Citrus Sinensis ID: 004567

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740----
MKKSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFSKYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKRKRGGLGDDDDEEDEDNASDKDEESMERGRRKKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLNSMHS
cccccccccHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHccccccccccccEEEEEcccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHccccEEEEcccccccccccccccEEEEccccccccccEEcccccccccccccEEEEEcHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccHHHccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHccc
ccccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccHccccccHHHHHHHHHcccccHHHHHHHHcHHHHccccHHHEcccccHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEccHHHHHHHHccccccHHHHHHEEHHHHHHHHHcccHHHHHHHHHHccHHHcEEEEEccccccHHHHHHHHccccEEEEEccccccccHccccccEEEEccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHHHcccEEEEHHHHHccccccccccEEEEEcccccHHHHEEEccccccccccccEEEEEccHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHHHHccccccEEEEcccccccccHHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccc
mkkskrkpnrkaVRSMEIEEIELLNSwidsqkpesgtnplsfpplgkkepigrigedsfskyvgstrfdqlpiskktksglkdagfvkmtdiqraslphslcgrdilgaaktgsgktlAFVIPVLEKLykerwgpedgvgsiiispTRELADQLFDVLKAVGKhhnfsaglliggrrdvdmEKEHVNELNILvctpgrllqhmdetpnfdcsqLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLArlslkdpqylsvheesvtatpnrlQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKklrpgiplmclygrmKQDRRMAIYAQFCEKRSVLFCTDVasrgldfnkaVDWVVQvdcpedvaSYIHRVGrtarynsggrsvlflTPTEMKMLEKLREAkipihftkantkrlqPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIqkdkevfdVTKLSIDEFsaslglpmtpkirflnqkkgkmvpvkpvldnaeKEDKLMISRekllpdnfteenvdrdiletkdiedEGKADLLEDVMRATRVKKNkklkinvhrplgtrlvfdeecntvpplamladtknanvsldqdqKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKrkrgglgddddeedednasdkdeeSMERGRRKKAKiyfdsdsdndnderkqnkddngpnidsISLAEQEALALKLLNSMHS
mkkskrkpnrkavrsmEIEEIELLNswidsqkpesgtnplsfpplgKKEPIGRIGEDSFSKyvgstrfdqlpiskktksglkdagfvKMTDIQRASLPHSLCGRDILGaaktgsgktlAFVIPVLEKlykerwgpedgVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHeesvtatpnrlqQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEafkklrpgiplMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHrvgrtarynsggrsvLFLTPTEMKMLEKLREAKIPIhftkantkrlqpVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEfsaslglpmtpkirflnqkkgkmvpvkpvldnaekeDKLMisrekllpdnfteenvdrdiletkdiedegkadlleDVMRatrvkknkklkinvhrplgtrlvfdEECNTVPPLamladtknanvsldqdqkteyYKKIReelkradkedklldrqrrrekrikqkmkrkrgglgddddeedednasdkdeesmergrrkkakiyfdsdsdndnderkqnkddngpnidSISLAEQEALALKLLNSMHS
MKKSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFSKYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADkedklldrqrrrekrikqkmkrkrGGLGddddeedednasdkdeeSMERGRRKKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISlaeqealalkllNSMHS
***********************************************************************************************SLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLK**QYLSV*********NRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQ***********************************************************VMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLAD**********************************************************************************************************************************
******************************************************************RFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVD****HVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKI*************PVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTP*********************************************************************************************************************************************************************************************************************************EALAL*LLN****
*************RSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFSKYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKR*************************************KKAKIYFDSD**************NGPNIDSISLAEQEALALKLLNSMHS
**************************************************************VGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQK***********************************************************MRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDRQRRREKR*******************************************************************SISLAEQEALALKLLNS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFSKYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYxxxxxxxxxxxxxxxxxxxxxRRREKRIKQKMKRKRGGLGDDDDEEDEDNASDKDEESMERGRRKKAKIYFDSDSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLNSMHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query744 2.2.26 [Sep-21-2011]
Q9FFT9739 DEAD-box ATP-dependent RN yes no 0.974 0.981 0.605 0.0
Q0D622773 DEAD-box ATP-dependent RN yes no 0.974 0.937 0.498 0.0
Q54Q94878 Probable ATP-dependent RN yes no 0.663 0.562 0.529 1e-159
Q7RZ35823 ATP-dependent RNA helicas N/A no 0.797 0.720 0.446 1e-155
Q9UTP9735 ATP-dependent RNA helicas yes no 0.887 0.897 0.437 1e-153
Q4WM60787 ATP-dependent RNA helicas yes no 0.594 0.561 0.567 1e-153
Q1EB31806 ATP-dependent RNA helicas N/A no 0.861 0.795 0.437 1e-153
Q2UHB7796 ATP-dependent RNA helicas yes no 0.594 0.555 0.562 1e-153
Q0CMM5804 ATP-dependent RNA helicas N/A no 0.594 0.549 0.560 1e-153
A1CTZ2823 ATP-dependent RNA helicas N/A no 0.594 0.537 0.565 1e-152
>sp|Q9FFT9|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1 Back     alignment and function desciption
 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/752 (60%), Positives = 575/752 (76%), Gaps = 27/752 (3%)

Query: 1   MKKSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDS-- 58
           +K  K K  RK +R  E+EEI LL  WI+SQKP+SG NPLS  PL K   IG+  ED   
Sbjct: 2   VKIKKTKGMRKQIRLNEVEEINLLKQWIESQKPDSGFNPLSLRPLPKDSKIGK-SEDGKN 60

Query: 59  ---FSKYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSG 115
              FS+Y G  +F QLPIS KTK GLKDA +V MTD+Q A++PH+LCGRDILGAA+TGSG
Sbjct: 61  GTVFSRYAGVRKFAQLPISDKTKRGLKDAKYVDMTDVQSAAIPHALCGRDILGAARTGSG 120

Query: 116 KTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGG 175
           KTLAFVIP+LEKL++ERW PEDGVG IIISPTRELA Q F VL  VGK H FSAGLLIGG
Sbjct: 121 KTLAFVIPILEKLHRERWSPEDGVGCIIISPTRELAAQTFGVLNKVGKFHKFSAGLLIGG 180

Query: 176 RRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALN 235
           R  VD+EKE V+E+NILVC PGRLLQHMDETPNF+C QLQILILDEADR+LD  FK  L+
Sbjct: 181 REGVDVEKERVHEMNILVCAPGRLLQHMDETPNFECPQLQILILDEADRVLDSAFKGQLD 240

Query: 236 AIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPL 295
            I+SQLPKHRQT LFSATQTK V+DLARLSL+DP+Y+SVH E+VTATP  L QT MIVP+
Sbjct: 241 PIISQLPKHRQTLLFSATQTKKVKDLARLSLRDPEYISVHAEAVTATPTSLMQTVMIVPV 300

Query: 296 EQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAI 355
           E+KLDMLWSFIK HLNS+ILVFL++ KQVK+V EAF KLRPGIPL  L+G+M Q++RM +
Sbjct: 301 EKKLDMLWSFIKTHLNSRILVFLSTKKQVKFVHEAFNKLRPGIPLKSLHGKMSQEKRMGV 360

Query: 356 YAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVL 415
           Y+QF E++SVLFCTDV +RGLDF+KAVDWVVQVDCPEDVASYIHRVGRTAR+ + G+S+L
Sbjct: 361 YSQFIERQSVLFCTDVLARGLDFDKAVDWVVQVDCPEDVASYIHRVGRTARFYTQGKSLL 420

Query: 416 FLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLR 475
           FLTP+E KM+EKL+EAK+PI   KAN ++LQ VS LLAALLVKYPD+Q  AQ+AFITYLR
Sbjct: 421 FLTPSEEKMIEKLQEAKVPIKLIKANNQKLQEVSRLLAALLVKYPDLQGVAQRAFITYLR 480

Query: 476 SVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLN---QKKGKM-VPVKPVLDNAEKE 531
           S+H ++DKE+FDV+KLSI+ FSASLGLPMTP+IRF N   +KKG     +   ++NA++ 
Sbjct: 481 SIHKRRDKEIFDVSKLSIENFSASLGLPMTPRIRFTNLKTKKKGVYESSIAMEIENAQEY 540

Query: 532 DKLMISREKLLPDNFTEENVD-RDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVH 590
           +  ++ ++ LL ++  EE+   +   E K +E   K +  E ++   RV KNKKLKIN+H
Sbjct: 541 EAPLVVKKDLLGEDLEEEDFALKPRKEGKVVEKSTKEE--EVLIPGNRVLKNKKLKINLH 598

Query: 591 RPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRADKEDKLLDR 650
           RP G+R+V DEE N++ PLA +A      V+LD+++  +YYKK+  E+++AD EDK +D+
Sbjct: 599 RPFGSRVVLDEEGNSLAPLASVAAEAGTEVALDEERMNDYYKKVGAEMRKADIEDKKVDK 658

Query: 651 QRRREKRIKQKMKRKRGGL--GDDDDEEDEDNASDKDEESMERGRRKKAKIYFDSDSDND 708
           +RRREKR+KQK+KRKRG +   ++++EED D +   D+E+    +R K  +     SDN+
Sbjct: 659 ERRREKRMKQKIKRKRGAMEDEEEEEEEDHDGSGSSDDETGRNSKRAKKIV-----SDNE 713

Query: 709 NDERKQNKDDNGPNIDSISLAEQEALALKLLN 740
            +  K        N DS+S+A+ E +ALK + 
Sbjct: 714 ENGGK-------INTDSLSVADLEEMALKFIT 738

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0D622|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2 Back     alignment and function description
>sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 Back     alignment and function description
>sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 Back     alignment and function description
>sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 Back     alignment and function description
>sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 Back     alignment and function description
>sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 Back     alignment and function description
>sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 Back     alignment and function description
>sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
224126463766 predicted protein [Populus trichocarpa] 0.989 0.960 0.726 0.0
255563905753 dead box ATP-dependent RNA helicase, put 0.983 0.972 0.717 0.0
356501519746 PREDICTED: DEAD-box ATP-dependent RNA he 0.991 0.989 0.696 0.0
356553180743 PREDICTED: DEAD-box ATP-dependent RNA he 0.987 0.989 0.691 0.0
449470439734 PREDICTED: DEAD-box ATP-dependent RNA he 0.961 0.974 0.694 0.0
449515263734 PREDICTED: DEAD-box ATP-dependent RNA he 0.961 0.974 0.696 0.0
225460999750 PREDICTED: DEAD-box ATP-dependent RNA he 0.995 0.988 0.683 0.0
357494471747 ATP-dependent RNA helicase DBP4 [Medicag 0.977 0.973 0.656 0.0
297796361741 hypothetical protein ARALYDRAFT_495573 [ 0.973 0.977 0.611 0.0
15240418739 DEAD-box ATP-dependent RNA helicase 32 [ 0.974 0.981 0.605 0.0
>gi|224126463|ref|XP_002319844.1| predicted protein [Populus trichocarpa] gi|222858220|gb|EEE95767.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/768 (72%), Positives = 637/768 (82%), Gaps = 32/768 (4%)

Query: 3   KSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFSKY 62
           K K K  R+     E EEI  LN WIDSQKP+SGTNPLS PPL K  PIG + +D FS+Y
Sbjct: 5   KPKSKQTRRDRHEAEQEEISKLNQWIDSQKPDSGTNPLSLPPLPKDAPIGPLQDDKFSRY 64

Query: 63  VGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVI 122
            G+T F +LP+SK+T+ GLK A F KMTDIQRASLPHSLCGRDILGAAKTGSGKTLAF+I
Sbjct: 65  SGATMFKELPLSKRTQDGLKRANFSKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFII 124

Query: 123 PVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDME 182
           P+LEKLYKERWG EDGVG IIISPTRELA QLFDVLK VGK HNFSAGLLIGGR++V+ME
Sbjct: 125 PILEKLYKERWGSEDGVGGIIISPTRELAGQLFDVLKTVGKFHNFSAGLLIGGRKEVEME 184

Query: 183 KEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLP 242
           KEHVN L+ILVCTPGRLLQHMDETPNFDCSQLQ+L+LDEADRILDVGFKK LNAIV+QLP
Sbjct: 185 KEHVNALSILVCTPGRLLQHMDETPNFDCSQLQVLVLDEADRILDVGFKKTLNAIVAQLP 244

Query: 243 KHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDML 302
           KHRQT LFSATQTKS+QDLARLSLKDP+Y+SVHE++ TATP+RLQQTAMIVPLEQKLDML
Sbjct: 245 KHRQTLLFSATQTKSIQDLARLSLKDPEYISVHEDAETATPSRLQQTAMIVPLEQKLDML 304

Query: 303 WSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCEK 362
           WSF+KAHLNSKILVFL+SCKQVK+VFEAFKKLRPGIPL CL+GRMKQ++RM IY+QFCE 
Sbjct: 305 WSFVKAHLNSKILVFLSSCKQVKFVFEAFKKLRPGIPLKCLHGRMKQEKRMGIYSQFCES 364

Query: 363 RSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLTPTEM 422
            SVLF TDVASRGLDFNKAVDWVVQVDCP+DVASYIHRVGRTARY +GGRSVLFL P+EM
Sbjct: 365 HSVLFSTDVASRGLDFNKAVDWVVQVDCPDDVASYIHRVGRTARYLAGGRSVLFLMPSEM 424

Query: 423 KMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKD 482
           KMLEKL+ AKIP+ F KANTKRLQPVSGLL+ALLVKYPDMQ  AQ+AFITYLRS+HIQKD
Sbjct: 425 KMLEKLQTAKIPVQFIKANTKRLQPVSGLLSALLVKYPDMQQLAQRAFITYLRSIHIQKD 484

Query: 483 KEVFDVTKLSIDEFSASLGLPMTPKIRFLNQK-KGKMVPVKPVL---DNAEKEDKLMISR 538
           KEVFDV KLSI+EFSASLGLPMTPK+RFLNQK KGK    K  L   +++EKED   I  
Sbjct: 485 KEVFDVLKLSIEEFSASLGLPMTPKVRFLNQKIKGKKAFGKSALLESEDSEKEDAAEIPG 544

Query: 539 EKLLPDNF-----------------TEENVDRDILETKDIED--EGKADLLEDVMRATRV 579
           EKL   NF                  EENV++  L+TK+  +  E K   +ED++ ATRV
Sbjct: 545 EKLDIGNFREESVGRLKENLKIGDSEEENVEKGFLQTKNALNGSEAKTGEIEDLVPATRV 604

Query: 580 KKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTKNANVS--LDQDQKTEYYKKIREE 637
            K KKLKINVHRP+GTR+VFDEE NT+PPLA +AD KN + S  LDQD++ EYYK +RE+
Sbjct: 605 LKKKKLKINVHRPVGTRVVFDEEGNTLPPLARVADRKNVDNSSLLDQDKREEYYKNMREQ 664

Query: 638 LKRADKEDKLLDRQRRREKRIKQKMKRKRGGLGDDDDEEDEDNASDKDEESMERGRR-KK 696
           +K  DKEDK+LDRQRRREKRIK+KMKRK G +G ++D E ED+ S  + E    GR+ K+
Sbjct: 665 MKHVDKEDKVLDRQRRREKRIKEKMKRKIGSMGLEEDGEGEDDLSGSEGE----GRKHKR 720

Query: 697 AKIYFDSDSDNDNDERKQNKDDNGPNIDSISLAEQEALALKLLNSMHS 744
           +KIYFDSDS  DN E  ++KD+ G + DSISLA+QEALALKLL+SMHS
Sbjct: 721 SKIYFDSDS--DNAEMTESKDNAGISTDSISLADQEALALKLLSSMHS 766

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563905|ref|XP_002522952.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223537764|gb|EEF39382.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356501519|ref|XP_003519572.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Glycine max] Back     alignment and taxonomy information
>gi|356553180|ref|XP_003544936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Glycine max] Back     alignment and taxonomy information
>gi|449470439|ref|XP_004152924.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515263|ref|XP_004164669.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225460999|ref|XP_002278373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 32 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357494471|ref|XP_003617524.1| ATP-dependent RNA helicase DBP4 [Medicago truncatula] gi|355518859|gb|AET00483.1| ATP-dependent RNA helicase DBP4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297796361|ref|XP_002866065.1| hypothetical protein ARALYDRAFT_495573 [Arabidopsis lyrata subsp. lyrata] gi|297311900|gb|EFH42324.1| hypothetical protein ARALYDRAFT_495573 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15240418|ref|NP_200302.1| DEAD-box ATP-dependent RNA helicase 32 [Arabidopsis thaliana] gi|75333773|sp|Q9FFT9.1|RH32_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 32 gi|9758271|dbj|BAB08770.1| RNA helicase-like protein [Arabidopsis thaliana] gi|332009172|gb|AED96555.1| DEAD-box ATP-dependent RNA helicase 32 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
TAIR|locus:2160225739 AT5G54910 [Arabidopsis thalian 0.858 0.864 0.639 1e-217
DICTYBASE|DDB_G0284017878 ddx10 "DEAD/DEAH box helicase" 0.787 0.667 0.475 1.6e-149
POMBASE|SPAC1093.05735 SPAC1093.05 "ATP-dependent RNA 0.592 0.6 0.554 3.5e-139
ASPGD|ASPL0000061778812 AN0589 [Emericella nidulans (t 0.594 0.544 0.547 1.2e-138
UNIPROTKB|E9PIF2835 DDX10 "Probable ATP-dependent 0.668 0.595 0.512 1.3e-137
UNIPROTKB|Q13206 875 DDX10 "Probable ATP-dependent 0.668 0.568 0.512 1.3e-137
UNIPROTKB|F1P0I3 875 DDX10 "Probable ATP-dependent 0.622 0.529 0.529 6.6e-136
UNIPROTKB|Q5ZJF6 875 DDX10 "Probable ATP-dependent 0.622 0.529 0.529 6.6e-136
MGI|MGI:1924841 875 Ddx10 "DEAD (Asp-Glu-Ala-Asp) 0.669 0.569 0.516 1.7e-135
RGD|1308990 874 Ddx10 "DEAD (Asp-Glu-Ala-Asp) 0.646 0.550 0.532 9.5e-135
TAIR|locus:2160225 AT5G54910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2103 (745.4 bits), Expect = 1.0e-217, P = 1.0e-217
 Identities = 417/652 (63%), Positives = 514/652 (78%)

Query:     1 MKKSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDS-- 58
             +K  K K  RK +R  E+EEI LL  WI+SQKP+SG NPLS  PL K   IG+  ED   
Sbjct:     2 VKIKKTKGMRKQIRLNEVEEINLLKQWIESQKPDSGFNPLSLRPLPKDSKIGK-SEDGKN 60

Query:    59 ---FSKYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSG 115
                FS+Y G  +F QLPIS KTK GLKDA +V MTD+Q A++PH+LCGRDILGAA+TGSG
Sbjct:    61 GTVFSRYAGVRKFAQLPISDKTKRGLKDAKYVDMTDVQSAAIPHALCGRDILGAARTGSG 120

Query:   116 KTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGG 175
             KTLAFVIP+LEKL++ERW PEDGVG IIISPTRELA Q F VL  VGK H FSAGLLIGG
Sbjct:   121 KTLAFVIPILEKLHRERWSPEDGVGCIIISPTRELAAQTFGVLNKVGKFHKFSAGLLIGG 180

Query:   176 RRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALN 235
             R  VD+EKE V+E+NILVC PGRLLQHMDETPNF+C QLQILILDEADR+LD  FK  L+
Sbjct:   181 REGVDVEKERVHEMNILVCAPGRLLQHMDETPNFECPQLQILILDEADRVLDSAFKGQLD 240

Query:   236 AIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPL 295
              I+SQLPKHRQT LFSATQTK V+DLARLSL+DP+Y+SVH E+VTATP  L QT MIVP+
Sbjct:   241 PIISQLPKHRQTLLFSATQTKKVKDLARLSLRDPEYISVHAEAVTATPTSLMQTVMIVPV 300

Query:   296 EQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAI 355
             E+KLDMLWSFIK HLNS+ILVFL++ KQVK+V EAF KLRPGIPL  L+G+M Q++RM +
Sbjct:   301 EKKLDMLWSFIKTHLNSRILVFLSTKKQVKFVHEAFNKLRPGIPLKSLHGKMSQEKRMGV 360

Query:   356 YAQFCEKRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVL 415
             Y+QF E++SVLFCTDV +RGLDF+KAVDWVVQVDCPEDVASYIHRVGRTAR+ + G+S+L
Sbjct:   361 YSQFIERQSVLFCTDVLARGLDFDKAVDWVVQVDCPEDVASYIHRVGRTARFYTQGKSLL 420

Query:   416 FLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLR 475
             FLTP+E KM+EKL+EAK+PI   KAN ++LQ VS LLAALLVKYPD+Q  AQ+AFITYLR
Sbjct:   421 FLTPSEEKMIEKLQEAKVPIKLIKANNQKLQEVSRLLAALLVKYPDLQGVAQRAFITYLR 480

Query:   476 SVHIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQK-KGKMVPVKPV---LDNAEKE 531
             S+H ++DKE+FDV+KLSI+ FSASLGLPMTP+IRF N K K K V    +   ++NA++ 
Sbjct:   481 SIHKRRDKEIFDVSKLSIENFSASLGLPMTPRIRFTNLKTKKKGVYESSIAMEIENAQEY 540

Query:   532 DKLMISREKLLPDNFTEENVD-RDILETKDIEDEGKADLLEDVMRATRVKKNKKLKINVH 590
             +  ++ ++ LL ++  EE+   +   E K +E   K +  E ++   RV KNKKLKIN+H
Sbjct:   541 EAPLVVKKDLLGEDLEEEDFALKPRKEGKVVEKSTKEE--EVLIPGNRVLKNKKLKINLH 598

Query:   591 RPLGTRLVFDEECNTVPPLAMLADTKNANVSLDQDQKTEYYKKIREELKRAD 642
             RP G+R+V DEE N++ PLA +A      V+LD+++  +YYKK+  E+++AD
Sbjct:   599 RPFGSRVVLDEEGNSLAPLASVAAEAGTEVALDEERMNDYYKKVGAEMRKAD 650
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0005730 "nucleolus" evidence=IDA
GO:0006606 "protein import into nucleus" evidence=RCA
DICTYBASE|DDB_G0284017 ddx10 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC1093.05 SPAC1093.05 "ATP-dependent RNA helicase Hca4 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061778 AN0589 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E9PIF2 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13206 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0I3 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJF6 DDX10 "Probable ATP-dependent RNA helicase DDX10" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1924841 Ddx10 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308990 Ddx10 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FFT9RH32_ARATH3, ., 6, ., 4, ., 1, 30.60500.97440.9810yesno
Q9UTP9DBP4_SCHPO3, ., 6, ., 4, ., 1, 30.43780.88700.8979yesno
Q6CGD1DBP4_YARLI3, ., 6, ., 4, ., 1, 30.51820.61690.6202yesno
Q0D622RH32_ORYSJ3, ., 6, ., 4, ., 1, 30.49870.97440.9379yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-103
cd00268203 cd00268, DEADc, DEAD-box helicases 3e-77
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 6e-69
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 5e-57
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-56
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-54
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 7e-53
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-50
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-48
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 5e-46
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-44
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 7e-44
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-39
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-38
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 4e-33
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 3e-24
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-19
smart0049082 smart00490, HELICc, helicase superfamily c-termina 9e-18
pfam1395964 pfam13959, DUF4217, Domain of unknown function (DU 5e-16
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 4e-11
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-10
cd09639353 cd09639, Cas3_I, CRISPR/Cas system-associated prot 7e-10
COG1205 851 COG1205, COG1205, Distinct helicase family with a 3e-08
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 5e-07
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-06
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 3e-06
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 1e-05
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 4e-05
COG1204766 COG1204, COG1204, Superfamily II helicase [General 8e-05
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 8e-05
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 8e-04
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  325 bits (834), Expect = e-103
 Identities = 149/496 (30%), Positives = 236/496 (47%), Gaps = 27/496 (5%)

Query: 65  STRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPV 124
              F  L +S +    LKD GF + T IQ A++P  L GRD+LG A+TG+GKT AF++P+
Sbjct: 28  PPEFASLGLSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLLPL 87

Query: 125 LEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHH-NFSAGLLIGG---RRDVD 180
           L+K+ K        V ++I++PTRELA Q+ + L+ +GK+       ++ GG   R+ ++
Sbjct: 88  LQKILKS--VERKYVSALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVSIRKQIE 145

Query: 181 MEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQ 240
             K  V+   I+V TPGRLL  +      D S ++ L+LDEADR+LD+GF   +  I+  
Sbjct: 146 ALKRGVD---IVVATPGRLLDLIKRG-KLDLSGVETLVLDEADRMLDMGFIDDIEKILKA 201

Query: 241 LPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVP-LEQKL 299
           LP  RQT LFSAT    +++LAR  L DP  + V  E +  T  +++Q  + V   E+KL
Sbjct: 202 LPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYLEVESEEEKL 261

Query: 300 DMLWSFIKAHLNSKILVFLTSCKQVKYVFEAFKKLRPGIPLMCLYGRMKQDRRMAIYAQF 359
           ++L   +K     +++VF+ + + V+ + E+ +K   G  +  L+G + Q+ R     +F
Sbjct: 262 ELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKR--GFKVAALHGDLPQEERDRALEKF 319

Query: 360 CEKR-SVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYNSGGRSVLFLT 418
            +    VL  TDVA+RGLD    V  V+  D P D   Y+HR+GRT R    G ++ F+T
Sbjct: 320 KDGELRVLVATDVAARGLDI-PDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVT 378

Query: 419 P-TEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSV 477
              E+K L+++ +            ++L     L          ++            S 
Sbjct: 379 EEEEVKKLKRIEKRLE---------RKLPSAVLLPLDEPEDAKLLKTTRPGLEEESDISD 429

Query: 478 HIQKDKEVFDVTKLSIDEFSASLGLPMTPKIRFLNQKKGKMVPVKPVLDNAEKEDKLMIS 537
            I+K K         +        L             G  V + P L+         I 
Sbjct: 430 EIKKLKSSKKALLRGLGVRFTLSKLLANLGKE--IPGAGDAVTIDPELERRSPNSADDIE 487

Query: 538 REKLLPDNFTEENVDR 553
                     EE   +
Sbjct: 488 YILKGLSYRAEERTAK 503

Length = 513
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|222474 pfam13959, DUF4217, Domain of unknown function (DUF4217) Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 744
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
PRK13766773 Hef nuclease; Provisional 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
COG1205851 Distinct helicase family with a unique C-terminal 100.0
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.98
PRK05580679 primosome assembly protein PriA; Validated 99.98
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.98
KOG0354746 consensus DEAD-box like helicase [General function 99.97
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
PRK04914956 ATP-dependent helicase HepA; Validated 99.97
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.97
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.97
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.96
PRK09694878 helicase Cas3; Provisional 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.96
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.96
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.95
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.94
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.94
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.94
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.94
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.93
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.93
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.92
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.92
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.92
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.92
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 99.92
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.91
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.9
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 99.89
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.88
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.87
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.86
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 99.86
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 99.86
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.86
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 99.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.84
PRK05298652 excinuclease ABC subunit B; Provisional 99.84
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 99.83
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.82
smart00487201 DEXDc DEAD-like helicases superfamily. 99.81
COG4096875 HsdR Type I site-specific restriction-modification 99.81
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.8
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.8
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.79
KOG0387923 consensus Transcription-coupled repair protein CSB 99.77
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.77
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.75
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.75
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.73
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.72
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.72
KOG1123776 consensus RNA polymerase II transcription initiati 99.71
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.7
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.68
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.68
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.68
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.67
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.67
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.65
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.65
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.65
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.64
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.6
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.6
COG4889 1518 Predicted helicase [General function prediction on 99.59
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.58
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.58
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.54
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.51
PRK14873665 primosome assembly protein PriA; Provisional 99.5
PF1395965 DUF4217: Domain of unknown function (DUF4217) 99.5
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.47
smart0049082 HELICc helicase superfamily c-terminal domain. 99.41
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.4
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.4
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 99.4
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.38
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.31
KOG4439901 consensus RNA polymerase II transcription terminat 99.29
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.28
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.28
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.23
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.17
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.09
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.09
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.04
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.03
COG0610962 Type I site-specific restriction-modification syst 99.01
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.01
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.01
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 98.89
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.8
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.76
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.68
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.51
PRK15483986 type III restriction-modification system StyLTI en 98.31
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.16
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.11
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.05
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.99
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.93
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.87
KOG1001674 consensus Helicase-like transcription factor HLTF/ 97.83
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.79
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.79
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.76
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.73
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.7
PRK10536262 hypothetical protein; Provisional 97.62
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.61
KOG1803649 consensus DNA helicase [Replication, recombination 97.6
TIGR00376637 DNA helicase, putative. The gene product may repre 97.55
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.5
PF1324576 AAA_19: Part of AAA domain 97.43
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.32
PRK13889988 conjugal transfer relaxase TraA; Provisional 97.12
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.1
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.07
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.04
KOG18051100 consensus DNA replication helicase [Replication, r 97.03
PRK04296190 thymidine kinase; Provisional 96.78
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.77
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.72
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 96.7
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.66
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.62
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.53
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.5
smart00382148 AAA ATPases associated with a variety of cellular 96.47
PRK08181269 transposase; Validated 96.46
PRK06526254 transposase; Provisional 96.42
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.41
PRK14974336 cell division protein FtsY; Provisional 96.39
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.31
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.31
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.27
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.14
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.12
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.09
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.05
PRK07952244 DNA replication protein DnaC; Validated 95.85
PHA02533534 17 large terminase protein; Provisional 95.8
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.77
PRK12377248 putative replication protein; Provisional 95.65
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.64
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.52
PRK08116268 hypothetical protein; Validated 95.51
COG3973747 Superfamily I DNA and RNA helicases [General funct 95.4
PRK08727233 hypothetical protein; Validated 95.38
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.38
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.3
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.3
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.28
PRK05642234 DNA replication initiation factor; Validated 95.23
PRK11054684 helD DNA helicase IV; Provisional 95.21
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 95.17
PRK00149450 dnaA chromosomal replication initiation protein; R 95.06
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.05
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 95.03
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.01
KOG1131755 consensus RNA polymerase II transcription initiati 94.99
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.97
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.95
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.9
PRK06893229 DNA replication initiation factor; Validated 94.88
PRK14087450 dnaA chromosomal replication initiation protein; P 94.87
PRK13833323 conjugal transfer protein TrbB; Provisional 94.85
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.79
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.75
PRK05707328 DNA polymerase III subunit delta'; Validated 94.75
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.68
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.67
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.67
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 94.64
PRK06921266 hypothetical protein; Provisional 94.61
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.52
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 94.49
PLN03025319 replication factor C subunit; Provisional 94.48
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.47
PHA02544316 44 clamp loader, small subunit; Provisional 94.44
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.43
PRK14086617 dnaA chromosomal replication initiation protein; P 94.36
KOG0383696 consensus Predicted helicase [General function pre 94.35
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.34
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.24
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.17
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.16
PTZ001121164 origin recognition complex 1 protein; Provisional 94.15
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 94.12
PRK09183259 transposase/IS protein; Provisional 94.12
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.08
PRK11773721 uvrD DNA-dependent helicase II; Provisional 94.07
PF13871278 Helicase_C_4: Helicase_C-like 94.05
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.04
PRK08769319 DNA polymerase III subunit delta'; Validated 94.01
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 93.97
PRK14088440 dnaA chromosomal replication initiation protein; P 93.94
PRK08084235 DNA replication initiation factor; Provisional 93.94
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.9
PF00004132 AAA: ATPase family associated with various cellula 93.89
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 93.89
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 93.85
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.85
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.82
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 93.77
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 93.76
PRK04195482 replication factor C large subunit; Provisional 93.76
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.73
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.73
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.73
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.72
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.68
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.68
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.66
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 93.65
PHA03333752 putative ATPase subunit of terminase; Provisional 93.63
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.61
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.61
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 93.49
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.45
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.43
PRK06835329 DNA replication protein DnaC; Validated 93.41
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 93.38
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.38
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 93.33
PRK12402337 replication factor C small subunit 2; Reviewed 93.3
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 93.23
PRK11331459 5-methylcytosine-specific restriction enzyme subun 93.21
TIGR00064272 ftsY signal recognition particle-docking protein F 93.18
PRK07940394 DNA polymerase III subunit delta'; Validated 93.18
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 93.18
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 93.1
PRK00771437 signal recognition particle protein Srp54; Provisi 93.09
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 93.06
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 93.04
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 92.99
PRK06871325 DNA polymerase III subunit delta'; Validated 92.96
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 92.8
PRK09112351 DNA polymerase III subunit delta'; Validated 92.79
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 92.75
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 92.75
PRK06964342 DNA polymerase III subunit delta'; Validated 92.71
PRK09401 1176 reverse gyrase; Reviewed 92.7
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 92.69
PRK00440319 rfc replication factor C small subunit; Reviewed 92.68
PRK12422445 chromosomal replication initiation protein; Provis 92.67
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 92.65
PRK10867433 signal recognition particle protein; Provisional 92.59
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.55
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.51
PRK07471365 DNA polymerase III subunit delta'; Validated 92.5
PHA03368738 DNA packaging terminase subunit 1; Provisional 92.45
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 92.44
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 92.38
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 92.37
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 92.36
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 92.35
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 92.2
PRK13851344 type IV secretion system protein VirB11; Provision 92.19
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 92.06
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.06
CHL00181287 cbbX CbbX; Provisional 92.04
PRK06090319 DNA polymerase III subunit delta'; Validated 92.0
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 91.95
PRK06067234 flagellar accessory protein FlaH; Validated 91.92
PF05729166 NACHT: NACHT domain 91.91
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 91.87
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 91.87
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.83
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 91.8
PRK13342413 recombination factor protein RarA; Reviewed 91.62
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 91.57
PTZ00293211 thymidine kinase; Provisional 91.5
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 91.49
PRK08939306 primosomal protein DnaI; Reviewed 91.47
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 91.41
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 91.31
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 91.28
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.17
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 91.12
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 91.1
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 91.09
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 91.0
PF13173128 AAA_14: AAA domain 90.96
PRK14873665 primosome assembly protein PriA; Provisional 90.94
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.91
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 90.87
TIGR00643630 recG ATP-dependent DNA helicase RecG. 90.83
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 90.81
PRK05973237 replicative DNA helicase; Provisional 90.76
TIGR00763775 lon ATP-dependent protease La. This protein is ind 90.74
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 90.72
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 90.69
PRK07993334 DNA polymerase III subunit delta'; Validated 90.64
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 90.6
cd03115173 SRP The signal recognition particle (SRP) mediates 90.58
PRK11823446 DNA repair protein RadA; Provisional 90.57
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 90.55
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 90.3
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 90.28
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 90.24
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 90.24
PRK05580679 primosome assembly protein PriA; Validated 90.21
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 89.97
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 89.94
KOG2543438 consensus Origin recognition complex, subunit 5 [R 89.69
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 89.68
COG2256436 MGS1 ATPase related to the helicase subunit of the 89.53
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 89.43
COG0552340 FtsY Signal recognition particle GTPase [Intracell 89.38
TIGR00595505 priA primosomal protein N'. All proteins in this f 89.38
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 89.36
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 89.36
TIGR00959428 ffh signal recognition particle protein. This mode 89.31
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 89.2
PRK04841 903 transcriptional regulator MalT; Provisional 89.18
PRK13897606 type IV secretion system component VirD4; Provisio 89.1
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 89.04
PRK13531498 regulatory ATPase RavA; Provisional 89.02
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 88.98
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 88.96
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 88.85
PRK06620214 hypothetical protein; Validated 88.67
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 88.66
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.58
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 88.46
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 88.41
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 88.3
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 88.23
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 88.22
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 88.21
PRK13341725 recombination factor protein RarA/unknown domain f 88.21
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 88.15
PRK07399314 DNA polymerase III subunit delta'; Validated 88.14
PRK03992389 proteasome-activating nucleotidase; Provisional 88.13
PRK08699325 DNA polymerase III subunit delta'; Validated 88.07
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 88.04
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 87.94
TIGR02688449 conserved hypothetical protein TIGR02688. Members 87.83
PRK13764602 ATPase; Provisional 87.78
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 87.75
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 87.69
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 87.65
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 87.62
PRK13695174 putative NTPase; Provisional 87.54
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 87.53
PF12846304 AAA_10: AAA-like domain 87.51
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 87.47
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 87.35
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.34
PRK10436462 hypothetical protein; Provisional 87.3
TIGR02533486 type_II_gspE general secretory pathway protein E. 87.22
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 87.2
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 87.01
TIGR00665434 DnaB replicative DNA helicase. This model describe 86.99
PRK07413382 hypothetical protein; Validated 86.97
PRK08058329 DNA polymerase III subunit delta'; Validated 86.75
PRK10865857 protein disaggregation chaperone; Provisional 86.6
PHA00729226 NTP-binding motif containing protein 86.49
PRK106891147 transcription-repair coupling factor; Provisional 86.49
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 86.38
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 86.31
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 86.31
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 86.29
COG4626546 Phage terminase-like protein, large subunit [Gener 86.17
PRK07004460 replicative DNA helicase; Provisional 86.12
PRK13850670 type IV secretion system protein VirD4; Provisiona 86.1
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 86.02
PHA03372668 DNA packaging terminase subunit 1; Provisional 85.92
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 85.67
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 85.64
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 85.51
PRK10416318 signal recognition particle-docking protein FtsY; 85.47
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 85.31
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 85.29
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.23
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 85.21
PHA00350399 putative assembly protein 85.19
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 85.08
PHA03311 828 helicase-primase subunit BBLF4; Provisional 84.91
KOG18061320 consensus DEAD box containing helicases [Replicati 84.86
PRK09087226 hypothetical protein; Validated 84.69
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 84.47
PRK13876663 conjugal transfer coupling protein TraG; Provision 84.43
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 84.42
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 84.41
TIGR03743634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 84.37
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 84.31
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 84.24
PRK06904472 replicative DNA helicase; Validated 84.19
PRK05748448 replicative DNA helicase; Provisional 84.18
COG2255332 RuvB Holliday junction resolvasome, helicase subun 84.18
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 84.13
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 84.05
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 84.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 83.84
cd01393226 recA_like RecA is a bacterial enzyme which has rol 83.83
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 83.7
CHL00176638 ftsH cell division protein; Validated 83.67
COG0593408 DnaA ATPase involved in DNA replication initiation 83.61
PRK04328249 hypothetical protein; Provisional 83.5
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 83.46
PRK13880636 conjugal transfer coupling protein TraG; Provision 83.42
PRK08840464 replicative DNA helicase; Provisional 83.25
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 83.1
PRK06321472 replicative DNA helicase; Provisional 82.99
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 82.91
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 82.91
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA repl 82.86
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 82.82
PRK13822641 conjugal transfer coupling protein TraG; Provision 82.81
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 82.75
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 82.72
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 82.68
PHA00012361 I assembly protein 82.3
PRK08760476 replicative DNA helicase; Provisional 82.28
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 82.11
CHL00095821 clpC Clp protease ATP binding subunit 82.0
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 81.89
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 81.79
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 81.74
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 81.62
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.6e-136  Score=1094.94  Aligned_cols=681  Identities=51%  Similarity=0.803  Sum_probs=598.8

Q ss_pred             hHHhhhhhHHHHHHHhhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCcCCCCCCCCCCCHHHHHHHHHCCCCCC
Q 004567           10 RKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFSKYVGSTRFDQLPISKKTKSGLKDAGFVKM   89 (744)
Q Consensus        10 ~~~~r~~~~~~~~~l~~~i~~~~p~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~l~ls~~~~~~L~~~gf~~~   89 (744)
                      ++..|+.++++|..|+..+.+                            .+ ......|.+||||..++++|+..+|..|
T Consensus        42 ~k~~~~~Eee~i~~l~~ky~e----------------------------i~-~~~~~kF~dlpls~~t~kgLke~~fv~~   92 (758)
T KOG0343|consen   42 KKKLRQQEEEEIEELKQKYAE----------------------------ID-STTIKKFADLPLSQKTLKGLKEAKFVKM   92 (758)
T ss_pred             hhhhhhhhHHHHHHHHHHHHH----------------------------hh-hhhhhhHHhCCCchHHHHhHhhcCCccH
Confidence            667788899999999999877                            22 3456679999999999999999999999


Q ss_pred             cHHHHHHHHHHHcCCCEEEEccCCCchhHHhHHHHHHHHHhccCCCCCCceEEEEcCChHHHHHHHHHHHHhhccCCceE
Q 004567           90 TDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSA  169 (744)
Q Consensus        90 t~iQ~~aip~il~g~dvlv~a~TGSGKTla~llpil~~L~~~~~~~~~g~~aLIl~PtreLa~Qi~~~l~~~~~~~~~~~  169 (744)
                      |.+|+.+||.+|+|+|||++|.|||||||||++|+|+.||+.+|++.+|.++|||+||||||.|+|+++.++|.+|.+++
T Consensus        93 teiQ~~~Ip~aL~G~DvlGAAkTGSGKTLAFlvPvlE~L~r~kWs~~DGlGalIISPTRELA~QtFevL~kvgk~h~fSa  172 (758)
T KOG0343|consen   93 TEIQRDTIPMALQGHDVLGAAKTGSGKTLAFLVPVLEALYRLKWSPTDGLGALIISPTRELALQTFEVLNKVGKHHDFSA  172 (758)
T ss_pred             HHHHHhhcchhccCcccccccccCCCceeeehHHHHHHHHHcCCCCCCCceeEEecchHHHHHHHHHHHHHHhhcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCccChHHHHHhcCCCcEEEEChHHHHHHHhcCCCCCCCCceEEEEcCchhhhccchHHHHHHHHHhCCCCCcEEE
Q 004567          170 GLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQTFL  249 (744)
Q Consensus       170 ~~l~Gg~~~~~~e~~~~~~~~IlV~TPgrLl~~l~~~~~~~~~~l~~lVlDEAh~lld~gf~~~l~~Il~~lp~~~q~ll  249 (744)
                      |+++| |.++..+..+++.+||+|||||||++||++++.|+++++++|||||||+|++|||..+++.|++++|..+|++|
T Consensus       173 GLiiG-G~~~k~E~eRi~~mNILVCTPGRLLQHmde~~~f~t~~lQmLvLDEADR~LDMGFk~tL~~Ii~~lP~~RQTLL  251 (758)
T KOG0343|consen  173 GLIIG-GKDVKFELERISQMNILVCTPGRLLQHMDENPNFSTSNLQMLVLDEADRMLDMGFKKTLNAIIENLPKKRQTLL  251 (758)
T ss_pred             ceeec-CchhHHHHHhhhcCCeEEechHHHHHHhhhcCCCCCCcceEEEeccHHHHHHHhHHHHHHHHHHhCChhheeee
Confidence            99999 88899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeeccChhHHHHHHHhcCCCccccccccccccCccccceeEEEcChhhHHHHHHHHHHHhCCCcEEEEecchHHHHHHHH
Q 004567          250 FSATQTKSVQDLARLSLKDPQYLSVHEESVTATPNRLQQTAMIVPLEQKLDMLWSFIKAHLNSKILVFLTSCKQVKYVFE  329 (744)
Q Consensus       250 ~SAT~~~~v~~la~~~l~~p~~i~v~~~~~~~~~~~l~q~~~~~~~~~kl~~L~~lLk~~~~~k~IVF~~s~~~v~~l~~  329 (744)
                      ||||++.++.+++++++.+|.||+++......+|.+++|+|++++...|+++||+||++|...++|||++||++|.++|+
T Consensus       252 FSATqt~svkdLaRLsL~dP~~vsvhe~a~~atP~~L~Q~y~~v~l~~Ki~~L~sFI~shlk~K~iVF~SscKqvkf~~e  331 (758)
T KOG0343|consen  252 FSATQTKSVKDLARLSLKDPVYVSVHENAVAATPSNLQQSYVIVPLEDKIDMLWSFIKSHLKKKSIVFLSSCKQVKFLYE  331 (758)
T ss_pred             eecccchhHHHHHHhhcCCCcEEEEeccccccChhhhhheEEEEehhhHHHHHHHHHHhccccceEEEEehhhHHHHHHH
Confidence            99999999999999999999999999999899999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCcEEEeeCCCCHHHHHHHHHHHhc-cCCeEEEccccccccccCCCCcEEEEcCCCCCHhHHHHHhhccCcCC
Q 004567          330 AFKKLRPGIPLMCLYGRMKQDRRMAIYAQFCE-KRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVASYIHRVGRTARYN  408 (744)
Q Consensus       330 ~L~~l~~g~~v~~lhg~~~~~~R~~i~~~F~~-~~~VLVaTdv~arGlDi~p~V~~VI~~d~P~s~~~yiQRiGRagR~g  408 (744)
                      .|+++.||+++++|||+|+|..|..++..|.. ...||||||+++||||| |.|+||||+|||.++++||||+||++|++
T Consensus       332 ~F~rlrpg~~l~~L~G~~~Q~~R~ev~~~F~~~~~~vLF~TDv~aRGLDF-paVdwViQ~DCPedv~tYIHRvGRtAR~~  410 (758)
T KOG0343|consen  332 AFCRLRPGIPLLALHGTMSQKKRIEVYKKFVRKRAVVLFCTDVAARGLDF-PAVDWVIQVDCPEDVDTYIHRVGRTARYK  410 (758)
T ss_pred             HHHhcCCCCceeeeccchhHHHHHHHHHHHHHhcceEEEeehhhhccCCC-cccceEEEecCchhHHHHHHHhhhhhccc
Confidence            99999999999999999999999999999999 89999999999999999 99999999999999999999999999999


Q ss_pred             CCCeEEEEeCcch-HHHHHHHHHcCCCcccccccccccccHHHHHHHHHhcChhHHHHHHHHHHHHHHHhccCCCccccc
Q 004567          409 SGGRSVLFLTPTE-MKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALLVKYPDMQHRAQKAFITYLRSVHIQKDKEVFD  487 (744)
Q Consensus       409 ~~G~~il~l~~~e-~~~l~~l~~~~i~i~~~~~~~~~~~~i~~~l~~~~~~~~~l~~~a~~af~sy~rs~~~~~~~~if~  487 (744)
                      ..|.++++++|+| ..|+..|+.++||+..+.+++.++.++..+|+++++++|++++.||+||++|++|+|.+.++.+|+
T Consensus       411 ~~G~sll~L~psEeE~~l~~Lq~k~I~i~~i~i~~~k~~~i~~~l~~ll~~~~eLk~~aqka~isY~rsi~~~rdK~~f~  490 (758)
T KOG0343|consen  411 ERGESLLMLTPSEEEAMLKKLQKKKIPIKEIKIDPEKLTSIRNKLEALLAKDPELKEYAQKAFISYLRSIYLMRDKRVFD  490 (758)
T ss_pred             CCCceEEEEcchhHHHHHHHHHHcCCCHHhhccCHHHhhhHHHHHHHHHhhCHHHHHHHHHHHHHHHHHHHhhccchhhc
Confidence            9999999999999 589999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCHHHHHHhcCCCCCCC-ccccccccCCCCCCCCcCcchhhhhhhhhhhcccCCCCcCCCCCCCCcccccccccccc
Q 004567          488 VTKLSIDEFSASLGLPMTPK-IRFLNQKKGKMVPVKPVLDNAEKEDKLMISREKLLPDNFTEENVDRDILETKDIEDEGK  566 (744)
Q Consensus       488 ~~~l~~~~~a~s~gl~~~p~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  566 (744)
                      +..+++++||.||||+++|+ |+|+....++++ ..+..+.+-+.++ +++ |           +++||++|||+|..++
T Consensus       491 ~~~l~~~afa~s~Gl~~~p~~~~~l~~~~k~~~-~~~l~e~~~~~ee-ee~-~-----------~~ed~f~vK~~dvlge  556 (758)
T KOG0343|consen  491 VEKLDIEAFADSLGLPGTPRIVRFLNKKAKKQG-IEQLMEQSVDEEE-EEA-T-----------DDEDFFKVKKHDVLGE  556 (758)
T ss_pred             chhccHHHHHHhcCCCCCchhccchhhHHHhcC-hHhhhhhhccchh-hhc-c-----------chhhhhheeccccccc
Confidence            99999999999999999999 999887665555 2211110000000 000 2           3445555555544431


Q ss_pred             c----c----c---ccc-------hhhhhhhhhhhhhhhcccCCCCCeeeecCCCCCCCchhhhcccc---ccCCCcChH
Q 004567          567 A----D----L---LED-------VMRATRVKKNKKLKINVHRPLGTRLVFDEECNTVPPLAMLADTK---NANVSLDQD  625 (744)
Q Consensus       567 ~----~----~---~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~  625 (744)
                      -    +    +   ...       ..+.+|++.+||+ +++++++|+|++|||||++++ .|+...+.   ..|+.  ++
T Consensus       557 ~~~l~ee~~~ek~d~~~~svkk~~k~~~tKva~aKKa-~~k~~kvnsK~~FddEGe~~~-~~~~~~e~~~~~~~~d--~~  632 (758)
T KOG0343|consen  557 PEQLKEEDAAEKEDNDFISVKKKDKKRVTKVALAKKA-LKKNLKVNSKLTFDDEGELAP-EYEQMPETITSKAGDD--DD  632 (758)
T ss_pred             hhhhhhhhhhhcccCCCceeccchhhhHHHHHHHHHH-HHHhhccCceeeecCccccch-hhhhchhhhhhhccCc--hh
Confidence            0    0    0   000       0346799999999 999999999999999999888 77766655   33444  77


Q ss_pred             HHHHHHHHHHHHHHHhcHHhHHHHHHHHHHHHHHHHHHHhcCCCCCCCCC---c-ccc-----cCCCCC-cchhhccccc
Q 004567          626 QKTEYYKKIREELKRADKEDKLLDRQRRREKRIKQKMKRKRGGLGDDDDE---E-DED-----NASDKD-EESMERGRRK  695 (744)
Q Consensus       626 ~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~-~~~-----~~~~~~-~~~~~~~~~~  695 (744)
                      +...|+.+++++|+++|++||+++|+++++||+++++++|+.++++.+++   + .++     .|++|| +.+|+|+|+|
T Consensus       633 ~~g~~l~k~~a~l~~~D~~DK~~~kek~~ek~r~k~~k~rr~aeea~~~e~e~~e~d~~~~~~~gs~dD~d~s~lPd~dk  712 (758)
T KOG0343|consen  633 TGGINLEKAKAELKEEDKEDKKRFKEKRKEKRREKLEKERRRAEEANEEEAEAEEEDGDFVDWSGSEDDPDISWLPDPDK  712 (758)
T ss_pred             hccchHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhcccccccchhccCchhcccCCcccCCcccCCChhh
Confidence            88888999999999999999999999999999999999987665432111   1 111     244444 3378899999


Q ss_pred             ccccccCCCCCCchhhhh-cCCCCCCCCCCCCCHHHHHHHHHHhHh
Q 004567          696 KAKIYFDSDSDNDNDERK-QNKDDNGPNIDSISLAEQEALALKLLN  740 (744)
Q Consensus       696 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~  740 (744)
                      ++++|+++.++.+..... .....+.+. .+.+++|+|++|++|..
T Consensus       713 ~~kk~~~d~de~e~k~~s~~~~~g~k~~-~~~~~eD~e~~~~k~~~  757 (758)
T KOG0343|consen  713 VRKKKESDSDENEGKIQSALAADGIKEV-SNSSVEDVEPLALKLKK  757 (758)
T ss_pred             hhhccccCchhhcccccccccccccccc-CCcchhhcchhhHHhhc
Confidence            999998877665543211 223445555 78999999999999865

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF13959 DUF4217: Domain of unknown function (DUF4217) Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 6e-77
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-53
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-43
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 5e-42
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 1e-41
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-41
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 6e-39
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 2e-37
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-34
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-34
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-33
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-32
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-32
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-32
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-32
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-32
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-32
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-32
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-31
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-31
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 5e-31
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 4e-30
2vso_A395 Crystal Structure Of A Translation Initiation Compl 3e-28
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 4e-28
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 7e-28
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 9e-27
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-26
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-26
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-26
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-26
1fuu_A394 Yeast Initiation Factor 4a Length = 394 2e-26
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-26
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 1e-24
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 9e-24
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 2e-23
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 2e-23
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 2e-23
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 3e-22
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 6e-22
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-21
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 7e-21
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 3e-20
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 8e-20
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 5e-18
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-17
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 2e-17
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 1e-16
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-16
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 1e-16
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 4e-16
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 4e-14
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 5e-14
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 7e-10
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-09
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 3e-09
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 3e-08
2jgn_A185 Ddx3 Helicase Domain Length = 185 4e-08
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 2e-07
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 3e-07
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 3e-07
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 4e-07
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 4e-07
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 9e-07
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-06
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 9e-06
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 1e-05
1gm5_A780 Structure Of Recg Bound To Three-Way Dna Junction L 4e-04
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure 
Iteration: 1

 Score =  285 bits (730), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 174/213 (81%), Gaps = 1/213 (0%)
Query: 66  TRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVL 125
           TRF   P+SKKT  GL++A +  +T+IQ+ ++  +L G+D+LGAAKTGSGKTLAF++PVL
Sbjct: 25  TRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFLVPVL 84
Query: 126 EKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEH 185
           E LY+ +W   DG+G +IISPTRELA Q F+VL+ VGK+H+FSAGL+IGG+ D+  E E 
Sbjct: 85  EALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGK-DLKHEAER 143
Query: 186 VNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHR 245
           +N +NILVCTPGRLLQHMDET +F  + LQ+L+LDEADRILD+GF   +NA++  LPK R
Sbjct: 144 INNINILVCTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKR 203
Query: 246 QTFLFSATQTKSVQDLARLSLKDPQYLSVHEES 278
           QT LFSATQTKSV+DLARLSLK+P+Y+ VHE++
Sbjct: 204 QTLLFSATQTKSVKDLARLSLKNPEYVWVHEKA 236
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-168
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-163
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-118
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-112
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-85
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 4e-82
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 6e-82
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 9e-82
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-80
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-76
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-75
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-74
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-74
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-71
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 8e-71
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-70
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 6e-70
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 9e-70
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-60
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 5e-57
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-56
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 2e-55
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 2e-54
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 3e-53
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-52
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 3e-52
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-51
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-51
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-51
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-51
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-47
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-22
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 5e-21
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-20
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 5e-20
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 7e-20
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-19
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-19
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 4e-18
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-14
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-13
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 6e-12
1yks_A440 Genome polyprotein [contains: flavivirin protease 4e-10
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-09
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-09
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 5e-09
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 9e-09
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 5e-04
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-08
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-08
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-08
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 2e-04
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-07
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-07
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 5e-07
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-05
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 8e-07
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-04
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-06
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 2e-05
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 2e-05
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 3e-05
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  493 bits (1272), Expect = e-168
 Identities = 126/548 (22%), Positives = 247/548 (45%), Gaps = 28/548 (5%)

Query: 1   MKKSKRKPNRKAVRSMEIEEIELLNSWIDSQKPESGTNPLSFPPLGKKEPIGRIGEDSFS 60
             + +R   R    +          +     +     + + F      + I    ED+  
Sbjct: 7   GNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDNSK 66

Query: 61  KYVGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCG--RDILGAAKTGSGKTL 118
           +    +  ++  + K+    +    F  +T +Q+ ++   L     D++  AKTG+GKT 
Sbjct: 67  EVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTF 126

Query: 119 AFVIPVLEKLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHH----NFSAGLLIG 174
           AF+IP+ + L   ++  +  V ++I++PTR+LA Q+   +K +   +     ++   L+G
Sbjct: 127 AFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVG 186

Query: 175 G-RRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKA 233
           G      M K +    NI++ TPGRL+  +++  N     +   +LDEADR+L++GF+  
Sbjct: 187 GTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDD 246

Query: 234 LNAIVSQLPK-------HRQTFLFSATQTKSVQDLARLSLKDPQYLSV--HEESVTATPN 284
           L  I   L +       + +T LFSAT    VQ LA   +   + L +   +++      
Sbjct: 247 LETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHE 306

Query: 285 RLQQTAMIVP-LEQKLDMLWSFIKAHL-----NSKILVFLTSCKQVKYVFEAFK-KLRPG 337
           R+ Q+ +I       +      IK  +     N K ++F  + K   ++    K + +  
Sbjct: 307 RIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKD 366

Query: 338 IPLMCLYGRMKQDRRMAIYAQFCE-KRSVLFCTDVASRGLDFNKAVDWVVQVDCPEDVAS 396
           +P++  +G++ Q++R ++  +F + +  +L CTDV +RG+DF   V  V+Q+  P ++A+
Sbjct: 367 LPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFP-NVHEVLQIGVPSELAN 425

Query: 397 YIHRVGRTARYNSGGRSVLFLTPTEMKMLEKLREAKIPIHFTKANTKRLQPVSGLLAALL 456
           YIHR+GRTAR    G SVLF+   E+  + +L +AK  +   +   +  + +   +   +
Sbjct: 426 YIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAV 485

Query: 457 VKYPDMQHRAQKAFITYLRSVHIQKDKEVFDVTKLSIDEFSASLGLP---MTPKIRFLNQ 513
            + P+       + I+  RS   +       +       +   L  P   +    RFL++
Sbjct: 486 TEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDK 545

Query: 514 KKGKMVPV 521
                 P+
Sbjct: 546 LGLSRSPI 553
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 744
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 8e-42
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 7e-39
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-38
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-37
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 3e-37
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-36
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-34
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 3e-33
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 4e-33
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-32
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 7e-29
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 6e-26
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 2e-22
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 7e-20
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 4e-17
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 9e-16
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-15
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-15
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-15
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-14
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 2e-14
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 4e-14
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 8e-14
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 9e-13
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-11
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 2e-11
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 7e-09
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 6e-05
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 7e-04
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  149 bits (377), Expect = 8e-42
 Identities = 67/208 (32%), Positives = 117/208 (56%), Gaps = 8/208 (3%)

Query: 68  FDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGR-DILGAAKTGSGKTLAFVIPVLE 126
           F++L +S    + +++ GF K TDIQ   +P  L    +I+  A+TGSGKT +F IP   
Sbjct: 6   FNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIP--- 62

Query: 127 KLYKERWGPEDGVGSIIISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHV 186
               E     +G+ +II++PTRELA Q+ D ++++  + N     + GG+  +  + + +
Sbjct: 63  --LIELVNENNGIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGK-AIYPQIKAL 119

Query: 187 NELNILVCTPGRLLQHMDETPNFDCSQLQILILDEADRILDVGFKKALNAIVSQLPKHRQ 246
              NI+V TPGR+L H+      +   ++  ILDEAD +L++GF K +  I++   K ++
Sbjct: 120 KNANIVVGTPGRILDHI-NRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKR 178

Query: 247 TFLFSATQTKSVQDLARLSLKDPQYLSV 274
             LFSAT  + + +LA+  + D  ++  
Sbjct: 179 ILLFSATMPREILNLAKKYMGDYSFIKA 206
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query744
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.98
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.97
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.97
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.97
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.97
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.96
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.95
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.93
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.92
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.89
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.86
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.86
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.85
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.85
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.82
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.82
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.81
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.81
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.8
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.76
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.74
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.71
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.66
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.65
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.63
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.54
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.39
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.3
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.13
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 99.09
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.83
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.72
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 98.06
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.9
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 97.88
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.49
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.48
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.28
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.17
d2qy9a2211 GTPase domain of the signal recognition particle r 97.06
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.03
d1vmaa2213 GTPase domain of the signal recognition particle r 96.87
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.81
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.78
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.68
d1okkd2207 GTPase domain of the signal recognition particle r 96.67
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.55
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.44
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.28
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 96.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.17
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.11
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.02
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.71
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.59
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.48
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.99
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 94.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.58
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.16
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 93.78
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 93.72
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.6
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 93.01
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.86
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.59
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.18
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.96
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.33
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.79
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.67
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.86
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 89.25
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 89.2
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.68
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.56
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 87.37
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 87.11
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 87.1
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 86.84
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 86.78
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.45
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.42
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 86.28
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 85.87
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 85.54
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.27
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.18
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 84.1
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 83.92
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 83.09
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 81.58
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 80.53
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=0  Score=303.51  Aligned_cols=208  Identities=28%  Similarity=0.451  Sum_probs=187.8

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             67888777999998999999799999939999999999769979998468884237827999999974138999991699
Q 004567           63 VGSTRFDQLPISKKTKSGLKDAGFVKMTDIQRASLPHSLCGRDILGAAKTGSGKTLAFVIPVLEKLYKERWGPEDGVGSI  142 (744)
Q Consensus        63 ~~~~~F~~l~ls~~~~~~L~~~g~~~lt~iQ~~ai~~~l~gkdvli~a~TGSGKTla~llpil~~l~~~~~~~~~g~~vL  142 (744)
                      ....+|++++|++.++++|..+||..||++|..+||.+++|+|++++|+||||||+||++|+++.+...    ..+.+++
T Consensus        14 ~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~----~~~~~~l   89 (222)
T d2j0sa1          14 DVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ----VRETQAL   89 (222)
T ss_dssp             CCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT----SCSCCEE
T ss_pred             CCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCEEEECCCCHHHHHHHCCCCCCCCCCC----CCCCEEE
T ss_conf             999997777989999999998799999999999999998799869975743414544045401100333----4674257


Q ss_pred             EECCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHCCCCCEEEECHHHHHHHHHCCCCCCCCCCEEEEECCC
Q ss_conf             99289577999999999961127750789976854747789750999499987688999885299988888208997572
Q 004567          143 IISPTRELADQLFDVLKAVGKHHNFSAGLLIGGRRDVDMEKEHVNELNILVCTPGRLLQHMDETPNFDCSQLQILILDEA  222 (744)
Q Consensus       143 ii~PtreLa~Qi~~~l~~~~~~~~~~~~~~~Gg~~~~~~e~~~~~~~~IiV~TPgrLl~~l~~~~~~~~~~l~~iViDEA  222 (744)
                      |++||++|+.|++++++.++...++.+..++|+............+++|+|+|||+|.+++... .+.+.+++++|+|||
T Consensus        90 il~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~-~~~~~~l~~lVlDEa  168 (222)
T d2j0sa1          90 ILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRR-SLRTRAIKMLVLDEA  168 (222)
T ss_dssp             EECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTT-SSCCTTCCEEEEETH
T ss_pred             EECCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHCCCCEEEECCCCCHHHCCCCC-CCCCCCCEEEEECCH
T ss_conf             7555288889999999998475634588875112102467875148738867987577612001-034442303554224


Q ss_pred             HHHHCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCC
Q ss_conf             02220104999999999689888189983026725999999843899401014
Q 004567          223 DRILDVGFKKALNAIVSQLPKHRQTFLFSATQTKSVQDLARLSLKDPQYLSVH  275 (744)
Q Consensus       223 h~ll~~gf~~~l~~I~~~lp~~~q~il~SAT~~~~v~~l~~~~l~~p~~i~v~  275 (744)
                      |++++.+|...+..|+..+|+.+|+++||||+++.+..+++.++.+|..+.+.
T Consensus       169 D~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         169 DEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             HHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             HHHHHCCCHHHHHHHHHHCCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEEEE
T ss_conf             67652573999999999689888799999728889999999988998899972
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure