Citrus Sinensis ID: 004425


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750----
MHTLLPANLLQPPFKSQQSLPPLKKKVPINTFSPNPKSQVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVKDSSAFELQD
ccccccccccccccccccccccccccccHHccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHcccccccEEcHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccc
ccccccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHccccccccEEEcc
mhtllpanllqppfksqqslpplkkkvpintfspnpksqVAYLCSISsvscsertllfndwpqLVKISIGSGDLKLGQAVHAFLLksgsqndtfeANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKgylddgdyeSVLGIACDmyrseekfneHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLlssdfepndytfTNVISVCYEnlgveegkqlhgLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGyvrsghggkaINGFLEFLdlgiccdssclatvidgcsvcsnlelGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQrlagmepdpvTFSRLLSLSASQACLVrgrslhaysiktgyaaDVIVGNALITMYAKCGSIDGAFQIfkgisdrdIVSWNAMLSAYALHGLGKGALLLFEEMkregfapddiSILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAmnlinsspfsespllWRTLVSVSKLMANSKFSILASKRlldlepkdagsFILVSNMYAGQGMLDEAAKVRTTMndlrlskeagcswIEIDSKLHHFVasgkdhpeseeiYSKLDLLNdemklkvkdssafelqd
mhtllpanllqppfksqqslppLKKKVPINTFSPNPKSQVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLInsspfsesplLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLdllndemklkvkdssafelqd
MHTLLPANLLQPPFKSQQSLPPLKKKVPINTFSPNPKSQVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSayalhglgkgalllFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVKDSSAFELQD
**************************************QVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVA************************************
*****************QSLPPLKKKVPINTFSPNPKSQVAYLCS**********LLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVKDSSAFELQD
MHTLLPANLLQPPFKSQQSLPPLKKKVPINTFSPNPKSQVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVK*********
*HTLLPANLLQPPFKSQQSLPPLKKKVPINTFSPNPKSQVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVKDSSAFELQD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTLLPANLLQPPFKSQQSLPPLKKKVPINTFSPNPKSQVAYLCSISSVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVKDSSAFELQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query754 2.2.26 [Sep-21-2011]
P93005727 Pentatricopeptide repeat- yes no 0.901 0.935 0.335 1e-111
Q9FWA6903 Pentatricopeptide repeat- no no 0.877 0.733 0.309 1e-103
Q7XJN6860 Pentatricopeptide repeat- no no 0.913 0.801 0.325 1e-101
Q9S7F4825 Putative pentatricopeptid no no 0.862 0.787 0.322 1e-101
Q9SVP71064 Pentatricopeptide repeat- no no 0.868 0.615 0.310 1e-101
Q0WN60970 Pentatricopeptide repeat- no no 0.899 0.698 0.307 1e-100
Q5G1T1850 Pentatricopeptide repeat- no no 0.897 0.796 0.306 4e-99
Q9LFI1768 Pentatricopeptide repeat- no no 0.885 0.869 0.312 1e-98
Q9STE1857 Pentatricopeptide repeat- no no 0.900 0.792 0.310 2e-98
Q9ZUW3868 Pentatricopeptide repeat- no no 0.905 0.786 0.310 1e-97
>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=3 SV=1 Back     alignment and function desciption
 Score =  403 bits (1035), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 232/691 (33%), Positives = 379/691 (54%), Gaps = 11/691 (1%)

Query: 73  DLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIK 132
           +L  G+AVH  ++++G+      AN L+N YAK  +L  A  +F+ ++ +  ++W SLI 
Sbjct: 29  NLVAGRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSIFNAIICKDVVSWNSLIT 88

Query: 133 GYLDDGDYES---VLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSG 189
           GY  +G   S   V+ +  +M   +   N +T + I +A S L+    G Q HA  +K  
Sbjct: 89  GYSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAHALVVKMS 148

Query: 190 FENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFV 249
              +++V TSL+ MY  +G   +   VF  +  ++    + M+  Y   G  E A  VF 
Sbjct: 149 SFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYATRGRVEEAIKVFN 208

Query: 250 HLLSSDFE--PNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGK 307
             L    E   +DY FT V+S     + V  G+Q+H + +K G++  +++ NA+VTMY K
Sbjct: 209 LFLREKEEGSDSDYVFTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALSNALVTMYSK 268

Query: 308 HGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATV 367
                EA +MFD+  +RN I+W+A+++GY ++G   +A+  F      GI      +  V
Sbjct: 269 CESLNEACKMFDSSGDRNSITWSAMVTGYSQNGESLEAVKLFSRMFSAGIKPSEYTIVGV 328

Query: 368 IDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYT 427
           ++ CS    LE G QLH F +K G+   +   TALVD+YAK G L  AR   D    +  
Sbjct: 329 LNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVDMYAKAGCLADARKGFDCLQERDV 388

Query: 428 AEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLH 487
           A + +++SG+++    D E+ ++L+ + + AG+ P+  T + +L   +S A L  G+ +H
Sbjct: 389 ALWTSLISGYVQN--SDNEEALILYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVH 446

Query: 488 AYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGK 547
            ++IK G+  +V +G+AL TMY+KCGS++    +F+   ++D+VSWNAM+S  + +G G 
Sbjct: 447 GHTIKHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQGD 506

Query: 548 GALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACM 607
            AL LFEEM  EG  PDD++ + ++ AC + G  E G   FN +    GL P ++H+ACM
Sbjct: 507 EALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERGWFYFNMMSDQIGLDPKVDHYACM 566

Query: 608 VDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDA 667
           VDLL RAG+L EA   I S+       LWR L+S  K     +  + A ++L+ L  +++
Sbjct: 567 VDLLSRAGQLKEAKEFIESANIDHGLCLWRILLSACKNHGKCELGVYAGEKLMALGSRES 626

Query: 668 GSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESE 727
            +++ +S +Y   G + +  +V   M    +SKE GCSWIE+ ++ H FV     HP  E
Sbjct: 627 STYVQLSGIYTALGRMRDVERVWKHMRANGVSKEVGCSWIELKNQYHVFVVGDTMHPMIE 686

Query: 728 EIYSKLDLLNDEMK----LKVKDSSAFELQD 754
           E    + L++ +M     + V DSS  E ++
Sbjct: 687 ETKDLVCLVSRQMIEEGFVTVLDSSFVEEEE 717





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2 Back     alignment and function description
>sp|Q7XJN6|PP197_ARATH Pentatricopeptide repeat-containing protein At2g40720 OS=Arabidopsis thaliana GN=PCMP-E26 PE=3 SV=1 Back     alignment and function description
>sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana GN=PCMP-H36 PE=3 SV=1 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protein At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2 Back     alignment and function description
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein At3g53360, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E86 PE=2 SV=1 Back     alignment and function description
>sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protein At4g21300 OS=Arabidopsis thaliana GN=PCMP-E36 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query754
255577487752 pentatricopeptide repeat-containing prot 0.976 0.978 0.610 0.0
225441775773 PREDICTED: pentatricopeptide repeat-cont 0.973 0.949 0.605 0.0
317106770638 JMS10C05.5 [Jatropha curcas] 0.839 0.992 0.638 0.0
224087027599 predicted protein [Populus trichocarpa] 0.781 0.983 0.633 0.0
356555301 858 PREDICTED: pentatricopeptide repeat-cont 0.905 0.796 0.337 1e-117
168044807 902 predicted protein [Physcomitrella patens 0.888 0.742 0.337 1e-116
328774753 1020 pentatricopeptide repeat protein 78 [Fun 0.885 0.654 0.332 1e-116
168056582 986 predicted protein [Physcomitrella patens 0.872 0.667 0.337 1e-115
54695180 986 PpPPR_98 [Physcomitrella patens] 0.872 0.667 0.337 1e-115
296082505746 unnamed protein product [Vitis vinifera] 0.913 0.923 0.342 1e-115
>gi|255577487|ref|XP_002529622.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530907|gb|EEF32767.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/755 (61%), Positives = 568/755 (75%), Gaps = 19/755 (2%)

Query: 1   MHTLLPANLLQPPFKSQQSLPPLKKKVPINTFS-------------PNPKSQVAYLCSIS 47
           M T  PA LL    K Q S P L+ K P + F+              NPK  V    +IS
Sbjct: 1   MTTFFPATLLPCISKPQFSFPQLEIKTPNSIFTCSSSKPVHNNNNLQNPKPNVTRYSTIS 60

Query: 48  SVSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFN 107
           +    E TLLFNDWP+L+KISIGS D  LGQAVH++L+K+GSQ+DTF+ NN++NLY KFN
Sbjct: 61  N----EDTLLFNDWPELIKISIGSRDFLLGQAVHSYLVKAGSQDDTFKGNNVLNLYVKFN 116

Query: 108 RLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILE 167
           RLD+AQK+FD M  R+ ITWTSLIKGYL+D D++S   IA DM++  E FNEHTC+VIL+
Sbjct: 117 RLDLAQKVFDRMRTRNTITWTSLIKGYLEDNDFQSAFSIAGDMHKFGENFNEHTCTVILQ 176

Query: 168 ACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRC 227
           ACS  +DRI GEQIH F IKSGF+ NVFVGTSLI+MY  SG F  AE VF  + +KD+RC
Sbjct: 177 ACSSPDDRILGEQIHCFVIKSGFDENVFVGTSLIAMYTKSGFFDVAEKVFDSMGFKDIRC 236

Query: 228 VNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAV 287
           +NFMILEY +AG    A  VF +LL+  FEP DYTFTN+IS C  +LGVEEGKQL GLA 
Sbjct: 237 LNFMILEYGRAGNGGKAIEVFKNLLNDGFEPTDYTFTNIISTCNGDLGVEEGKQLQGLAF 296

Query: 288 KFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAIN 347
           K+G + E SVGNAI+TMYG  GM +EAERMF ++SE+NLISWTALISGY RSG+G KA++
Sbjct: 297 KYGFLSETSVGNAIITMYGNSGMPKEAERMFSSMSEKNLISWTALISGYSRSGYGKKAVD 356

Query: 348 GFLEFLD-LGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIY 406
            FL   D LGI  DS+ L  ++D CS C+NLELGLQ+HGF +K G   DV + TALVD+Y
Sbjct: 357 AFLGLHDELGINFDSTLLTAILDCCSDCNNLELGLQIHGFVMKLGCACDVNVATALVDLY 416

Query: 407 AKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVT 466
           AK   L+SAR++ D  S K  A FNAIL+GF+E  + DEED M+LF+Q RLAG++PD VT
Sbjct: 417 AKCEKLQSARIVFDHLSNKGIASFNAILAGFLES-SGDEEDPMILFNQLRLAGVKPDMVT 475

Query: 467 FSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGIS 526
           FSRLLSL A+QA L +GRS HAY++KTG+  ++ V N++I+MYAKCGSI+ A Q+F  ++
Sbjct: 476 FSRLLSLLANQASLEKGRSFHAYTVKTGFDTNISVANSVISMYAKCGSIEDAHQMFNIMN 535

Query: 527 DRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGIC 586
            RD +SWNA++SAYALHG  + +L LFEEMKR+GF PD+ +IL +LQAC YSGL + GIC
Sbjct: 536 CRDSISWNALISAYALHGQAQKSLFLFEEMKRKGFDPDEFTILAILQACTYSGLWKDGIC 595

Query: 587 LFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLM 646
           LFN +E  YG++P+LEH+ACM DLLGRAG LSEAM++I  SPF +S LLWRTLV+V KL 
Sbjct: 596 LFNLMEPKYGIKPLLEHYACMADLLGRAGYLSEAMDIIKRSPFPKSTLLWRTLVNVCKLH 655

Query: 647 ANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSW 706
            N  F  LASK LLDL P +AGS+ILVSNMYA + M DEAAKVR  MNDL+  KEAG SW
Sbjct: 656 GNLNFGKLASKHLLDLSPVEAGSYILVSNMYASEKMSDEAAKVRKVMNDLKFRKEAGSSW 715

Query: 707 IEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMK 741
           IEID+K+HHFVAS KDHPES EIY++L+LL DEMK
Sbjct: 716 IEIDNKVHHFVASDKDHPESREIYTRLELLTDEMK 750




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225441775|ref|XP_002277828.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|317106770|dbj|BAJ53262.1| JMS10C05.5 [Jatropha curcas] Back     alignment and taxonomy information
>gi|224087027|ref|XP_002308034.1| predicted protein [Populus trichocarpa] gi|222854010|gb|EEE91557.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356555301|ref|XP_003545972.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|168044807|ref|XP_001774871.1| predicted protein [Physcomitrella patens subsp. patens] gi|162673765|gb|EDQ60283.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|328774753|gb|AEB39776.1| pentatricopeptide repeat protein 78 [Funaria hygrometrica] Back     alignment and taxonomy information
>gi|168056582|ref|XP_001780298.1| predicted protein [Physcomitrella patens subsp. patens] gi|162668246|gb|EDQ54857.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|54695180|dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens] Back     alignment and taxonomy information
>gi|296082505|emb|CBI21510.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query754
TAIR|locus:2057630727 AT2G33680 "AT2G33680" [Arabido 0.901 0.935 0.328 6e-103
TAIR|locus:2078653825 AT3G02010 [Arabidopsis thalian 0.875 0.8 0.314 3.7e-99
TAIR|locus:2064828860 AT2G40720 [Arabidopsis thalian 0.913 0.801 0.316 1.4e-94
TAIR|locus:2032840937 AT1G16480 "AT1G16480" [Arabido 0.924 0.743 0.311 3.8e-94
TAIR|locus:21194401064 AT4G13650 [Arabidopsis thalian 0.867 0.614 0.300 9e-93
TAIR|locus:505006130970 AT1G18485 [Arabidopsis thalian 0.899 0.698 0.297 1.9e-92
TAIR|locus:2082886850 EMB2261 "embryo defective 2261 0.893 0.792 0.302 1e-91
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.896 0.788 0.310 4.5e-91
TAIR|locus:20952891028 AT3G09040 "AT3G09040" [Arabido 0.881 0.646 0.297 5.7e-91
TAIR|locus:2083961768 AT3G53360 "AT3G53360" [Arabido 0.885 0.869 0.302 5.7e-91
TAIR|locus:2057630 AT2G33680 "AT2G33680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1020 (364.1 bits), Expect = 6.0e-103, P = 6.0e-103
 Identities = 227/691 (32%), Positives = 372/691 (53%)

Query:    73 DLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIK 132
             +L  G+AVH  ++++G+      AN L+N YAK  +L  A  +F+ ++ +  ++W SLI 
Sbjct:    29 NLVAGRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSIFNAIICKDVVSWNSLIT 88

Query:   133 GYLDDGDYES---VLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSG 189
             GY  +G   S   V+ +  +M   +   N +T + I +A S L+    G Q HA  +K  
Sbjct:    89 GYSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAHALVVKMS 148

Query:   190 FENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFV 249
                +++V TSL+ MY  +G   +   VF  +  ++    + M+  Y   G  E A  VF 
Sbjct:   149 SFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYATRGRVEEAIKVFN 208

Query:   250 HLLSSDFE--PNDYTFTNVISVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGK 307
               L    E   +DY FT V+S     + V  G+Q+H + +K G++  +++ NA+VTMY K
Sbjct:   209 LFLREKEEGSDSDYVFTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALSNALVTMYSK 268

Query:   308 HGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATV 367
                  EA +MFD+  +RN I+W+A+++GY ++G   +A+  F      GI      +  V
Sbjct:   269 CESLNEACKMFDSSGDRNSITWSAMVTGYSQNGESLEAVKLFSRMFSAGIKPSEYTIVGV 328

Query:   368 IDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYT 427
             ++ CS    LE G QLH F +K G+   +   TALVD+YAK G L  AR   D    +  
Sbjct:   329 LNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVDMYAKAGCLADARKGFDCLQERDV 388

Query:   428 AEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLH 487
             A + +++SG+++    D E+ ++L+ + + AG+ P+  T + +L   +S A L  G+ +H
Sbjct:   389 ALWTSLISGYVQN--SDNEEALILYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVH 446

Query:   488 AYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSXXXXXXXXX 547
              ++IK G+  +V +G+AL TMY+KCGS++    +F+   ++D+VSWNAM+S         
Sbjct:   447 GHTIKHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQGD 506

Query:   548 XXXXXFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACM 607
                  FEEM  EG  PDD++ + ++ AC + G  E G   FN +    GL P ++H+ACM
Sbjct:   507 EALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERGWFYFNMMSDQIGLDPKVDHYACM 566

Query:   608 VDLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDA 667
             VDLL RAG+L EA   I S+       LWR L+S  K     +  + A ++L+ L  +++
Sbjct:   567 VDLLSRAGQLKEAKEFIESANIDHGLCLWRILLSACKNHGKCELGVYAGEKLMALGSRES 626

Query:   668 GSFILVSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESE 727
              +++ +S +Y   G + +  +V   M    +SKE GCSWIE+ ++ H FV     HP  E
Sbjct:   627 STYVQLSGIYTALGRMRDVERVWKHMRANGVSKEVGCSWIELKNQYHVFVVGDTMHPMIE 686

Query:   728 EIYSKLDLLNDEMK----LKVKDSSAFELQD 754
             E    + L++ +M     + V DSS  E ++
Sbjct:   687 ETKDLVCLVSRQMIEEGFVTVLDSSFVEEEE 717


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064828 AT2G40720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095289 AT3G09040 "AT3G09040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083961 AT3G53360 "AT3G53360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P93005PP181_ARATHNo assigned EC number0.33570.90180.9353yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-125
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-95
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-56
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-51
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-39
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-37
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-29
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-26
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
pfam0153531 pfam01535, PPR, PPR repeat 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  394 bits (1014), Expect = e-125
 Identities = 214/669 (31%), Positives = 362/669 (54%), Gaps = 12/669 (1%)

Query: 77  GQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLD 136
           G  V +  L S         N +++++ +F  L  A  +F  M  R   +W  L+ GY  
Sbjct: 105 GSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAK 164

Query: 137 DGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFV 196
            G ++  L +   M  +  + + +T   +L  C  + D   G ++HA  ++ GFE +V V
Sbjct: 165 AGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDV 224

Query: 197 GTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDF 256
             +LI+MY   G    A  VF  +  +D    N MI  Y + GE      +F  +     
Sbjct: 225 VNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSV 284

Query: 257 EPNDYTFTNVISVCYENLGVEE-GKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAE 315
           +P+  T T+VIS C E LG E  G+++HG  VK G   ++SV N+++ MY   G   EAE
Sbjct: 285 DPDLMTITSVISAC-ELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAE 343

Query: 316 RMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCS 375
           ++F  +  ++ +SWTA+ISGY ++G   KA+  +       +  D   +A+V+  C+   
Sbjct: 344 KVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLG 403

Query: 376 NLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSC---KYTAEFNA 432
           +L++G++LH  A + G +S V +  AL+++Y+K   +  A   L+ F     K    + +
Sbjct: 404 DLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKA---LEVFHNIPEKDVISWTS 460

Query: 433 ILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIK 492
           I++G        E    ++F +Q L  ++P+ VT    LS  A    L+ G+ +HA+ ++
Sbjct: 461 IIAGLRLNNRCFEA---LIFFRQMLLTLKPNSVTLIAALSACARIGALMCGKEIHAHVLR 517

Query: 493 TGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALLL 552
           TG   D  + NAL+ +Y +CG ++ A+  F    ++D+VSWN +L+ Y  HG G  A+ L
Sbjct: 518 TGIGFDGFLPNALLDLYVRCGRMNYAWNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVEL 576

Query: 553 FEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMVDLLG 612
           F  M   G  PD+++ + +L AC  SG+   G+  F+ +E+ Y + P L+H+AC+VDLLG
Sbjct: 577 FNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLG 636

Query: 613 RAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFIL 672
           RAG+L+EA N IN  P +  P +W  L++  ++  + +   LA++ + +L+P   G +IL
Sbjct: 637 RAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYIL 696

Query: 673 VSNMYAGQGMLDEAAKVRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSK 732
           + N+YA  G  DE A+VR TM +  L+ + GCSW+E+  K+H F+   + HP+ +EI + 
Sbjct: 697 LCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTV 756

Query: 733 LDLLNDEMK 741
           L+   ++MK
Sbjct: 757 LEGFYEKMK 765


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 754
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.82
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.8
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.75
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.72
KOG2076895 consensus RNA polymerase III transcription factor 99.71
PRK14574 822 hmsH outer membrane protein; Provisional 99.7
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.68
KOG2076895 consensus RNA polymerase III transcription factor 99.67
KOG2003840 consensus TPR repeat-containing protein [General f 99.62
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.6
KOG0547606 consensus Translocase of outer mitochondrial membr 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.56
KOG2003840 consensus TPR repeat-containing protein [General f 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.51
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.48
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.48
KOG1126638 consensus DNA-binding cell division cycle control 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.45
KOG1915677 consensus Cell cycle control protein (crooked neck 99.43
KOG1915677 consensus Cell cycle control protein (crooked neck 99.42
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.42
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.41
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.41
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.38
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.37
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.32
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.3
KOG0547606 consensus Translocase of outer mitochondrial membr 99.29
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.28
PF1304150 PPR_2: PPR repeat family 99.28
KOG2376652 consensus Signal recognition particle, subunit Srp 99.27
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.26
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.26
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.26
PRK12370553 invasion protein regulator; Provisional 99.26
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.25
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.24
PF1304150 PPR_2: PPR repeat family 99.24
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.24
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.23
PRK11189296 lipoprotein NlpI; Provisional 99.22
KOG1129478 consensus TPR repeat-containing protein [General f 99.19
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.19
PRK12370553 invasion protein regulator; Provisional 99.16
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.13
KOG2376652 consensus Signal recognition particle, subunit Srp 99.12
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.12
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.11
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.1
PRK11189296 lipoprotein NlpI; Provisional 99.09
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.06
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.04
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.03
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.0
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.0
KOG1129478 consensus TPR repeat-containing protein [General f 98.93
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.93
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.91
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.84
KOG1125579 consensus TPR repeat-containing protein [General f 98.83
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.83
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.82
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.82
PRK04841903 transcriptional regulator MalT; Provisional 98.81
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.81
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.77
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.75
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.73
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.73
PRK15359144 type III secretion system chaperone protein SscB; 98.73
PRK10370198 formate-dependent nitrite reductase complex subuni 98.71
PLN02789320 farnesyltranstransferase 98.66
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.66
PF1285434 PPR_1: PPR repeat 98.64
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.62
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.58
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.57
PRK15359144 type III secretion system chaperone protein SscB; 98.57
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.56
PF1285434 PPR_1: PPR repeat 98.56
PRK04841903 transcriptional regulator MalT; Provisional 98.52
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.51
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.51
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.48
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.46
KOG1128777 consensus Uncharacterized conserved protein, conta 98.45
PRK10370198 formate-dependent nitrite reductase complex subuni 98.45
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.44
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.4
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.39
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.39
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.38
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.38
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.35
PLN02789320 farnesyltranstransferase 98.35
KOG1125579 consensus TPR repeat-containing protein [General f 98.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.29
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.28
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.24
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.18
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.15
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.14
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.13
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
KOG0553304 consensus TPR repeat-containing protein [General f 98.09
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.02
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.02
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.01
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.0
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.98
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.97
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.96
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.96
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.96
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.96
COG3898531 Uncharacterized membrane-bound protein [Function u 97.95
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.94
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.91
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.88
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.87
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.87
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.86
KOG0553304 consensus TPR repeat-containing protein [General f 97.86
PRK15331165 chaperone protein SicA; Provisional 97.8
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.73
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.73
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.72
PF1343134 TPR_17: Tetratricopeptide repeat 97.71
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.71
COG4700251 Uncharacterized protein conserved in bacteria cont 97.7
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.67
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.67
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.65
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.63
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.62
COG4700251 Uncharacterized protein conserved in bacteria cont 97.61
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.6
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.59
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.53
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.51
PF1337173 TPR_9: Tetratricopeptide repeat 97.51
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.51
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.49
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.46
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.43
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.38
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.37
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.37
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.35
PF1342844 TPR_14: Tetratricopeptide repeat 97.28
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.26
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.26
PF12688120 TPR_5: Tetratrico peptide repeat 97.25
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.21
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.19
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.17
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.17
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.16
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.14
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.11
PRK10803263 tol-pal system protein YbgF; Provisional 97.1
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.1
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.08
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.06
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.04
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.02
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.0
PF12688120 TPR_5: Tetratrico peptide repeat 97.0
PF1337173 TPR_9: Tetratricopeptide repeat 97.0
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.95
KOG4555175 consensus TPR repeat-containing protein [Function 96.95
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.92
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.86
KOG20411189 consensus WD40 repeat protein [General function pr 96.81
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.81
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.8
PRK10803263 tol-pal system protein YbgF; Provisional 96.79
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.7
KOG1258577 consensus mRNA processing protein [RNA processing 96.69
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.6
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.46
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.4
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.39
PF13512142 TPR_18: Tetratricopeptide repeat 96.37
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.33
PRK11906458 transcriptional regulator; Provisional 96.29
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.21
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.12
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.06
KOG1941518 consensus Acetylcholine receptor-associated protei 96.04
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.97
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.92
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.87
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.84
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.8
PRK11906458 transcriptional regulator; Provisional 95.76
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.74
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 95.69
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.67
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.58
KOG4234271 consensus TPR repeat-containing protein [General f 95.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.55
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.53
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.5
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.39
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.32
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.29
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.25
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.15
smart00299140 CLH Clathrin heavy chain repeat homology. 95.13
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.05
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.03
KOG3941406 consensus Intermediate in Toll signal transduction 94.69
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.59
KOG3941406 consensus Intermediate in Toll signal transduction 94.49
PRK15331165 chaperone protein SicA; Provisional 94.32
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.28
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.17
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.1
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.08
KOG20411189 consensus WD40 repeat protein [General function pr 94.0
KOG4555175 consensus TPR repeat-containing protein [Function 93.95
PF13512142 TPR_18: Tetratricopeptide repeat 93.92
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.9
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.77
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.64
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.49
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.45
smart00299140 CLH Clathrin heavy chain repeat homology. 93.41
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.37
PRK11619 644 lytic murein transglycosylase; Provisional 93.32
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.24
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.05
KOG1585308 consensus Protein required for fusion of vesicles 92.99
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.89
PRK10941269 hypothetical protein; Provisional 92.84
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.57
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.48
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.23
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.15
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.15
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.97
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.84
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.84
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.41
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.39
KOG1586288 consensus Protein required for fusion of vesicles 91.35
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.07
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.92
KOG1258577 consensus mRNA processing protein [RNA processing 90.84
PF1342844 TPR_14: Tetratricopeptide repeat 90.51
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.44
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.25
KOG1550552 consensus Extracellular protein SEL-1 and related 89.49
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 89.45
KOG1586288 consensus Protein required for fusion of vesicles 89.43
COG3629280 DnrI DNA-binding transcriptional activator of the 89.39
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.35
COG3629280 DnrI DNA-binding transcriptional activator of the 89.07
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.99
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 88.93
KOG1585308 consensus Protein required for fusion of vesicles 88.91
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.9
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.45
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 88.3
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.24
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 87.51
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 87.24
PRK09687280 putative lyase; Provisional 86.82
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.48
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.05
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.94
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 85.9
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.86
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.81
KOG4234271 consensus TPR repeat-containing protein [General f 85.68
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.63
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 85.58
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.41
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.37
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 85.19
KOG4570418 consensus Uncharacterized conserved protein [Funct 84.85
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.8
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 84.78
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.42
KOG3364149 consensus Membrane protein involved in organellar 84.36
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.08
KOG1550552 consensus Extracellular protein SEL-1 and related 83.93
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.68
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.48
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.34
PHA02875413 ankyrin repeat protein; Provisional 83.15
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 82.52
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 81.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 81.81
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.73
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.14
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 81.02
PRK09687280 putative lyase; Provisional 80.44
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.9e-115  Score=995.18  Aligned_cols=697  Identities=30%  Similarity=0.545  Sum_probs=687.4

Q ss_pred             ccccccCCCCCcHHHHHHHhccCCCcchhHHHHHHHHHhCCCCChhhhHHHHHHHHccCChhHHHHHhccCCCCChhhHH
Q 004425           49 VSCSERTLLFNDWPQLVKISIGSGDLKLGQAVHAFLLKSGSQNDTFEANNLINLYAKFNRLDVAQKLFDGMLVRSAITWT  128 (754)
Q Consensus        49 ~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~~~~~~~~  128 (754)
                      +...+.+|+..+|..++++|.+.+.+..+..++..+.+.|..++..++|+||.+|++.|+++.|.++|++|++||.++||
T Consensus        77 m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~~A~~~f~~m~~~d~~~~n  156 (857)
T PLN03077         77 MQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWN  156 (857)
T ss_pred             HHhcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChHHHHHHHhcCCCCCeeEHH
Confidence            45567789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCChhHHHHHHHHHHhCCCCCChhhHHHHHHHhccCCChHHHHHHHHHHHHHCCCCcHHHHHHHHHHhHhcC
Q 004425          129 SLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIHAFAIKSGFENNVFVGTSLISMYFHSG  208 (754)
Q Consensus       129 ~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g  208 (754)
                      +||++|++.|++++|+++|++|...|+.||..||+.+|++|+..+++..+.+++..|.+.|+.||..++|+||.+|+++|
T Consensus       157 ~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g  236 (857)
T PLN03077        157 VLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCG  236 (857)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHhHHHHHhccCCCCCcchHHHHHHHHHHcCChhHHHHHHHHhHHCCCCCCcchHHHHHHHHhccCCchHHHHHHHHHHH
Q 004425          209 CFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFHVFVHLLSSDFEPNDYTFTNVISVCYENLGVEEGKQLHGLAVK  288 (754)
Q Consensus       209 ~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~  288 (754)
                      ++++|.++|++|+.+|.++||++|.+|++.|++++|+++|++|.+.|+.||..||+.+|.+|++.|+++.|.+++..|.+
T Consensus       237 ~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~  316 (857)
T PLN03077        237 DVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVK  316 (857)
T ss_pred             CHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCChhHHHHHHHHHHhcCChHHHHHHHHccCCCCchhHHHHHHHHHhcCChhHHHHHHHHhHhcCcccChhhHHHHH
Q 004425          289 FGVVREISVGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVI  368 (754)
Q Consensus       289 ~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll  368 (754)
                      .|+.||..+||+|+.+|+++|++++|.++|++|..+|+++||++|.+|++.|++++|+++|++|.+.|+.||..||+.++
T Consensus       317 ~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll  396 (857)
T PLN03077        317 TGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVL  396 (857)
T ss_pred             hCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcccCChHHHHHHHHHHHHhCCCcchhHHHHHHHHHHhCCCHHHHHHHHhcCCCCChhhHHHHHHHHhhhhcCCHHHH
Q 004425          369 DGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDV  448 (754)
Q Consensus       369 ~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~~~A  448 (754)
                      .+|++.|+++.|.++++.+.+.|+.++..++++|+++|+++|++++|.++|++|.++|.++||++|.+|++  .|+.++|
T Consensus       397 ~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~--~g~~~eA  474 (857)
T PLN03077        397 SACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRL--NNRCFEA  474 (857)
T ss_pred             HHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHH--CCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999  9999999


Q ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHhcccchHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHhccCCC
Q 004425          449 MVLFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDR  528 (754)
Q Consensus       449 ~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~  528 (754)
                      +.+|++|.. ++.||..||+.++.+|++.|+++.+.+++..+.+.|+.+|..++|+|+++|+++|++++|.++|+.+ .+
T Consensus       475 ~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~  552 (857)
T PLN03077        475 LIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EK  552 (857)
T ss_pred             HHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CC
Confidence            999999986 6999999999999999999999999999999999999999999999999999999999999999999 99


Q ss_pred             ChhHHHHHHHHHHHcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHhCCCCCccHHHHHH
Q 004425          529 DIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIYGLRPILEHFACMV  608 (754)
Q Consensus       529 ~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~l~  608 (754)
                      |+++||+||.+|+++|+.++|+++|++|.+.|+.||.+||+.++.+|++.|++++|.++|+.|.+++|+.|+..||++|+
T Consensus       553 d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv  632 (857)
T PLN03077        553 DVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVV  632 (857)
T ss_pred             ChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999996689999999999999


Q ss_pred             HHHhhcCCHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHhhccCCCCcchHHHHHHHHHhcCCchHHHH
Q 004425          609 DLLGRAGRLSEAMNLINSSPFSESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAGQGMLDEAAK  688 (754)
Q Consensus       609 ~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~  688 (754)
                      ++|+++|++++|.+++++|+.+||..+|++|+.+|+.+|+.+.|+.+.+++++++|+++..|..|+++|+..|+|++|.+
T Consensus       633 ~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~  712 (857)
T PLN03077        633 DLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVAR  712 (857)
T ss_pred             HHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhCCCccCCceeEEEECCEEEEEecCCCCCCChHHHHHHHHHHHHHHHHcCCCCCc
Q 004425          689 VRTTMNDLRLSKEAGCSWIEIDSKLHHFVASGKDHPESEEIYSKLDLLNDEMKLKVKDSSA  749 (754)
Q Consensus       689 ~~~~m~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~  749 (754)
                      +++.|+++|++|+||+|||++++++|.|++||++||+.++||.+|+.|..+|++.||.|+.
T Consensus       713 vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~  773 (857)
T PLN03077        713 VRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSE  773 (857)
T ss_pred             HHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCc
Confidence            9999999999999999999999999999999999999999999999999999999999974



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query754
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 57.1 bits (136), Expect = 2e-08
 Identities = 24/142 (16%), Positives = 43/142 (30%), Gaps = 7/142 (4%)

Query: 451 LFSQQRLAGMEPDPVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGNALITMYA 510
           L    R A   P     +RLL  +  +  L   ++      +   +       A      
Sbjct: 79  LEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCL 138

Query: 511 KCGSIDGAFQIFKGISDR-------DIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAP 563
               +  A  +      +        +  +NA++  +A  G  K  + +   +K  G  P
Sbjct: 139 LTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTP 198

Query: 564 DDISILGVLQACIYSGLSEGGI 585
           D +S    LQ         G I
Sbjct: 199 DLLSYAAALQCMGRQDQDAGTI 220


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query754
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.7
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.63
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.62
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.52
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.49
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.47
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.44
3u4t_A272 TPR repeat-containing protein; structural genomics 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.42
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.4
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.37
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.37
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.33
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.31
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.3
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.29
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.23
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.15
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.13
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.09
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.06
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.03
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.01
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.99
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.99
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.95
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.93
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.92
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.92
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.91
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.89
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.88
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.86
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.84
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.82
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.82
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.8
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.8
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.78
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.74
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.73
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.72
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.7
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.67
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.65
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.65
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.64
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.63
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.62
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.62
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.52
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.51
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.5
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.49
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.47
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.43
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.43
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.41
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.4
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.4
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.4
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.4
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.38
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.36
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.33
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.33
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.32
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.3
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.29
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.28
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.28
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.25
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.21
3k9i_A117 BH0479 protein; putative protein binding protein, 98.21
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.2
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.18
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.18
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.16
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.15
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.14
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.13
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.1
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.06
3k9i_A117 BH0479 protein; putative protein binding protein, 98.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.02
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.02
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.0
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.98
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.92
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.91
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.9
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.89
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.81
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.66
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.53
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.51
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.38
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.36
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.05
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.0
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.94
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.94
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.62
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.59
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.47
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.45
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.95
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.9
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.86
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.78
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.72
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.38
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.34
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.24
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.88
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.65
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.18
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.95
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.27
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.79
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.42
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 90.5
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.43
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.34
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 90.19
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 89.79
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 89.29
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.84
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.18
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.24
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 87.13
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 87.1
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 85.62
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.56
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.01
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.0
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.09
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 81.23
2uwj_G115 Type III export protein PSCG; virulence, chaperone 80.46
2p58_C116 Putative type III secretion protein YSCG; type III 80.2
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 80.03
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4.2e-41  Score=375.44  Aligned_cols=499  Identities=8%  Similarity=-0.058  Sum_probs=343.6

Q ss_pred             HHccCChhHHHHHhccCCCCChhhHHHHHHHHhcCCChhHHHHHHHHHHhCCCCCChhhHHHHHHHhccCCChHHHHHHH
Q 004425          103 YAKFNRLDVAQKLFDGMLVRSAITWTSLIKGYLDDGDYESVLGIACDMYRSEEKFNEHTCSVILEACSLLEDRIFGEQIH  182 (754)
Q Consensus       103 ~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~  182 (754)
                      +.+.|.+..+...|+.++.+++..|+.++..|.+.|++++|+.+|++|..  ..|+..++..+..+|...|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            45667778888889999889999999999999999999999999999984  5678899999999999999999999999


Q ss_pred             HHHHHHCCCCcHHHHHHHHHHhHhcCCHhHHHHHhccCCCC-------------------CcchHHHHHHHHHHcCChhH
Q 004425          183 AFAIKSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYK-------------------DVRCVNFMILEYNKAGESEM  243 (754)
Q Consensus       183 ~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  243 (754)
                      +.+...  +++..+++.++.+|.++|++++|.++|+++...                   +..+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            987543  688999999999999999999999999965433                   37799999999999999999


Q ss_pred             HHHHHHHhHHCCCCCCc-chHHHHHHHHhccCCchH--HHHH-HHHHHHhcCCCChhHHHHHHHHHHhcCChHHHHHHHH
Q 004425          244 AFHVFVHLLSSDFEPND-YTFTNVISVCYENLGVEE--GKQL-HGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFD  319 (754)
Q Consensus       244 A~~~~~~m~~~g~~p~~-~t~~~ll~~~~~~~~~~~--a~~~-~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~  319 (754)
                      |+++|++|.+.+  |+. ..+..+...+...+..+.  +..+ +..+...+..+...+|+.++..|.+.|++++|.++|+
T Consensus       219 A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~  296 (597)
T 2xpi_A          219 AKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLS  296 (597)
T ss_dssp             HHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHH
Confidence            999999998864  443 334444433332222111  1111 4444445555566777888888999999999999999


Q ss_pred             ccCC--CCchhHHHHHHHHHhcCChhHHHHHHHHhHhcCcccChhhHHHHHHHhcccCChHHHHHHHHHHHHhCCCcchh
Q 004425          320 AISE--RNLISWTALISGYVRSGHGGKAINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVR  397 (754)
Q Consensus       320 ~~~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~  397 (754)
                      ++.+  ++..+|+.++.+|.+.|++++|+.+|+++.+.+. .+..++..++..+...|++++|..+++.+.+.. +.+..
T Consensus       297 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~  374 (597)
T 2xpi_A          297 SINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDP-YNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAV  374 (597)
T ss_dssp             TSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHH
T ss_pred             HhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCc-ccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHH
Confidence            9987  7889999999999999999999999999987642 366778888888888888888888888777543 34455


Q ss_pred             HHHHHHHHHHhCCCHHHHHHHHhcCCCCChhhHHHHHHHHhhhhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhcc
Q 004425          398 LGTALVDIYAKGGDLKSARMLLDGFSCKYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPDPVTFSRLLSLSASQ  477 (754)
Q Consensus       398 ~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~  477 (754)
                      +++.++.+|.++|++                                 ++|.++|+++.+.  .|+              
T Consensus       375 ~~~~l~~~~~~~g~~---------------------------------~~A~~~~~~~~~~--~~~--------------  405 (597)
T 2xpi_A          375 TWLAVGIYYLCVNKI---------------------------------SEARRYFSKSSTM--DPQ--------------  405 (597)
T ss_dssp             HHHHHHHHHHHTTCH---------------------------------HHHHHHHHHHHHH--CTT--------------
T ss_pred             HHHHHHHHHHHhccH---------------------------------HHHHHHHHHHHHh--CCC--------------
Confidence            566666666655555                                 4555555554432  111              


Q ss_pred             cchHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHhccC---CCChhHHHHHHHHHHHcCChHHHHHHHH
Q 004425          478 ACLVRGRSLHAYSIKTGYAADVIVGNALITMYAKCGSIDGAFQIFKGIS---DRDIVSWNAMLSAYALHGLGKGALLLFE  554 (754)
Q Consensus       478 ~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~  554 (754)
                                          +..+|+.++.+|.+.|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|+++|+
T Consensus       406 --------------------~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~  465 (597)
T 2xpi_A          406 --------------------FGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQ  465 (597)
T ss_dssp             --------------------CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHH
T ss_pred             --------------------CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHH
Confidence                                12222333333333333333333333321   1234455555555555566666666666


Q ss_pred             HHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHh---CCCCC--ccHHHHHHHHHhhcCCHHHHHHHHHhC-C
Q 004425          555 EMKREGFAPDDISILGVLQACIYSGLSEGGICLFNEIEQIY---GLRPI--LEHFACMVDLLGRAGRLSEAMNLINSS-P  628 (754)
Q Consensus       555 ~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~---~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~~-~  628 (754)
                      ++.+.. +.+..+|..++..|.+.|++++|.++|+++.+..   +..|+  ..+|..++.+|.+.|++++|.+.++++ .
T Consensus       466 ~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  544 (597)
T 2xpi_A          466 SSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLL  544 (597)
T ss_dssp             HHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHH
Confidence            665532 1134556666666666666666666666665521   44555  456677777777777777777777654 2


Q ss_pred             C-CCCHHHHHHHHHHHHhcCChHHHHHHHHHhhccCCCCcchHHHHHHHHHh
Q 004425          629 F-SESPLLWRTLVSVSKLMANSKFSILASKRLLDLEPKDAGSFILVSNMYAG  679 (754)
Q Consensus       629 ~-~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~  679 (754)
                      . +.++.+|..+..+|...|++++|...++++++++|+++..+..|+++|..
T Consensus       545 ~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          545 LSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             HSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC-
T ss_pred             hCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhc
Confidence            2 33789999999999999999999999999999999999999999998754



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query754
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.1
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.09
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.06
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.04
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.02
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.99
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.92
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.91
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.65
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.58
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.55
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.49
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.49
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.46
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.45
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.4
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.36
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.34
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.32
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.23
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.17
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.16
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.13
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.06
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.89
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.84
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.79
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.75
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.73
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.68
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.63
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.35
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.35
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.33
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.23
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.22
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.63
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.25
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.82
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.08
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.82
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 89.45
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.44
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.76
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=2.7e-20  Score=192.09  Aligned_cols=372  Identities=11%  Similarity=0.031  Sum_probs=261.4

Q ss_pred             HHHhccCCchHHHHHHHHHHHhcCCCChhHHHHHHHHHHhcCChHHHHHHHHccCC--C-CchhHHHHHHHHHhcCChhH
Q 004425          268 SVCYENLGVEEGKQLHGLAVKFGVVREISVGNAIVTMYGKHGMSEEAERMFDAISE--R-NLISWTALISGYVRSGHGGK  344 (754)
Q Consensus       268 ~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~--~-~~~~~~~li~~~~~~g~~~~  344 (754)
                      ..+.+.|++++|.+.++.+++.. +.+..++..+...|.+.|++++|...|++..+  | +..+|..+...|.+.|++++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccc
Confidence            44556666777777666666542 23455556666666666666666666665542  2 34455556666666666666


Q ss_pred             HHHHHHHhHhcCcccChhhHHHHHHHhcccCChHHHHHHHHHHHHhCCCcchhHHHHHHHHHHhCCCHHHHHHHHhcCCC
Q 004425          345 AINGFLEFLDLGICCDSSCLATVIDGCSVCSNLELGLQLHGFAIKHGYLSDVRLGTALVDIYAKGGDLKSARMLLDGFSC  424 (754)
Q Consensus       345 A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~  424 (754)
                      |+..+....+.... +..............+...............                                ..
T Consensus        86 A~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------------~~  132 (388)
T d1w3ba_          86 AIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQY--------------------------------NP  132 (388)
T ss_dssp             HHHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHH--------------------------------CT
T ss_pred             cccccccccccccc-ccccccccccccccccccccccccccccccc--------------------------------cc
Confidence            66666655543211 1111111111111112222222111111111                                12


Q ss_pred             CChhhHHHHHHHHhhhhcCCHHHHHHHHHHHHHcCCCCC-HHHHHHHHHHHhcccchHHHHHHHHHHHHhCCCCchhHHH
Q 004425          425 KYTAEFNAILSGFMEKIADDEEDVMVLFSQQRLAGMEPD-PVTFSRLLSLSASQACLVRGRSLHAYSIKTGYAADVIVGN  503 (754)
Q Consensus       425 ~~~~~~~~li~~~~~~~~~~~~~A~~~~~~m~~~g~~p~-~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~  503 (754)
                      .....+.........  .+....+...+......  .|+ ...+..+...+...|+.+.|...+..+.+.. +-+...+.
T Consensus       133 ~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~  207 (388)
T d1w3ba_         133 DLYCVRSDLGNLLKA--LGRLEEAKACYLKAIET--QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYI  207 (388)
T ss_dssp             TCTHHHHHHHHHHHT--TSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             ccccccccccccccc--cchhhhhHHHHHHhhcc--CcchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHH
Confidence            222233333344444  67777777777776654  343 4566777778888889999999888888764 34567788


Q ss_pred             HHHHHHHhcCCHHHHHHHHhccC---CCChhHHHHHHHHHHHcCChHHHHHHHHHHHHcCCCCCH-HHHHHHHHHHHhcC
Q 004425          504 ALITMYAKCGSIDGAFQIFKGIS---DRDIVSWNAMLSAYALHGLGKGALLLFEEMKREGFAPDD-ISILGVLQACIYSG  579 (754)
Q Consensus       504 ~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~-~t~~~ll~a~~~~g  579 (754)
                      .+...|...|++++|...|+...   ..+...|..+...+.+.|++++|+..|++.++  +.|+. .++..+..++...|
T Consensus       208 ~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~  285 (388)
T d1w3ba_         208 NLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKG  285 (388)
T ss_dssp             HHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHS
T ss_pred             HHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcC
Confidence            88999999999999999998764   35567788899999999999999999999998  56764 58888999999999


Q ss_pred             CHHHHHHHHHHHHHHhCCCCCccHHHHHHHHHhhcCCHHHHHHHHHhC-CCCC-CHHHHHHHHHHHHhcCChHHHHHHHH
Q 004425          580 LSEGGICLFNEIEQIYGLRPILEHFACMVDLLGRAGRLSEAMNLINSS-PFSE-SPLLWRTLVSVSKLMANSKFSILASK  657 (754)
Q Consensus       580 ~~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~-~~~p-~~~~~~~l~~~~~~~g~~~~a~~~~~  657 (754)
                      ++++|.+.++....  ..+.+...+..++.++.+.|++++|++.+++. ...| ++.+|..+..++...|++++|+..++
T Consensus       286 ~~~~A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~  363 (388)
T d1w3ba_         286 SVAEAEDCYNTALR--LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYK  363 (388)
T ss_dssp             CHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHH
T ss_pred             CHHHHHHHHHhhhc--cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            99999999999877  34556678889999999999999999999875 5556 58889999999999999999999999


Q ss_pred             HhhccCCCCcchHHHHHHHHHhcCC
Q 004425          658 RLLDLEPKDAGSFILVSNMYAGQGM  682 (754)
Q Consensus       658 ~~~~~~p~~~~~~~~l~~~~~~~g~  682 (754)
                      ++++++|+++.+|..|+++|.+.|+
T Consensus       364 ~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         364 EAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999999999885



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure