Citrus Sinensis ID: 004369


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------76
MASVPWAAAAACTLETKSRQPSSSLATLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFGVSF
cccHHHHHHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHccccccHHHHccHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHccccHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccc
ccHHHHHHHHHHHHcccHHHHHHHHHHcccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccEcccccEEcccccEEEc
MASVPWAAAAACTletksrqpssslatlkdknhtvsyqrsgskliqlngnsepvrslGFQEALSVltegpkvqtSSYVSLLQECvnrkslsnAEIIHAHIVktgshqdfFVMTFLVNVYgkcgnmeeaqkvfdnlprinvVSWTSLISGyvqnsqpeLAIHVFLDMleagnyptnvtLGTALTACSSLESIRLGKQIHAYVVKYqteddtsvgnsLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGAcgengeavQGLRFFSKMLsegiqpneftlTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDdlsahnggtEALSIFSKLnssgmkpdlytFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLlagvrpnqvTFVGALAACSNAGMVYEALGYFEMMQKeykikpvmDHYMCLIDMFVRLGCIEEAFDFIKkmdfepneVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTreeklsetddwswirikdkvysfkpndglhpqsAEIFKVLDELVEKAKCfgykqqesfeltdeesasvyhSEKLAIAFGllntpivspILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKfvnghctcrdfgvsf
MASVPWAAAAActletksrqpssslatlkdknhtvsYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKkcgrierasrvFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKnltreeklsetddwswiriKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKiitsltarEIIVRDSkrlhkfvnghctcrdfgvsf
MASVPWAAAAACTLETKSRQPSSSLATLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFGVSF
**********************************************************FQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDL******TEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTD**SASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFG***
*ASVPWAAAAACTLETKSRQPSSSLATLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFGVSF
MASVPWAAAAACTLE***********TLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFGVSF
MASVPWAAAAACTLETKSRQPSSSLATLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFGVSF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVPWAAAAACTLETKSRQPSSSLATLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFGVSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query758 2.2.26 [Sep-21-2011]
Q5G1T1850 Pentatricopeptide repeat- yes no 0.877 0.782 0.355 1e-132
Q3E6Q1809 Pentatricopeptide repeat- no no 0.885 0.829 0.362 1e-130
Q9SHZ8786 Pentatricopeptide repeat- no no 0.891 0.860 0.326 1e-127
Q9ZUW3868 Pentatricopeptide repeat- no no 0.886 0.774 0.356 1e-126
Q9SVP71064 Pentatricopeptide repeat- no no 0.890 0.634 0.329 1e-123
O82380738 Pentatricopeptide repeat- no no 0.895 0.920 0.339 1e-122
Q9SMZ2990 Pentatricopeptide repeat- no no 0.878 0.672 0.336 1e-122
Q9CAA8743 Putative pentatricopeptid no no 0.837 0.854 0.345 1e-121
O81767823 Pentatricopeptide repeat- no no 0.907 0.835 0.329 1e-120
Q9LYU9752 Pentatricopeptide repeat- no no 0.893 0.900 0.322 1e-120
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function desciption
 Score =  473 bits (1216), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 247/694 (35%), Positives = 401/694 (57%), Gaps = 29/694 (4%)

Query: 77  YVSLLQECVNRKSLSNAEIIHAHIVKTGSHQ-DFFVMTFLVNVYGKCGN-MEEAQKVFDN 134
           Y ++++ C N   +    +    ++KTG  + D  V   L++++ K  N  E A KVFD 
Sbjct: 169 YTAVIRACSNSDFVGVGRVTLGFLMKTGHFESDVCVGCSLIDMFVKGENSFENAYKVFDK 228

Query: 135 LPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLG 194
           +  +NVV+WT +I+  +Q   P  AI  FLDM+ +G      TL +  +AC+ LE++ LG
Sbjct: 229 MSELNVVTWTLMITRCMQMGFPREAIRFFLDMVLSGFESDKFTLSSVFSACAELENLSLG 288

Query: 195 KQIHAYVVKYQTEDDTSVGNSLCSLYSTC---GSLNSAIKAFNRIREKNVMSWTTVIGAC 251
           KQ+H++ ++    DD  V  SL  +Y+ C   GS++   K F+R+ + +VMSWT +I   
Sbjct: 289 KQLHSWAIRSGLVDD--VECSLVDMYAKCSADGSVDDCRKVFDRMEDHSVMSWTALITGY 346

Query: 252 GENGE-AVQGLRFFSKMLSEG-IQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYAS 309
            +N   A + +  FS+M+++G ++PN FT +S    CG +   RVG QV     K G AS
Sbjct: 347 MKNCNLATEAINLFSEMITQGHVEPNHFTFSSAFKACGNLSDPRVGKQVLGQAFKRGLAS 406

Query: 310 NLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGG 369
           N  V NS++ +++K   +++AQ+ F+ +S  NLV++N  + G  + ++            
Sbjct: 407 NSSVANSVISMFVKSDRMEDAQRAFESLSEKNLVSYNTFLDGTCRNLNF----------- 455

Query: 370 TEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTAL 429
            +A  + S++    +    +TF+S+L+  + + ++ +GEQIH+  +K G   +  V  AL
Sbjct: 456 EQAFKLLSEITERELGVSAFTFASLLSGVANVGSIRKGEQIHSQVVKLGLSCNQPVCNAL 515

Query: 430 VNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQ 489
           ++MY KCG I+ ASRVF  M  R +ISWTSMITGFA H  + + L+ F  M+  GV+PN+
Sbjct: 516 ISMYSKCGSIDTASRVFNFMENRNVISWTSMITGFAKHGFAIRVLETFNQMIEEGVKPNE 575

Query: 490 VTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIK 549
           VT+V  L+ACS+ G+V E   +F  M +++KIKP M+HY C++D+  R G + +AF+FI 
Sbjct: 576 VTYVAILSACSHVGLVSEGWRHFNSMYEDHKIKPKMEHYACMVDLLCRAGLLTDAFEFIN 635

Query: 550 KMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWED 609
            M F+ + ++W  F+  CR H N ELG  AA ++L+L P +  +Y  L +I+  AG+WE+
Sbjct: 636 TMPFQADVLVWRTFLGACRVHSNTELGKLAARKILELDPNEPAAYIQLSNIYACAGKWEE 695

Query: 610 VAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGY 669
              ++   +E  L +    SWI + DK++ F   D  HP + +I+  LD L+ + K  GY
Sbjct: 696 STEMRRKMKERNLVKEGGCSWIEVGDKIHKFYVGDTAHPNAHQIYDELDRLITEIKRCGY 755

Query: 670 KQQESFELTDEESASVY---------HSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHN 720
                  L   E  +           HSEK+A+AFGL++T    P+ V K+  +C DCHN
Sbjct: 756 VPDTDLVLHKLEEENDEAEKERLLYQHSEKIAVAFGLISTSKSRPVRVFKNLRVCGDCHN 815

Query: 721 FIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDF 754
            +K I++++ REI++RD  R H F +G C+C D+
Sbjct: 816 AMKYISTVSGREIVLRDLNRFHHFKDGKCSCNDY 849




May play a role in embryogenesis.
Arabidopsis thaliana (taxid: 3702)
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=3 SV=1 Back     alignment and function description
>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22 PE=3 SV=1 Back     alignment and function description
>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=3 SV=2 Back     alignment and function description
>sp|Q9LYU9|PP378_ARATH Pentatricopeptide repeat-containing protein At5g13270, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H90 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query758
359492976762 PREDICTED: pentatricopeptide repeat-cont 0.988 0.982 0.661 0.0
449523219755 PREDICTED: pentatricopeptide repeat-cont 0.977 0.981 0.605 0.0
356498879754 PREDICTED: pentatricopeptide repeat-cont 0.980 0.985 0.596 0.0
449461407749 PREDICTED: pentatricopeptide repeat-cont 0.932 0.943 0.615 0.0
224115126673 predicted protein [Populus trichocarpa] 0.869 0.979 0.651 0.0
356551789758 PREDICTED: pentatricopeptide repeat-cont 0.895 0.895 0.626 0.0
357490167765 Pentatricopeptide repeat-containing prot 0.985 0.976 0.583 0.0
255572826687 pentatricopeptide repeat-containing prot 0.894 0.986 0.623 0.0
125534384770 hypothetical protein OsI_36110 [Oryza sa 0.932 0.918 0.556 0.0
302142104683 unnamed protein product [Vitis vinifera] 0.883 0.980 0.581 0.0
>gi|359492976|ref|XP_002283668.2| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/765 (66%), Positives = 612/765 (80%), Gaps = 16/765 (2%)

Query: 1   MASVPWAAAAACTL-ETKSRQPSSSLATLKDKNHTVSYQRSGSKLIQLNGNSEPVRSLGF 59
           MAS+P  A       E++ R+ S+S     +K+ +VSYQRS     QL+G SE  R L F
Sbjct: 1   MASLPSVAVTRTPKSESEFRKYSASFLP-SEKSPSVSYQRS----TQLDGVSE-ARCLDF 54

Query: 60  QEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVY 119
           +EALS + EG KV+++ YV +LQEC+++K +S+A+ IHAHIVKTG+H+D F+MTFLVNVY
Sbjct: 55  REALSFIREGTKVESAFYVPILQECIDKKLVSDAQKIHAHIVKTGAHKDAFLMTFLVNVY 114

Query: 120 GKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLG 179
            KCG ME A+KVFD LPR NVVSWT+L++GYV +S+PELA+ VF +MLEAG YPTN TLG
Sbjct: 115 AKCGTMETARKVFDELPRRNVVSWTTLMTGYVHDSKPELAVQVFREMLEAGAYPTNYTLG 174

Query: 180 TALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREK 239
           TAL+A S L S  LGKQIH Y +KY+ E D S+GNSLCSLYS CGSL  A+KAF RIR+K
Sbjct: 175 TALSASSDLHSKELGKQIHGYSIKYRIEFDASIGNSLCSLYSKCGSLECAVKAFRRIRDK 234

Query: 240 NVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVH 299
           NV+SWTTVI A G+NGEA  GL+FF +MLSE ++PNEFTLTS  S+C  M SL +G Q+H
Sbjct: 235 NVISWTTVISAWGDNGEAATGLQFFVEMLSECVEPNEFTLTSALSLCCVMQSLDIGTQIH 294

Query: 300 SLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLA 359
           SL IKLG+ SNL ++NSIMYLYLKCG + EA+KLFD M  ++LVTWNAMIAGHA+MMD A
Sbjct: 295 SLTIKLGFESNLPIKNSIMYLYLKCGWIHEAKKLFDEMETISLVTWNAMIAGHARMMDFA 354

Query: 360 KDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGF 419
           KDDL+AH  GTEALSIF KLN SGMKPDL+TFSS+L++CS LVALEQGEQ+HA T+KTGF
Sbjct: 355 KDDLAAHQCGTEALSIFLKLNRSGMKPDLFTFSSVLSVCSSLVALEQGEQVHAQTIKTGF 414

Query: 420 LSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFED 479
           LSDVVVGTALVNMY KCG IERAS+ FVEMS RTLISWTSMITG+A +    QAL LFED
Sbjct: 415 LSDVVVGTALVNMYNKCGSIERASKAFVEMSIRTLISWTSMITGYAQNGQPQQALLLFED 474

Query: 480 MLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLG 539
           M LAGVRPN++TFVG L+ACS+AGMV EAL YF+MM+ EYKI PVMDHY CLIDMFVRLG
Sbjct: 475 MRLAGVRPNKITFVGVLSACSHAGMVDEALDYFQMMKNEYKITPVMDHYACLIDMFVRLG 534

Query: 540 CIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLD 599
            ++EAFDFIK+MD EPNE IWS+ IAGCR  G +ELGFYAAEQLL LKPKD E+Y +LL+
Sbjct: 535 RLDEAFDFIKEMDLEPNEFIWSILIAGCRSQGKLELGFYAAEQLLNLKPKDTETYNLLLN 594

Query: 600 IFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDE 659
           +++SAG+W++V+ V+ + +EEKL    DWSWI IKDK+YSFK N   H QS E++++L  
Sbjct: 595 MYLSAGKWKEVSRVRKMMKEEKLGRLKDWSWISIKDKIYSFKRNARSHAQSGEMYELLGN 654

Query: 660 LVEKAKCFGYKQQESFELTDEE---------SASVYHSEKLAIAFGLLNTPIVSPILVVK 710
           L EKAK FGY+ +ES E+TDEE         ++ VYHSEKLAIAFGLLNT    PI V K
Sbjct: 655 LHEKAKSFGYEWEESLEVTDEEEDADEEKALTSIVYHSEKLAIAFGLLNTSNAVPIRVTK 714

Query: 711 STTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDFG 755
           S +MCRDCHNFI+II+ L+AREII+RDSKRLHKF+NGHC+C DFG
Sbjct: 715 SISMCRDCHNFIRIISLLSAREIIIRDSKRLHKFINGHCSCGDFG 759




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449523219|ref|XP_004168621.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356498879|ref|XP_003518275.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Glycine max] Back     alignment and taxonomy information
>gi|449461407|ref|XP_004148433.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224115126|ref|XP_002332220.1| predicted protein [Populus trichocarpa] gi|222831877|gb|EEE70354.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356551789|ref|XP_003544256.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Glycine max] Back     alignment and taxonomy information
>gi|357490167|ref|XP_003615371.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355516706|gb|AES98329.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255572826|ref|XP_002527345.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533264|gb|EEF35017.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|125534384|gb|EAY80932.1| hypothetical protein OsI_36110 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|302142104|emb|CBI19307.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query758
TAIR|locus:2082886850 EMB2261 "embryo defective 2261 0.877 0.782 0.355 3e-124
TAIR|locus:2205425743 AT1G68930 "AT1G68930" [Arabido 0.713 0.728 0.364 2.5e-119
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.885 0.829 0.362 9.8e-119
TAIR|locus:2038603868 AT2G27610 "AT2G27610" [Arabido 0.845 0.738 0.365 6.2e-117
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.691 0.707 0.365 6.1e-114
TAIR|locus:21194401064 AT4G13650 [Arabidopsis thalian 0.890 0.634 0.329 3.2e-113
TAIR|locus:2125899990 AT4G33170 [Arabidopsis thalian 0.878 0.672 0.336 5.2e-113
TAIR|locus:2196583866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.885 0.774 0.333 2.2e-112
TAIR|locus:2178188995 MEF7 "AT5G09950" [Arabidopsis 0.885 0.674 0.355 4.2e-111
TAIR|locus:2032840937 AT1G16480 "AT1G16480" [Arabido 0.852 0.689 0.332 8.7e-111
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1221 (434.9 bits), Expect = 3.0e-124, P = 3.0e-124
 Identities = 247/694 (35%), Positives = 404/694 (58%)

Query:    77 YVSLLQECVNRKSLSNAEIIHAHIVKTGSHQ-DFFVMTFLVNVYGKCGN-MEEAQKVFDN 134
             Y ++++ C N   +    +    ++KTG  + D  V   L++++ K  N  E A KVFD 
Sbjct:   169 YTAVIRACSNSDFVGVGRVTLGFLMKTGHFESDVCVGCSLIDMFVKGENSFENAYKVFDK 228

Query:   135 LPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLG 194
             +  +NVV+WT +I+  +Q   P  AI  FLDM+ +G      TL +  +AC+ LE++ LG
Sbjct:   229 MSELNVVTWTLMITRCMQMGFPREAIRFFLDMVLSGFESDKFTLSSVFSACAELENLSLG 288

Query:   195 KQIHAYVVKYQTEDDTSVGNSLCSLYSTC---GSLNSAIKAFNRIREKNVMSWTTVIGAC 251
             KQ+H++ ++    DD     SL  +Y+ C   GS++   K F+R+ + +VMSWT +I   
Sbjct:   289 KQLHSWAIRSGLVDDVEC--SLVDMYAKCSADGSVDDCRKVFDRMEDHSVMSWTALITGY 346

Query:   252 GENGE-AVQGLRFFSKMLSEG-IQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYAS 309
              +N   A + +  FS+M+++G ++PN FT +S    CG +   RVG QV     K G AS
Sbjct:   347 MKNCNLATEAINLFSEMITQGHVEPNHFTFSSAFKACGNLSDPRVGKQVLGQAFKRGLAS 406

Query:   310 NLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGG 369
             N  V NS++ +++K   +++AQ+ F+ +S  NLV++N  + G  + ++            
Sbjct:   407 NSSVANSVISMFVKSDRMEDAQRAFESLSEKNLVSYNTFLDGTCRNLNFE---------- 456

Query:   370 TEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTAL 429
              +A  + S++    +    +TF+S+L+  + + ++ +GEQIH+  +K G   +  V  AL
Sbjct:   457 -QAFKLLSEITERELGVSAFTFASLLSGVANVGSIRKGEQIHSQVVKLGLSCNQPVCNAL 515

Query:   430 VNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQ 489
             ++MY KCG I+ ASRVF  M  R +ISWTSMITGFA H  + + L+ F  M+  GV+PN+
Sbjct:   516 ISMYSKCGSIDTASRVFNFMENRNVISWTSMITGFAKHGFAIRVLETFNQMIEEGVKPNE 575

Query:   490 VTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIK 549
             VT+V  L+ACS+ G+V E   +F  M +++KIKP M+HY C++D+  R G + +AF+FI 
Sbjct:   576 VTYVAILSACSHVGLVSEGWRHFNSMYEDHKIKPKMEHYACMVDLLCRAGLLTDAFEFIN 635

Query:   550 KMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWED 609
              M F+ + ++W  F+  CR H N ELG  AA ++L+L P +  +Y  L +I+  AG+WE+
Sbjct:   636 TMPFQADVLVWRTFLGACRVHSNTELGKLAARKILELDPNEPAAYIQLSNIYACAGKWEE 695

Query:   610 VAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGY 669
                ++   +E  L +    SWI + DK++ F   D  HP + +I+  LD L+ + K  GY
Sbjct:   696 STEMRRKMKERNLVKEGGCSWIEVGDKIHKFYVGDTAHPNAHQIYDELDRLITEIKRCGY 755

Query:   670 ---------KQQESFELTDEESASVYHSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHN 720
                      K +E  +  ++E     HSEK+A+AFGL++T    P+ V K+  +C DCHN
Sbjct:   756 VPDTDLVLHKLEEENDEAEKERLLYQHSEKIAVAFGLISTSKSRPVRVFKNLRVCGDCHN 815

Query:   721 FIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDF 754
              +K I++++ REI++RD  R H F +G C+C D+
Sbjct:   816 AMKYISTVSGREIVLRDLNRFHHFKDGKCSCNDY 849


GO:0009507 "chloroplast" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
TAIR|locus:2205425 AT1G68930 "AT1G68930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query758
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-170
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-154
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-88
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-55
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-36
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-16
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 3e-13
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-06
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  512 bits (1320), Expect = e-170
 Identities = 247/703 (35%), Positives = 399/703 (56%), Gaps = 21/703 (2%)

Query: 59  FQEALS----VLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTF 114
           F EAL     +L  G +    ++  +L+ C     L+    +HAH+V+ G   D  V+  
Sbjct: 168 FDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNA 227

Query: 115 LVNVYGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPT 174
           L+ +Y KCG++  A+ VFD +PR + +SW ++ISGY +N +    + +F  M E    P 
Sbjct: 228 LITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPD 287

Query: 175 NVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFN 234
            +T+ + ++AC  L   RLG+++H YVVK     D SV NSL  +Y + GS   A K F+
Sbjct: 288 LMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFS 347

Query: 235 RIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRV 294
           R+  K+ +SWT +I    +NG   + L  ++ M  + + P+E T+ S+ S C  +  L V
Sbjct: 348 RMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDV 407

Query: 295 GAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQ 354
           G ++H L  + G  S + V N+++ +Y KC  +D+A ++F  +   ++++W ++IAG   
Sbjct: 408 GVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAG--- 464

Query: 355 MMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALT 414
                   L  +N   EAL  F ++  + +KP+  T  + L+ C+R+ AL  G++IHA  
Sbjct: 465 --------LRLNNRCFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHV 515

Query: 415 LKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMSTRTLISWTSMITGFANHSLSHQAL 474
           L+TG   D  +  AL+++Y +CGR+  A   F     + ++SW  ++TG+  H     A+
Sbjct: 516 LRTGIGFDGFLPNALLDLYVRCGRMNYAWNQF-NSHEKDVVSWNILLTGYVAHGKGSMAV 574

Query: 475 QLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDM 534
           +LF  M+ +GV P++VTF+  L ACS +GMV + L YF  M+++Y I P + HY C++D+
Sbjct: 575 ELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDL 634

Query: 535 FVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESY 594
             R G + EA++FI KM   P+  +W   +  CR H ++ELG  AA+ + +L P     Y
Sbjct: 635 LGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYY 694

Query: 595 AMLLDIFVSAGRWEDVAVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIF 654
            +L +++  AG+W++VA V+   RE  L+     SW+ +K KV++F  +D  HPQ  EI 
Sbjct: 695 ILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEIN 754

Query: 655 KVLDELVEKAKCFGYKQQESFELTDEE--SASVY--HSEKLAIAFGLLNTPIVSPILVVK 710
            VL+   EK K  G    ES  + + E     ++  HSE+LAIAFGL+NT    PI V K
Sbjct: 755 TVLEGFYEKMKASGLAGSESSSMDEIEVSKDDIFCGHSERLAIAFGLINTVPGMPIWVTK 814

Query: 711 STTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRD 753
           +  MC +CHN +K I+ +  REI VRD+++ H F +G C+C D
Sbjct: 815 NLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD 857


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 758
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.82
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.78
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK14574 822 hmsH outer membrane protein; Provisional 99.76
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.74
PRK14574 822 hmsH outer membrane protein; Provisional 99.73
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.69
KOG2003840 consensus TPR repeat-containing protein [General f 99.68
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.64
KOG2076895 consensus RNA polymerase III transcription factor 99.64
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.63
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.62
KOG2076895 consensus RNA polymerase III transcription factor 99.58
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.52
KOG0547606 consensus Translocase of outer mitochondrial membr 99.48
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.47
KOG2003840 consensus TPR repeat-containing protein [General f 99.45
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.43
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.41
KOG1915677 consensus Cell cycle control protein (crooked neck 99.41
KOG1126638 consensus DNA-binding cell division cycle control 99.39
KOG1915677 consensus Cell cycle control protein (crooked neck 99.39
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.38
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.36
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.35
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.35
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.33
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.32
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.32
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.26
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.24
PF1304150 PPR_2: PPR repeat family 99.24
PF1304150 PPR_2: PPR repeat family 99.23
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.22
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.17
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.15
PRK12370553 invasion protein regulator; Provisional 99.11
KOG0547606 consensus Translocase of outer mitochondrial membr 99.1
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.08
KOG2376652 consensus Signal recognition particle, subunit Srp 99.07
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.05
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.05
PRK11189296 lipoprotein NlpI; Provisional 99.05
PRK12370553 invasion protein regulator; Provisional 99.05
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.04
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.02
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.0
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.98
PRK11189296 lipoprotein NlpI; Provisional 98.97
KOG1129478 consensus TPR repeat-containing protein [General f 98.97
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.96
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.95
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.93
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.92
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.86
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.85
KOG1129478 consensus TPR repeat-containing protein [General f 98.83
KOG2376652 consensus Signal recognition particle, subunit Srp 98.83
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.8
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.77
KOG1125579 consensus TPR repeat-containing protein [General f 98.75
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.74
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.73
PRK04841903 transcriptional regulator MalT; Provisional 98.68
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.68
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.66
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.64
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.63
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.61
PRK15359144 type III secretion system chaperone protein SscB; 98.58
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.58
PRK10370198 formate-dependent nitrite reductase complex subuni 98.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.53
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.51
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.5
PRK15359144 type III secretion system chaperone protein SscB; 98.5
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.49
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.48
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.47
PLN02789320 farnesyltranstransferase 98.46
PF1285434 PPR_1: PPR repeat 98.45
PF1285434 PPR_1: PPR repeat 98.43
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.41
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.41
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.4
PRK04841903 transcriptional regulator MalT; Provisional 98.39
PRK10370198 formate-dependent nitrite reductase complex subuni 98.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.32
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.3
KOG1128777 consensus Uncharacterized conserved protein, conta 98.3
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.29
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.28
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.28
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.27
KOG1128777 consensus Uncharacterized conserved protein, conta 98.25
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.21
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.2
PLN02789320 farnesyltranstransferase 98.19
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.18
KOG1125579 consensus TPR repeat-containing protein [General f 98.13
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.12
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.07
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.07
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.07
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.04
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.0
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.98
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.92
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.87
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.86
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.84
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.83
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.82
KOG0553304 consensus TPR repeat-containing protein [General f 97.8
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.78
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.75
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.73
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.72
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.7
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.68
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.67
PRK15331165 chaperone protein SicA; Provisional 97.65
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.64
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.63
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.6
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.59
COG3898531 Uncharacterized membrane-bound protein [Function u 97.59
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.55
KOG0553304 consensus TPR repeat-containing protein [General f 97.54
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.53
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.49
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.47
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.46
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.43
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.36
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.36
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.34
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.31
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.23
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.2
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.19
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.17
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.1
KOG20411189 consensus WD40 repeat protein [General function pr 97.1
PF1337173 TPR_9: Tetratricopeptide repeat 97.1
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.04
PF1343134 TPR_17: Tetratricopeptide repeat 97.01
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.99
COG4700251 Uncharacterized protein conserved in bacteria cont 96.96
COG3898531 Uncharacterized membrane-bound protein [Function u 96.95
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.94
COG4700251 Uncharacterized protein conserved in bacteria cont 96.92
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.9
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.86
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.86
PF12688120 TPR_5: Tetratrico peptide repeat 96.86
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.83
PF1337173 TPR_9: Tetratricopeptide repeat 96.82
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.82
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.82
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.81
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.8
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.74
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.73
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.69
PRK10803263 tol-pal system protein YbgF; Provisional 96.69
KOG20411189 consensus WD40 repeat protein [General function pr 96.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.65
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.65
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.63
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.62
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.58
PF12688120 TPR_5: Tetratrico peptide repeat 96.57
PF1342844 TPR_14: Tetratricopeptide repeat 96.55
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.54
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.39
PRK10803263 tol-pal system protein YbgF; Provisional 96.36
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.05
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.04
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.01
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.95
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.89
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.87
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.86
KOG4555175 consensus TPR repeat-containing protein [Function 95.73
PRK11906458 transcriptional regulator; Provisional 95.7
KOG1258577 consensus mRNA processing protein [RNA processing 95.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.64
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.54
PRK11906458 transcriptional regulator; Provisional 95.44
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.41
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.41
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.38
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.37
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.32
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.29
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.22
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.17
KOG1585308 consensus Protein required for fusion of vesicles 95.08
PF13512142 TPR_18: Tetratricopeptide repeat 95.02
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.92
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.84
KOG3941406 consensus Intermediate in Toll signal transduction 94.79
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.27
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.17
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.14
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.06
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.97
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.96
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.85
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.78
KOG2610491 consensus Uncharacterized conserved protein [Funct 93.71
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.65
PF13512142 TPR_18: Tetratricopeptide repeat 93.61
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.58
KOG3941406 consensus Intermediate in Toll signal transduction 93.54
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.52
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.49
KOG2610491 consensus Uncharacterized conserved protein [Funct 93.37
smart00299140 CLH Clathrin heavy chain repeat homology. 93.3
PRK15331165 chaperone protein SicA; Provisional 93.25
KOG4234271 consensus TPR repeat-containing protein [General f 93.18
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.14
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.12
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.09
smart00299140 CLH Clathrin heavy chain repeat homology. 93.03
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.83
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.68
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.62
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.55
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.39
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.28
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.24
KOG1941518 consensus Acetylcholine receptor-associated protei 91.91
PF1342844 TPR_14: Tetratricopeptide repeat 91.45
KOG4555175 consensus TPR repeat-containing protein [Function 91.4
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 90.86
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.78
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.23
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.15
PRK09687280 putative lyase; Provisional 90.14
PRK09687280 putative lyase; Provisional 89.94
PF13281374 DUF4071: Domain of unknown function (DUF4071) 89.74
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.58
COG3629280 DnrI DNA-binding transcriptional activator of the 89.37
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.33
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 89.07
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.94
KOG3364149 consensus Membrane protein involved in organellar 88.93
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.85
KOG4648 536 consensus Uncharacterized conserved protein, conta 88.49
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.46
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.14
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.84
PRK10941269 hypothetical protein; Provisional 87.55
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 87.05
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 87.02
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 86.87
KOG1586288 consensus Protein required for fusion of vesicles 85.81
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.73
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.6
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 84.93
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.85
PF13170297 DUF4003: Protein of unknown function (DUF4003) 84.81
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.42
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 84.41
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.81
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.48
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.31
KOG1585308 consensus Protein required for fusion of vesicles 82.51
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.19
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 81.93
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 81.84
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 81.42
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 81.34
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.33
COG3629280 DnrI DNA-binding transcriptional activator of the 81.21
COG3947361 Response regulator containing CheY-like receiver a 80.83
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 80.53
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 80.43
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 80.05
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.2e-135  Score=1183.14  Aligned_cols=690  Identities=35%  Similarity=0.648  Sum_probs=680.1

Q ss_pred             CCCchhHHHHHHHHHHHcCCCCCcchHHHHHHHhhcCCCcHHHHHHHHHHHHhCCCCchhHHHHHHHHhhcCCChHHHHH
Q 004369           51 SEPVRSLGFQEALSVLTEGPKVQTSSYVSLLQECVNRKSLSNAEIIHAHIVKTGSHQDFFVMTFLVNVYGKCGNMEEAQK  130 (758)
Q Consensus        51 ~~~~~~~a~~~~~~~~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~  130 (758)
                      ..|++++|+++|.+|...|+.||.+||+.++++|+..+++..+.++|..+++.|+.||+.++|+||++|+++|++++|.+
T Consensus       164 ~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~  243 (857)
T PLN03077        164 KAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARL  243 (857)
T ss_pred             hCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHH
Confidence            36889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHccCCCCCcchHHHHHHHHHhCCCchHHHHHHHHHHHcCCCCChhhHHHHHHHhcccCChHHHHHHHHHHHHhCCCCCh
Q 004369          131 VFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIHAYVVKYQTEDDT  210 (758)
Q Consensus       131 ~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~  210 (758)
                      +|++|+++|+++||+||.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.|+++|..+.+.|+.||.
T Consensus       244 lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~  323 (857)
T PLN03077        244 VFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDV  323 (857)
T ss_pred             HHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHhhcCChHHHHHHHhccCCCCcchHHHHHHHHhhCCChhhHHHHHHHHHHCCCCCChhhHHHHHHHHcccC
Q 004369          211 SVGNSLCSLYSTCGSLNSAIKAFNRIREKNVMSWTTVIGACGENGEAVQGLRFFSKMLSEGIQPNEFTLTSISSVCGTML  290 (758)
Q Consensus       211 ~~~~~Li~~y~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~  290 (758)
                      .+||+|+++|+++|++++|.++|++|.+||+++||+||.+|++.|++++|+++|++|.+.|+.||..||++++.+|++.|
T Consensus       324 ~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g  403 (857)
T PLN03077        324 SVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLG  403 (857)
T ss_pred             HHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHccCCCCCeeechhHHHHHhhhchhhhchhhcCCChh
Q 004369          291 SLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMSHVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGT  370 (758)
Q Consensus       291 ~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~li~~~~~~~~~~~~~l~~~g~~~  370 (758)
                      +++.|.++|+.+.+.|+.++..++|+|+++|+++|++++|.++|++|.++|+++||+||.+|++           +|+.+
T Consensus       404 ~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~-----------~g~~~  472 (857)
T PLN03077        404 DLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRL-----------NNRCF  472 (857)
T ss_pred             hHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHH-----------CCCHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999           99999


Q ss_pred             HHHHHHHHhHhCCCCCCHHHHHHHHHHHhcccchHHHHHHHHHHHHcCCCChHHHHhHHhhhHHhcCCHHHHHHHHHhcC
Q 004369          371 EALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMS  450 (758)
Q Consensus       371 ~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~~~~~~~~~~~~Li~~y~~~g~~~~A~~~~~~~~  450 (758)
                      +|+.+|++|.. +++||..||+++|.+|++.|+++.+.++|..+.+.|+.+|..++|+|+++|+|+|++++|.++|+++ 
T Consensus       473 eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-  550 (857)
T PLN03077        473 EALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-  550 (857)
T ss_pred             HHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-
Confidence            99999999986 5999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CCChhHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccccHHHHHHHHHHhhhhcCCCCCHHHHHH
Q 004369          451 TRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMC  530 (758)
Q Consensus       451 ~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~  530 (758)
                      .+|+++||+||.+|+++|+.++|+++|++|.+.|+.||.+||+.+|.+|++.|++++|.++|+.|.+++|+.|+..+|++
T Consensus       551 ~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~  630 (857)
T PLN03077        551 EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYAC  630 (857)
T ss_pred             CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999977899999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHhccCCCCchhHHHHHHHhhhCCCchhH
Q 004369          531 LIDMFVRLGCIEEAFDFIKKMDFEPNEVIWSVFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDV  610 (758)
Q Consensus       531 li~~~~~~g~~~~A~~~~~~m~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a  610 (758)
                      |+++|++.|++++|.+++++|+++||..+|++|+.+|+.+|+.+.|+.+++++++++|+++..|..|+++|++.|+|++|
T Consensus       631 lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a  710 (857)
T PLN03077        631 VVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEV  710 (857)
T ss_pred             HHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhCCCCCCCceeEEEECCEEEEEecCCCCCCChHHHHHHHHHHHHHHHHcCcccCCccccchhh----hhhhh
Q 004369          611 AVVKNLTREEKLSETDDWSWIRIKDKVYSFKPNDGLHPQSAEIFKVLDELVEKAKCFGYKQQESFELTDEE----SASVY  686 (758)
Q Consensus       611 ~~~~~~m~~~~~~~~~~~s~~~~~~~~~~f~~~~~~~~~~~~i~~~l~~l~~~m~~~g~~~~~~~~~~~~~----~~~~~  686 (758)
                      .++++.|+++|++|+||+|||++++++|.|.+||.+||+.++||.+|++|..+|++.||.||+..++++.+    ..+++
T Consensus       711 ~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~~~~~~~~~~~k~~~~~~  790 (857)
T PLN03077        711 ARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSMDEIEVSKDDIFCG  790 (857)
T ss_pred             HHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCcchhccccHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999998886543    77899


Q ss_pred             hhHHHHHHHcccCCCCCCcEEEEeccccCCchhHHHHHHhhhcCCeEEEecCCccccccCccccccc
Q 004369          687 HSEKLAIAFGLLNTPIVSPILVVKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRD  753 (758)
Q Consensus       687 ~~~~~a~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~h~~~~g~cs~~~  753 (758)
                      ||||||+|||||+||+|.||||+||||||+|||+++||||++++|||||||.+|||||+||+|||+|
T Consensus       791 hse~la~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d  857 (857)
T PLN03077        791 HSERLAIAFGLINTVPGMPIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD  857 (857)
T ss_pred             ccHHHHHHHhhhcCCCCCeEEEeCCCEeCccHHHHHHHHHHHhCeEEEEecCCcceeCCCCcccCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999998



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query758
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 9e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 5e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 64.5 bits (155), Expect = 9e-11
 Identities = 22/193 (11%), Positives = 58/193 (30%), Gaps = 11/193 (5%)

Query: 372 ALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKTGFLSDVVVGTALVN 431
           A  +      +   P     + +L      ++L+  +       +           A   
Sbjct: 76  AGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFK 135

Query: 432 MYKKCGRIERASRVFVEMSTR-------TLISWTSMITGFANHSLSHQALQLFEDMLLAG 484
                 ++  A  + V    +       TL  + +++ G+A      + + +   +  AG
Sbjct: 136 CCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAG 195

Query: 485 VRPNQVTFVGALAACSNAGMVYEALGYF--EMMQKEYKIKPVMDHYMCLIDMFVRLGCIE 542
           + P+ +++  AL            +     +M Q+  K++ +      L+    R   ++
Sbjct: 196 LTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALF--TAVLLSEEDRATVLK 253

Query: 543 EAFDFIKKMDFEP 555
                       P
Sbjct: 254 AVHKVKPTFSLPP 266


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query758
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.81
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.73
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.72
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.69
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.69
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.67
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.66
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.65
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.59
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.48
3u4t_A272 TPR repeat-containing protein; structural genomics 99.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.45
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.44
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.43
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.43
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.41
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.4
3u4t_A272 TPR repeat-containing protein; structural genomics 99.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.38
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.38
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.36
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.35
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.32
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.25
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.25
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.24
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.22
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.21
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.21
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.19
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.19
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.18
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.14
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.12
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.06
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.03
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.99
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.96
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.95
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.94
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.93
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.92
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.91
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.89
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.87
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.85
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.82
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.82
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.78
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.76
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.75
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.74
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.7
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.69
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.66
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.64
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.63
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.62
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.6
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.55
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.54
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.5
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.49
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.47
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.46
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.46
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.43
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.42
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.4
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.39
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.39
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.36
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.36
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.34
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.34
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.33
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.32
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.3
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.29
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.29
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.29
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.27
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.27
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.2
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.19
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.19
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.13
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.12
3k9i_A117 BH0479 protein; putative protein binding protein, 98.07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.05
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.03
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.02
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.01
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.0
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.99
3k9i_A117 BH0479 protein; putative protein binding protein, 97.99
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.99
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.99
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.97
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.94
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.93
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.92
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.89
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.88
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.86
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.84
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.82
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.75
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.74
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.51
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.43
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.42
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.38
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.32
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.28
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.28
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.22
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.2
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.0
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.98
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.98
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.96
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.73
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.24
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.19
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.17
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.17
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.09
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.97
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.94
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.65
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.52
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.35
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.93
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 94.76
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.46
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.41
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.2
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 92.99
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.94
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.83
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.4
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.07
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 89.92
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 89.45
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.68
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.17
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.95
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.21
2p58_C116 Putative type III secretion protein YSCG; type III 85.21
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.89
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 84.42
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.32
2p58_C116 Putative type III secretion protein YSCG; type III 83.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 83.3
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 81.85
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 80.81
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.8
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 80.69
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.5e-41  Score=385.08  Aligned_cols=480  Identities=9%  Similarity=-0.054  Sum_probs=401.9

Q ss_pred             hhcCCChHHHHHHHccCCCCCcchHHHHHHHHHhCCCchHHHHHHHHHHHcCCCCChhhHHHHHHHhcccCChHHHHHHH
Q 004369          119 YGKCGNMEEAQKVFDNLPRINVVSWTSLISGYVQNSQPELAIHVFLDMLEAGNYPTNVTLGTALTACSSLESIRLGKQIH  198 (758)
Q Consensus       119 ~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~  198 (758)
                      +.+.|.+..+...|+.++.+++..|+.++..|.+.|++++|+.+|++|..  ..|+..++..+..+|...|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            45677788888999999988999999999999999999999999999985  4688899999999999999999999999


Q ss_pred             HHHHHhCCCCChhHHHHHHHHHhhcCChHHHHHHHhccCCC-------------------CcchHHHHHHHHhhCCChhh
Q 004369          199 AYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIREK-------------------NVMSWTTVIGACGENGEAVQ  259 (758)
Q Consensus       199 ~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  259 (758)
                      +.+...  +++..+++.++.+|.++|++++|.++|+++...                   ++.+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            988643  678899999999999999999999999965433                   37899999999999999999


Q ss_pred             HHHHHHHHHHCCCCCChh-hHHHHHHHHcccCChHH--HHHH-HHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHc
Q 004369          260 GLRFFSKMLSEGIQPNEF-TLTSISSVCGTMLSLRV--GAQV-HSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFD  335 (758)
Q Consensus       260 A~~l~~~m~~~g~~p~~~-t~~~ll~~~~~~~~~~~--a~~~-~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~  335 (758)
                      |+++|++|.+.+  |+.. .+..+...+...+..+.  +..+ +..+...+......+++.++.+|.+.|++++|.++|+
T Consensus       219 A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~  296 (597)
T 2xpi_A          219 AKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLS  296 (597)
T ss_dssp             HHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHH
Confidence            999999998854  5443 33333333322222111  1111 4445555555566778888999999999999999999


Q ss_pred             cCCC--CCeeechhHHHHHhhhchhhhchhhcCCChhHHHHHHHHhHhCCCCCCHHHHHHHHHHHhcccchHHHHHHHHH
Q 004369          336 GMSH--VNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHAL  413 (758)
Q Consensus       336 ~m~~--~~~~~~~~li~~~~~~~~~~~~~l~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~i~~~  413 (758)
                      ++.+  ++..+|+.++.+|.+           .|++++|+++|++|.+.+ +.+..++..++.++...|++++|.+++..
T Consensus       297 ~~~~~~~~~~~~~~l~~~~~~-----------~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  364 (597)
T 2xpi_A          297 SINGLEKSSDLLLCKADTLFV-----------RSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISND  364 (597)
T ss_dssp             TSTTGGGCHHHHHHHHHHHHH-----------TTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             HhhcCCchHHHHHHHHHHHHH-----------hcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHH
Confidence            9987  888999999999999           999999999999998764 33778899999999999999999999999


Q ss_pred             HHHcCCCChHHHHhHHhhhHHhcCCHHHHHHHHHhcC---CCChhHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHH
Q 004369          414 TLKTGFLSDVVVGTALVNMYKKCGRIERASRVFVEMS---TRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPNQV  490 (758)
Q Consensus       414 ~~~~~~~~~~~~~~~Li~~y~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~  490 (758)
                      +.+.. +.+..+++.++.+|.++|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|+++|++|.+.+ +.+..
T Consensus       365 ~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~  442 (597)
T 2xpi_A          365 LVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHL  442 (597)
T ss_dssp             HHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSH
T ss_pred             HHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchH
Confidence            98654 5678899999999999999999999999875   4578899999999999999999999999999863 44788


Q ss_pred             HHHHHHHHHhccccHHHHHHHHHHhhhhcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHc-------CCCCC--HHHHH
Q 004369          491 TFVGALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKM-------DFEPN--EVIWS  561 (758)
Q Consensus       491 t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m-------~~~p~--~~~~~  561 (758)
                      ++..++.+|.+.|++++|.++|+.+.+.  .+.+..+|+.++.+|.+.|++++|.++|+++       +..|+  ..+|.
T Consensus       443 ~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~  520 (597)
T 2xpi_A          443 PYLFLGMQHMQLGNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWA  520 (597)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHH
T ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHH
Confidence            9999999999999999999999999873  3446889999999999999999999999998       45787  78999


Q ss_pred             HHHHHHHHcCChhHHHHHHHHHhccCCCCchhHHHHHHHhhhCCCchhHHHHHHHhhhC
Q 004369          562 VFIAGCRRHGNMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGRWEDVAVVKNLTREE  620 (758)
Q Consensus       562 ~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~  620 (758)
                      .++.+|.+.|++++|...++++++.+|+++.+|..++.+|.+.|++++|.+.++++.+.
T Consensus       521 ~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~  579 (597)
T 2xpi_A          521 NLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAI  579 (597)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999873



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 758
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.6 bits (109), Expect = 6e-06
 Identities = 31/191 (16%), Positives = 62/191 (32%), Gaps = 18/191 (9%)

Query: 429 LVNMYKKCGRIERASRVF---VEMSTRTLISWTSMITGFANHSLSHQALQLFEDMLLAGV 485
           L  ++   G I  A   F   V +    L ++ ++        +  +A+  +   L    
Sbjct: 175 LGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSP 234

Query: 486 RPNQVTFVGALAACSNAGMVYEALGYFEMMQKEYK----IKP-VMDHYMCLIDMFVRLGC 540
                          N   VY   G  ++    Y+    ++P   D Y  L +     G 
Sbjct: 235 NHAV--------VHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGS 286

Query: 541 IEEAFDFIKKMDFEPNEVIWSVFIAG--CRRHGNMELGFYAAEQLLKLKPKDCESYAMLL 598
           + EA D              S+       R  GN+E       + L++ P+   +++ L 
Sbjct: 287 VAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLA 346

Query: 599 DIFVSAGRWED 609
            +    G+ ++
Sbjct: 347 SVLQQQGKLQE 357


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query758
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.86
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.45
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.01
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.96
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.92
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.92
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.84
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.64
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.64
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.55
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.38
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.38
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.25
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.21
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.2
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.11
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.03
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.03
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.02
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.99
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.97
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.69
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.67
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.65
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.58
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.54
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.46
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.44
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.44
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.24
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.98
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.92
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.87
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.45
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.64
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.7
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.52
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.51
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.95
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 88.62
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.38
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 81.07
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=8e-20  Score=191.16  Aligned_cols=369  Identities=11%  Similarity=0.091  Sum_probs=256.9

Q ss_pred             HhcccCChHHHHHHHHHHHHhCCCCChhHHHHHHHHHhhcCChHHHHHHHhccCC--C-CcchHHHHHHHHhhCCChhhH
Q 004369          184 ACSSLESIRLGKQIHAYVVKYQTEDDTSVGNSLCSLYSTCGSLNSAIKAFNRIRE--K-NVMSWTTVIGACGENGEAVQG  260 (758)
Q Consensus       184 ~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~~~~--~-~~~~~~~li~~~~~~g~~~~A  260 (758)
                      .+.+.|+++.|.+.+..+++.. +.+..++..+...|.+.|++++|...|++..+  | +..+|..+...|.+.|++++|
T Consensus         8 ~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A   86 (388)
T d1w3ba_           8 REYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccc
Confidence            3445566666666666666543 22345555566666666666666666665543  2 334555566666666666666


Q ss_pred             HHHHHHHHHCCCCCChhhHHHHHHHHcccCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHccCC--
Q 004369          261 LRFFSKMLSEGIQPNEFTLTSISSVCGTMLSLRVGAQVHSLGIKLGYASNLRVRNSIMYLYLKCGLVDEAQKLFDGMS--  338 (758)
Q Consensus       261 ~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~--  338 (758)
                      +..+.........                                    +..........+...+....+........  
T Consensus        87 ~~~~~~~~~~~~~------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  130 (388)
T d1w3ba_          87 IEHYRHALRLKPD------------------------------------FIDGYINLAAALVAAGDMEGAVQAYVSALQY  130 (388)
T ss_dssp             HHHHHHHHHHCTT------------------------------------CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHH
T ss_pred             ccccccccccccc------------------------------------ccccccccccccccccccccccccccccccc
Confidence            6666665543211                                    11111122222222222222222221111  


Q ss_pred             -CCCeeechhHHHHHhhhchhhhchhhcCCChhHHHHHHHHhHhCCCCCCHHHHHHHHHHHhcccchHHHHHHHHHHHHc
Q 004369          339 -HVNLVTWNAMIAGHAQMMDLAKDDLSAHNGGTEALSIFSKLNSSGMKPDLYTFSSILTICSRLVALEQGEQIHALTLKT  417 (758)
Q Consensus       339 -~~~~~~~~~li~~~~~~~~~~~~~l~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~  417 (758)
                       ......+.........           .+....+...+.+..... +-+...+..+...+...++.+.|...+....+.
T Consensus       131 ~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~  198 (388)
T d1w3ba_         131 NPDLYCVRSDLGNLLKA-----------LGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL  198 (388)
T ss_dssp             CTTCTHHHHHHHHHHHT-----------TSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH
T ss_pred             ccccccccccccccccc-----------cchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHh
Confidence             1112222222333333           666666666666665532 224556666677778888888888888887775


Q ss_pred             CCCChHHHHhHHhhhHHhcCCHHHHHHHHHhcC---CCChhHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCC-HHHHH
Q 004369          418 GFLSDVVVGTALVNMYKKCGRIERASRVFVEMS---TRTLISWTSMITGFANHSLSHQALQLFEDMLLAGVRPN-QVTFV  493 (758)
Q Consensus       418 ~~~~~~~~~~~Li~~y~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~t~~  493 (758)
                      . +.+...+..+...|...|++++|...|++..   ..+...|..+...+.+.|++++|+..|++..+.  .|+ ..++.
T Consensus       199 ~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~  275 (388)
T d1w3ba_         199 D-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYC  275 (388)
T ss_dssp             C-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHH
T ss_pred             C-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHH
Confidence            4 4456788889999999999999999998765   446678888999999999999999999999884  555 66788


Q ss_pred             HHHHHHhccccHHHHHHHHHHhhhhcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHc-CCCC-CHHHHHHHHHHHHHcC
Q 004369          494 GALAACSNAGMVYEALGYFEMMQKEYKIKPVMDHYMCLIDMFVRLGCIEEAFDFIKKM-DFEP-NEVIWSVFIAGCRRHG  571 (758)
Q Consensus       494 ~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m-~~~p-~~~~~~~ll~~~~~~g  571 (758)
                      .+..++...|++++|.+.++....  ..+.+...+..+...+.+.|++++|++.+++. ...| +..+|..+...+...|
T Consensus       276 ~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g  353 (388)
T d1w3ba_         276 NLANALKEKGSVAEAEDCYNTALR--LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQG  353 (388)
T ss_dssp             HHHHHHHHHSCHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHcCCHHHHHHHHHhhhc--cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcC
Confidence            888999999999999999999876  34556788899999999999999999999997 7777 5678999999999999


Q ss_pred             ChhHHHHHHHHHhccCCCCchhHHHHHHHhhhCCC
Q 004369          572 NMELGFYAAEQLLKLKPKDCESYAMLLDIFVSAGR  606 (758)
Q Consensus       572 ~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  606 (758)
                      ++++|...++++++++|+++.+|..|+++|.+.|+
T Consensus       354 ~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         354 KLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             CCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            99999999999999999999999999999988875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure