thermus thermophilus [TaxId: 274]

Probab=99.90  E-value=8.6e-24  Score=208.87  Aligned_cols=144  Identities=10%  Similarity=0.022  Sum_probs=121.8

Q ss_pred             CCCceeecccCCCccccCCCCCCEEEEEEeccCCCCccCCCCcchhhcHHHHHHHHHCCC-eEEEEEEcCCC-ccCcCCH
Q 004302           87 QGPHHLWFNIVEDNIHFFKRGGAFLVLAGRFVDNCDSLIAGCGTVVTFEKVKSIQQSFPQ-LQVIGFLHGCS-TISAVDQ  164 (762)
Q Consensus        87 ~g~~~~w~n~~g~~v~Lsd~rGK~VvLnFWAtWC~pC~~p~C~~~~emP~L~~L~~~y~~-v~VvgV~~~~~-~~~e~~~  164 (762)
                      ++|+|.+.|.+|+.++|++++||+|||+|||+||+||       +++||.|.+|+++|++ +.||+|+..+. ...+++.
T Consensus        11 ~aPdF~l~d~~G~~~~Lsd~kGk~vvl~FwatwCp~C-------~~~~p~l~~l~~~y~~~v~~v~i~snd~~~~~~~~~   83 (187)
T d2cvba1          11 PLIDAELPDPRGGRYRLSQFHEPLLAVVFMCNHCPYV-------KGSIGELVALAERYRGKVAFVGINANDYEKYPEDAP   83 (187)
T ss_dssp             BCCCCEEECTTSCEEEGGGCCSSEEEEEEECSSCHHH-------HTTHHHHHHHHHHTTTTEEEEEEECCCTTTCGGGSH
T ss_pred             ccCccEeecCCCCEEEHHHhCCCeEEEEEeCCCCccc-------hhhhhhhhhhhhhccccceeeeeeccccccccccch
Confidence            6889999999999999999999999999999999877       9999999999999988 99999986431 1234578


Q ss_pred             HHHHHHHHhcCCCcceeeCCCCccccccCce----EEEEcCCCCEEEEec--------CCcCHHHHHHHHHHHHHhhccC
Q 004302          165 TRLVEMLMKEYITFPILLSNKNFPQMENGAC----YLLSKDFGNARVFHE--------NSLDIGMLNKAVEELIMQQQEN  232 (762)
Q Consensus       165 ~~v~~f~~k~~itfPVl~D~~~~~~~~ygv~----t~lId~~G~iv~~~~--------G~~~~~~L~~~l~~ll~~~~~~  232 (762)
                      +.+++|.++++++||+++|.+..+.++|++.    +||||++|+|+++..        ...+..+|+.+|+.+++....+
T Consensus        84 e~~~~~~~~~~~~~p~l~D~~~~~~~~~~v~~~P~~~liD~~G~i~y~G~idd~~~~~~~~~~~~L~~Ai~~ll~g~~~~  163 (187)
T d2cvba1          84 EKMAAFAEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRVNDNPKDPSKVQSHDLEAAIEALLRGEEPP  163 (187)
T ss_dssp             HHHHHHHHHHTCCSCEEECSSSHHHHHTTCCEESEEEEECTTCBEEEEECSSSCTTCGGGCCCCHHHHHHHHHHTTCCCC
T ss_pred             HHHHHHHHHhCCcceeeechhhhhcccccccceeeEEEEcCCCeEEEEeeecCCCCCCCCCCHHHHHHHHHHHHcCCCCC
Confidence            9999999999999999999999899999875    599999999997632        2344567999999999986554


Q ss_pred             CCCCC
Q 004302          233 SSSPS  237 (762)
Q Consensus       233 s~~~~  237 (762)
                      ....+
T Consensus       164 ~~~t~  168 (187)
T d2cvba1         164 LKEAP  168 (187)
T ss_dssp             SSCCC
T ss_pred             ccccC
Confidence            43333
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure