Citrus Sinensis ID: 004622


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWLD
cccccHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHcccccHHccccHHHHHHHHHHHHcccccccHHHHHHHHccccccccHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHccccccHHHHHHHHcHHccccHHHHHcccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
cHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHHHHHHcEEEEEcccccccEEEcc
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGcafsalgrkEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKqdrsvtceydvsnsmssltvsesglnandkmsetsenhnksdicdsssqsrdvsetcsksshdpdlcngrsdeakggssvpvsksglhingklrevsenhngssdgsksthasrdaseinrqssddfdicngpidkasvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQilkedpmypealigRGTARAFQRELEAAISDFTEAiqsnpsagEAWKRRGQARAALGESVEAIQDLSKalefepnsadilhergivnfkfkdFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLssgsrtmmpHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIpssrnigakdciprmyvkrftdslpcvilskressgdktfLLQSRRLRFYWLLIQLARKFNMIVLAsypiggsivwld
mlkrklldsryrlnkthkticeidelvrvDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETsenhnksdicdsssqsrDVSEtcsksshdpdlcngrsdeakggssvpvsksgLHINGKLrevsenhngssdgsksthasrdaseinrqssddfdicNGPIDKAsvnerhgrqtngthdvhdklssdsaslndsntnsesyskssisdnkssdstesrsklsfkWDMLKetsneakrnkkfcvtrisksksisvdfrlsrgiaqvnegkyASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTlmeilipssrnigakDCIPRMYVKRFTDSLPCvilskressgdktfllqsRRLRFYWLLIQLARKFNMIVLAsypiggsivwld
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAkggssvpvsksgLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKlssdsaslndsntnsesyskssisdnkssdstesrsklsFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYhlrglllhglgqhKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWLD
*********RYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQ**SVTCE************************************************************************************************************************************************************************************************************KFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDF*************************************LEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWL*
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWLD
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNAN*************************************LCNGRS**********VSKSGLHINGKLREVS***********************RQSSDDFDICNGPIDKASVNER**************************************************KLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS******************GESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWLD
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWLD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKRKLLDSRYRLNKTHKTICEIDELVRVDSVMASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDSSSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLLKSTVSFAGLTLMEILIPSSRNIGAKDCIPRMYVKRFTDSLPCVILSKRESSGDKTFLLQSRRLRFYWLLIQLARKFNMIVLASYPIGGSIVWLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query741 2.2.26 [Sep-21-2011]
Q8NBP0 860 Tetratricopeptide repeat yes no 0.364 0.313 0.275 2e-22
Q8RVB2 931 Probable UDP-N-acetylgluc N/A no 0.306 0.243 0.243 1e-11
O82039 932 Probable UDP-N-acetylgluc N/A no 0.306 0.243 0.247 4e-11
Q96301 914 Probable UDP-N-acetylgluc no no 0.306 0.248 0.247 4e-10
Q58741314 TPR repeat-containing pro yes no 0.245 0.579 0.268 8e-10
Q54VG4334 Small glutamine-rich tetr no no 0.156 0.347 0.316 2e-09
Q6YZI0 927 Probable UDP-N-acetylgluc no no 0.306 0.244 0.243 2e-09
Q04737248 TPR repeat-containing pro N/A no 0.218 0.653 0.265 4e-09
O82422 944 Probable UDP-N-acetylgluc N/A no 0.306 0.240 0.239 9e-09
Q68FQ7 659 RNA polymerase II-associa no no 0.302 0.339 0.270 2e-08
>sp|Q8NBP0|TTC13_HUMAN Tetratricopeptide repeat protein 13 OS=Homo sapiens GN=TTC13 PE=2 SV=3 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 137/280 (48%), Gaps = 10/280 (3%)

Query: 334 SDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVN 393
           SD +   S+   S LS   + +   +      K+F       + + S +  L+     + 
Sbjct: 100 SDCEPKGSSPCDSLLSLNTEKILSQAKSIAEQKRFPFA----TDNDSTNEELAIAYVLIG 155

Query: 394 EGKYASAISIFDQILKEDPMYPEALIGRGTARAFQ-----RELEAAISDFTEAIQSNPSA 448
            G Y  AI  F  +L+E+P    A+ GRG A   +     +  E A+ + +  I   P  
Sbjct: 156 SGLYDEAIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELALFELSRVITLEPDR 215

Query: 449 GEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSA 508
            E +++R +  + LG   EA+ DL+KA++ +P SA +   RG + F  +D+  A ED   
Sbjct: 216 PEVFEQRAEILSPLGRINEAVNDLTKAIQLQP-SARLYRHRGTLYFISEDYATAHEDFQQ 274

Query: 509 CVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSE 568
            ++L+K    A  Y GL     G  K+A E+  +A++   +F++A+  L Q Y++L N E
Sbjct: 275 SLELNKNQPIAMLYKGLTFFHRGLLKEAIESFKEALKQKVDFIDAYKSLGQAYRELGNFE 334

Query: 569 KALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDL 608
            A E  Q+ L +++   +   LRG++L+  G  ++A+K+ 
Sbjct: 335 AATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNF 374





Homo sapiens (taxid: 9606)
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q58741|Y1345_METJA TPR repeat-containing protein MJ1345 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1345 PE=4 SV=1 Back     alignment and function description
>sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description
>sp|Q04737|Y751_SYNY3 TPR repeat-containing protein slr0751 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0751 PE=4 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query741
255567975 1101 tetratricopeptide repeat protein, tpr, p 0.775 0.522 0.662 0.0
225438920 1068 PREDICTED: tetratricopeptide repeat prot 0.734 0.509 0.645 0.0
224071273526 predicted protein [Populus trichocarpa] 0.708 0.998 0.676 0.0
449448472 1046 PREDICTED: tetratricopeptide repeat prot 0.696 0.493 0.580 1e-175
449520722 1046 PREDICTED: tetratricopeptide repeat prot 0.696 0.493 0.580 1e-175
357482705 1033 Tetratricopeptide repeat protein [Medica 0.676 0.484 0.578 1e-173
357482701 1062 Tetratricopeptide repeat protein [Medica 0.676 0.471 0.578 1e-173
357482703798 Tetratricopeptide repeat protein [Medica 0.676 0.627 0.578 1e-173
356514306 1050 PREDICTED: tetratricopeptide repeat prot 0.676 0.477 0.571 1e-163
356496945 1047 PREDICTED: tetratricopeptide repeat prot 0.682 0.483 0.572 1e-161
>gi|255567975|ref|XP_002524965.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] gi|223535800|gb|EEF37462.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/580 (66%), Positives = 453/580 (78%), Gaps = 5/580 (0%)

Query: 33  MASAITARIELAKLCSLRNWSKAIRILDSLLAQSYEIQDICNRAFCYSQLELHKHVIRDC 92
           MASAI+ R+ELAKLC+ R+WSKAIR+LDSLL+QS  IQDICNRAFCYSQLELHKHVI+DC
Sbjct: 1   MASAISERVELAKLCASRDWSKAIRVLDSLLSQSCTIQDICNRAFCYSQLELHKHVIKDC 60

Query: 93  DKALQLDPTLLQAYILKGCAFSALGRKEEALSVWEKGYEHALHQSADLKQFLELEELLTA 152
           DKALQLDP LLQAYILKG AFS+LGRK++AL VW++GYEHAL QSADLKQ LELEELL  
Sbjct: 61  DKALQLDPMLLQAYILKGRAFSSLGRKDDALLVWQQGYEHALRQSADLKQLLELEELLKF 120

Query: 153 AKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNK-SDICDSSSQSRDVSETC 211
           AKQ+R++     V+ S + +  +E   + N K +E S+N ++ SDI +S  +S D SE C
Sbjct: 121 AKQERNIGLRDHVTES-TPMNTTEFATHTNGKSNEASKNRDQLSDISNSCRESGDGSEIC 179

Query: 212 SKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDAS 271
           SK   + D  N   D+A G S + + +   H+NGK  +V  NH+   D SK  + SRD  
Sbjct: 180 SKFGGNFDAMNVIRDKAGGESPITIPECRPHMNGKSDDVCTNHDKLGDKSKLHNESRDTY 239

Query: 272 EINRQSSDDFDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKS 331
           +I   S D+  I N    KA  + +  +  NGTH+  DK+S DS S N  +  S   SKS
Sbjct: 240 KICCNSGDNCAIQNYLSRKAEGDVKTDK--NGTHNFIDKIS-DSESCNVLSDTSVPSSKS 296

Query: 332 SISDNKSSDSTESRSKLSFKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQ 391
           S     S D+++ R KLS K D+  E  +E K++KKF VTRISK+KSI+VDFRLSRGIAQ
Sbjct: 297 STISISSGDTSDIRVKLSNKTDIPNEAGDETKKSKKFSVTRISKTKSITVDFRLSRGIAQ 356

Query: 392 VNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEA 451
           VNEGKYASAISIFDQIL EDP YPEALIGRGTA AFQRELEAAI+DF++AIQSNP AGEA
Sbjct: 357 VNEGKYASAISIFDQILTEDPTYPEALIGRGTAHAFQRELEAAIADFSKAIQSNPLAGEA 416

Query: 452 WKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVK 511
           WKRRGQARAALGES+EAI DL+KALEFEPNSADILHERGIVNFKFKDF+AAV+DLSACVK
Sbjct: 417 WKRRGQARAALGESIEAIHDLTKALEFEPNSADILHERGIVNFKFKDFDAAVQDLSACVK 476

Query: 512 LDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKAL 571
           LDK+NKSAYTYLGLALSS GEYKKAEEAHLK+IQLDR+FLE W HLTQFYQDLAN  KA 
Sbjct: 477 LDKDNKSAYTYLGLALSSTGEYKKAEEAHLKSIQLDRSFLEGWAHLTQFYQDLANLTKAF 536

Query: 572 ECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKDLSSG 611
           EC++QVL ID RF+KAYHL GLLLHG+G+H+KAIK+LS G
Sbjct: 537 ECIKQVLQIDARFAKAYHLHGLLLHGMGEHRKAIKELSLG 576




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438920|ref|XP_002279290.1| PREDICTED: tetratricopeptide repeat protein 13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224071273|ref|XP_002303385.1| predicted protein [Populus trichocarpa] gi|222840817|gb|EEE78364.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449448472|ref|XP_004141990.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520722|ref|XP_004167382.1| PREDICTED: tetratricopeptide repeat protein 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357482705|ref|XP_003611639.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512974|gb|AES94597.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357482701|ref|XP_003611637.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512972|gb|AES94595.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357482703|ref|XP_003611638.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355512973|gb|AES94596.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356514306|ref|XP_003525847.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|356496945|ref|XP_003517325.1| PREDICTED: tetratricopeptide repeat protein 13-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query741
TAIR|locus:2126347 1052 SRFR1 "SUPPRESSOR OF RPS4-RLD 0.341 0.240 0.703 1.2e-136
DICTYBASE|DDB_G0272186 1050 DDB_G0272186 "TPR_1 repeat-con 0.300 0.212 0.290 2.6e-28
ZFIN|ZDB-GENE-080722-25 826 ttc13 "tetratricopeptide repea 0.265 0.238 0.315 7.4e-19
UNIPROTKB|Q74DZ8266 GSU1166 "TPR domain protein" [ 0.300 0.838 0.271 1.2e-14
TIGR_CMR|GSU_1166266 GSU_1166 "TPR domain protein" 0.300 0.838 0.271 1.2e-14
UNIPROTKB|P72802266 mom72 "Mitochondrial outer mem 0.257 0.718 0.251 6.5e-12
ZFIN|ZDB-GENE-041121-17542 stip1 "stress-induced-phosphop 0.242 0.332 0.247 8.6e-11
UNIPROTKB|Q08E34609 TOMM70A "Translocase of outer 0.326 0.397 0.224 3.8e-10
UNIPROTKB|O94826608 TOMM70A "Mitochondrial import 0.326 0.398 0.220 8e-10
UNIPROTKB|Q3ZBZ8543 STIP1 "Stress-induced-phosphop 0.242 0.331 0.237 1.1e-09
TAIR|locus:2126347 SRFR1 "SUPPRESSOR OF RPS4-RLD 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 915 (327.2 bits), Expect = 1.2e-136, Sum P(2) = 1.2e-136
 Identities = 178/253 (70%), Positives = 212/253 (83%)

Query:   359 SNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEAL 418
             S+E+++NKK+ + RIS + SISVDFRLSRGIAQVNEG Y  AISIFD++LKE+P YPEAL
Sbjct:   275 SDESRKNKKYTIARISGTHSISVDFRLSRGIAQVNEGNYTKAISIFDKVLKEEPTYPEAL 334

Query:   419 IGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEF 478
             IGRGTA AFQRELE+AI+DFT+AIQSNP+A EAWKRRGQARAALGE VEA++DL+KAL F
Sbjct:   335 IGRGTAYAFQRELESAIADFTKAIQSNPAASEAWKRRGQARAALGEYVEAVEDLTKALVF 394

Query:   479 EPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSSIGEYKKAEE 538
             EPNS D+LHERGIVNFK KDF AAV+DLS C+K +K+NKSAYTYLGLA +S+GEYKKAEE
Sbjct:   395 EPNSPDVLHERGIVNFKSKDFTAAVKDLSICLKQEKDNKSAYTYLGLAFASLGEYKKAEE 454

Query:   539 AHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYXXXXXXXXXX 598
             AHLK+IQLD N+LEAW HL QFYQ+LA+  KALEC++QVL +D R  KAY          
Sbjct:   455 AHLKSIQLDSNYLEAWLHLAQFYQELADHCKALECIEQVLQVDNRVWKAYHLRGLVFHGL 514

Query:   599 XXXKKAIKDLSSG 611
                +KAI++LS G
Sbjct:   515 GEHRKAIQELSIG 527


GO:0042742 "defense response to bacterium" evidence=IGI
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IMP
GO:0032947 "protein complex scaffold" evidence=TAS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0031348 "negative regulation of defense response" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
DICTYBASE|DDB_G0272186 DDB_G0272186 "TPR_1 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080722-25 ttc13 "tetratricopeptide repeat domain 13" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q74DZ8 GSU1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1166 GSU_1166 "TPR domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P72802 mom72 "Mitochondrial outer membrane 72K protein" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E34 TOMM70A "Translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O94826 TOMM70A "Mitochondrial import receptor subunit TOM70" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBZ8 STIP1 "Stress-induced-phosphoprotein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query741
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-16
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-15
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-15
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-09
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 5e-09
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-08
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-07
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 3e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-07
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 4e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 7e-06
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 8e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 2e-05
TIGR02795117 TIGR02795, tol_pal_ybgF, tol-pal system protein Yb 6e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-04
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 3e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 3e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 6e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-04
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 8e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 8e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 0.002
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.002
pfam1341469 pfam13414, TPR_11, TPR repeat 0.004
pfam1341469 pfam13414, TPR_11, TPR repeat 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 80.1 bits (198), Expect = 3e-18
 Identities = 37/100 (37%), Positives = 57/100 (57%)

Query: 450 EAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSAC 509
           EA    G     LG+  EA++   KALE +P++AD  +      +K   +  A+ED    
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKA 60

Query: 510 VKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRN 549
           ++LD +N  AY  LGLA   +G+Y++A EA+ KA++LD N
Sbjct: 61  LELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 741
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG0547606 consensus Translocase of outer mitochondrial membr 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.98
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG1126638 consensus DNA-binding cell division cycle control 99.96
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.95
KOG2003840 consensus TPR repeat-containing protein [General f 99.95
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.95
KOG1126638 consensus DNA-binding cell division cycle control 99.95
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.94
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.94
KOG2003840 consensus TPR repeat-containing protein [General f 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK14574 822 hmsH outer membrane protein; Provisional 99.93
PRK14574 822 hmsH outer membrane protein; Provisional 99.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.93
KOG2076 895 consensus RNA polymerase III transcription factor 99.92
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.92
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.9
KOG2076 895 consensus RNA polymerase III transcription factor 99.89
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.89
PLN03077857 Protein ECB2; Provisional 99.89
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.89
KOG1129478 consensus TPR repeat-containing protein [General f 99.89
PLN032181060 maturation of RBCL 1; Provisional 99.88
PLN032181060 maturation of RBCL 1; Provisional 99.88
PLN03077 857 Protein ECB2; Provisional 99.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.88
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.87
PRK12370553 invasion protein regulator; Provisional 99.87
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.86
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.86
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.86
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.86
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.85
PRK11189296 lipoprotein NlpI; Provisional 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.85
KOG1915677 consensus Cell cycle control protein (crooked neck 99.84
PRK12370553 invasion protein regulator; Provisional 99.84
KOG1125579 consensus TPR repeat-containing protein [General f 99.84
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.84
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.83
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.83
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.83
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.83
PRK11189296 lipoprotein NlpI; Provisional 99.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.82
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.82
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.81
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.8
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.79
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.79
PLN02789320 farnesyltranstransferase 99.78
KOG0553304 consensus TPR repeat-containing protein [General f 99.78
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
PLN02789320 farnesyltranstransferase 99.77
KOG2376652 consensus Signal recognition particle, subunit Srp 99.77
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.72
KOG2376652 consensus Signal recognition particle, subunit Srp 99.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
KOG1915677 consensus Cell cycle control protein (crooked neck 99.69
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.67
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.66
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.65
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.62
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.61
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.61
PRK15359144 type III secretion system chaperone protein SscB; 99.57
PRK15359144 type III secretion system chaperone protein SscB; 99.57
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.53
KOG4648536 consensus Uncharacterized conserved protein, conta 99.52
PRK10370198 formate-dependent nitrite reductase complex subuni 99.52
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.52
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.52
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG4234271 consensus TPR repeat-containing protein [General f 99.51
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.51
PRK10370198 formate-dependent nitrite reductase complex subuni 99.51
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.51
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.51
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.49
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.47
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.47
KOG1128777 consensus Uncharacterized conserved protein, conta 99.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.43
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.42
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.42
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.41
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.39
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.39
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.38
KOG1128777 consensus Uncharacterized conserved protein, conta 99.37
PRK04841903 transcriptional regulator MalT; Provisional 99.37
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.37
PRK04841903 transcriptional regulator MalT; Provisional 99.36
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.35
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.33
KOG0553304 consensus TPR repeat-containing protein [General f 99.32
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.17
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.16
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.15
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.15
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.11
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.11
KOG1941518 consensus Acetylcholine receptor-associated protei 99.1
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.09
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.09
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 99.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.06
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.05
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.02
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.01
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.01
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.01
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.01
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.0
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.99
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.99
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.97
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.96
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.96
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.95
KOG1941518 consensus Acetylcholine receptor-associated protei 98.95
PRK11906458 transcriptional regulator; Provisional 98.94
PRK15331165 chaperone protein SicA; Provisional 98.93
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.93
KOG4648536 consensus Uncharacterized conserved protein, conta 98.92
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.92
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.92
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.91
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.9
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.9
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.89
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.89
PRK11906458 transcriptional regulator; Provisional 98.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.89
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.88
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.87
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.87
PRK15331165 chaperone protein SicA; Provisional 98.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.82
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.81
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.79
PRK10803263 tol-pal system protein YbgF; Provisional 98.78
KOG4555175 consensus TPR repeat-containing protein [Function 98.78
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.77
PRK10803263 tol-pal system protein YbgF; Provisional 98.76
PF1337173 TPR_9: Tetratricopeptide repeat 98.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.69
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.69
KOG2471696 consensus TPR repeat-containing protein [General f 98.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.68
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.67
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.67
PF12688120 TPR_5: Tetratrico peptide repeat 98.67
COG3898531 Uncharacterized membrane-bound protein [Function u 98.65
COG4700251 Uncharacterized protein conserved in bacteria cont 98.63
PF12688120 TPR_5: Tetratrico peptide repeat 98.62
COG3898531 Uncharacterized membrane-bound protein [Function u 98.62
PF13512142 TPR_18: Tetratricopeptide repeat 98.61
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.6
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.59
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.59
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.55
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.54
PF13512142 TPR_18: Tetratricopeptide repeat 98.52
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.52
KOG4234271 consensus TPR repeat-containing protein [General f 98.51
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.46
PF1337173 TPR_9: Tetratricopeptide repeat 98.45
COG4700251 Uncharacterized protein conserved in bacteria cont 98.42
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.36
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.34
KOG2471 696 consensus TPR repeat-containing protein [General f 98.29
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.24
KOG1585308 consensus Protein required for fusion of vesicles 98.23
KOG4555175 consensus TPR repeat-containing protein [Function 98.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.19
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.18
KOG1586288 consensus Protein required for fusion of vesicles 98.14
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.14
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.14
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.08
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.08
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.07
PF1343134 TPR_17: Tetratricopeptide repeat 98.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.0
PF1342844 TPR_14: Tetratricopeptide repeat 97.96
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.95
KOG1586288 consensus Protein required for fusion of vesicles 97.95
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.93
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.91
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.91
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.88
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.86
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.85
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.85
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.82
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.78
KOG1585308 consensus Protein required for fusion of vesicles 97.74
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.74
PF1342844 TPR_14: Tetratricopeptide repeat 97.73
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.7
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.68
KOG1310758 consensus WD40 repeat protein [General function pr 97.66
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.65
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.63
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.6
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.6
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.58
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.55
PF1343134 TPR_17: Tetratricopeptide repeat 97.54
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.54
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.52
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.44
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.42
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.41
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.41
KOG1550552 consensus Extracellular protein SEL-1 and related 97.39
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.39
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.35
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.34
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.34
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.32
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.29
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.17
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.16
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.15
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.12
KOG1550552 consensus Extracellular protein SEL-1 and related 97.11
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.1
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.04
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.03
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.0
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.0
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.97
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.89
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.89
KOG1258577 consensus mRNA processing protein [RNA processing 96.88
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.83
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.8
KOG4507886 consensus Uncharacterized conserved protein, conta 96.8
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.79
KOG1258577 consensus mRNA processing protein [RNA processing 96.74
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.7
PRK10941269 hypothetical protein; Provisional 96.67
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.66
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.64
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.43
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.38
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.35
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.32
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 96.31
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.3
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.26
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.22
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.19
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.18
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.18
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.03
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.94
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 95.89
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.85
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.82
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.8
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.7
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.67
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.62
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.59
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.55
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 95.54
KOG20411189 consensus WD40 repeat protein [General function pr 95.53
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.51
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.47
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.4
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.37
PRK10941269 hypothetical protein; Provisional 95.35
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.24
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.2
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.2
KOG1463411 consensus 26S proteasome regulatory complex, subun 95.16
KOG4814872 consensus Uncharacterized conserved protein [Funct 95.0
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.95
COG5159421 RPN6 26S proteasome regulatory complex component [ 94.91
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.89
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.61
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.5
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 94.47
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.43
COG5159421 RPN6 26S proteasome regulatory complex component [ 94.35
KOG3364149 consensus Membrane protein involved in organellar 94.18
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.16
KOG3364149 consensus Membrane protein involved in organellar 94.12
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.11
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.08
KOG1310 758 consensus WD40 repeat protein [General function pr 93.91
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.79
KOG15381081 consensus Uncharacterized conserved protein WDR10, 93.6
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.55
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.54
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.45
KOG2422665 consensus Uncharacterized conserved protein [Funct 93.3
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.19
KOG4814 872 consensus Uncharacterized conserved protein [Funct 92.91
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.87
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.84
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.81
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 91.85
COG5191435 Uncharacterized conserved protein, contains HAT (H 91.66
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.64
COG3629280 DnrI DNA-binding transcriptional activator of the 91.36
KOG1463411 consensus 26S proteasome regulatory complex, subun 91.27
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.26
KOG0529421 consensus Protein geranylgeranyltransferase type I 91.08
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.93
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.9
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.76
COG5191435 Uncharacterized conserved protein, contains HAT (H 90.73
COG2912269 Uncharacterized conserved protein [Function unknow 90.71
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.7
KOG0529421 consensus Protein geranylgeranyltransferase type I 90.68
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 90.59
KOG2581493 consensus 26S proteasome regulatory complex, subun 90.24
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.24
PF1286294 Apc5: Anaphase-promoting complex subunit 5 89.97
PF1286294 Apc5: Anaphase-promoting complex subunit 5 89.76
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 89.63
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 89.18
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.47
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.37
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.33
COG2912269 Uncharacterized conserved protein [Function unknow 88.27
KOG2581493 consensus 26S proteasome regulatory complex, subun 88.05
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 87.94
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.83
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 87.38
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.83
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 86.14
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 86.12
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.99
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.68
COG3629280 DnrI DNA-binding transcriptional activator of the 85.44
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 85.19
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.04
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.93
COG3947361 Response regulator containing CheY-like receiver a 84.81
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.7
PRK11619 644 lytic murein transglycosylase; Provisional 83.97
COG4941415 Predicted RNA polymerase sigma factor containing a 83.86
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.39
PRK11619644 lytic murein transglycosylase; Provisional 83.22
COG4455273 ImpE Protein of avirulence locus involved in tempe 82.96
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.44
KOG4014248 consensus Uncharacterized conserved protein (conta 82.24
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 81.99
PF1304150 PPR_2: PPR repeat family 81.79
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 80.12
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.6e-45  Score=365.87  Aligned_cols=463  Identities=16%  Similarity=0.127  Sum_probs=301.3

Q ss_pred             HHHHHHhcCCHHHHHHHHHHHHhcc-CChhhHHHHHHHHHhhhcHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHcCCHH
Q 004622           42 ELAKLCSLRNWSKAIRILDSLLAQS-YEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKE  120 (741)
Q Consensus        42 ~~~~~~~~g~~~~Ai~~~~~al~~~-~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~  120 (741)
                      .+-+.|+.|||++|.+.....-..+ .+.....-++.++++..+++....--..+++.+|...++|-.+|.++...|+++
T Consensus        54 lah~~yq~gd~~~a~~h~nmv~~~d~t~~~~llll~ai~~q~~r~d~s~a~~~~a~r~~~q~ae~ysn~aN~~kerg~~~  133 (966)
T KOG4626|consen   54 LAHRLYQGGDYKQAEKHCNMVGQEDPTNTERLLLLSAIFFQGSRLDKSSAGSLLAIRKNPQGAEAYSNLANILKERGQLQ  133 (966)
T ss_pred             HHHHHHhccCHHHHHHHHhHhhccCCCcccceeeehhhhhcccchhhhhhhhhhhhhccchHHHHHHHHHHHHHHhchHH
Confidence            3457899999999999999987777 555556778889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHhhhhccccccCcCCccchhhhhccccccCccchhhhhccCCCccccc
Q 004622          121 EALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDS  200 (741)
Q Consensus       121 ~A~~~~~~al~l~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  200 (741)
                      +|+..|+.+++++|++.+ +...+                                                        
T Consensus       134 ~al~~y~~aiel~p~fid-a~inl--------------------------------------------------------  156 (966)
T KOG4626|consen  134 DALALYRAAIELKPKFID-AYINL--------------------------------------------------------  156 (966)
T ss_pred             HHHHHHHHHHhcCchhhH-HHhhH--------------------------------------------------------
Confidence            999999999999998877 33322                                                        


Q ss_pred             CCCCcccccccccCCCCCCCCCCCcccccCCCCCCccccccccCcccccccccCCCCCCCCCCCCCCCcccccccCCCCc
Q 004622          201 SSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDD  280 (741)
Q Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  280 (741)
                                                                                                      
T Consensus       157 --------------------------------------------------------------------------------  156 (966)
T KOG4626|consen  157 --------------------------------------------------------------------------------  156 (966)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccCCCCCCCccccccccccCCCchHHHHhhhhHHHhcCChhhHHHHHHHhhccCCCCchhHHHHHHHHHchhcHHHHHH
Q 004622          281 FDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSN  360 (741)
Q Consensus       281 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~la~~~~~~g~~~~a~~  360 (741)
                                                     |..+..+|+.+.|...|..++.++|....+...++.++...|+..+|..
T Consensus       157 -------------------------------a~al~~~~~~~~a~~~~~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~  205 (966)
T KOG4626|consen  157 -------------------------------AAALVTQGDLELAVQCFFEALQLNPDLYCARSDLGNLLKAEGRLEEAKA  205 (966)
T ss_pred             -------------------------------HHHHHhcCCCcccHHHHHHHHhcCcchhhhhcchhHHHHhhcccchhHH
Confidence                                           3333444555556666666666666666666666666666666666655


Q ss_pred             HHHHhHHHHHHHhhccCCccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcccHHHHHHHHHH
Q 004622          361 EAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTE  440 (741)
Q Consensus       361 ~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~  440 (741)
                              ++.+.....|..+-+|..+|.++..+|+...|+..|+++++++|+.+++|+++|.+|...+.++.|+.+|.+
T Consensus       206 --------cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~r  277 (966)
T KOG4626|consen  206 --------CYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLR  277 (966)
T ss_pred             --------HHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHH
Confidence                    555555555555556666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHhCCCcHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHH
Q 004622          441 AIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAY  520 (741)
Q Consensus       441 ~l~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~  520 (741)
                      ++.+.|++..++.++|.+|+.+|..+-|+..|++++++.|+.++++.++|..+-..|+..+|..+|.+++.+.|+.+.++
T Consensus       278 Al~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam  357 (966)
T KOG4626|consen  278 ALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAM  357 (966)
T ss_pred             HHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHH
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCcccHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCcccHHHHHHHHHHHHHCCC
Q 004622          521 TYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQ  600 (741)
Q Consensus       521 ~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~  600 (741)
                      +++|.++..+|.+++|...|.++++..|+...+..+||.+|.++|++++|+.+|++++.+.|...+++.++|..|..+|+
T Consensus       358 ~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~  437 (966)
T KOG4626|consen  358 NNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGD  437 (966)
T ss_pred             HHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhh
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             hHHHHHHHHHhhhhcCCchHHHHHHHHHHHHHhCCCHHHHHHHHHhh---ccCCcccchhhHHH---HhcCCCchhHhhh
Q 004622          601 HKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPFIRRRLLCTRLL---KSTVSFAGLTLMEI---LIPSSRNIGAKDC  674 (741)
Q Consensus       601 ~~~A~~~~~~al~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~---~~~~~~~~~~l~~~---~~~~g~~~~A~~~  674 (741)
                      .+.|+..|.+++.++|.- .++ ..++|.+|...|+..+|+..|+..   ++..|.++.+++..   ...-.++++-...
T Consensus       438 v~~A~q~y~rAI~~nPt~-AeA-hsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~~k  515 (966)
T KOG4626|consen  438 VSAAIQCYTRAIQINPTF-AEA-HSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRMKK  515 (966)
T ss_pred             HHHHHHHHHHHHhcCcHH-HHH-HhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHHHH
Confidence            666666666666666654 444 566666666666666666544442   33333444444422   2233334444444


Q ss_pred             HHHHHhhh
Q 004622          675 IPRMYVKR  682 (741)
Q Consensus       675 ~~~~~~~~  682 (741)
                      +..+.+++
T Consensus       516 l~sivrdq  523 (966)
T KOG4626|consen  516 LVSIVRDQ  523 (966)
T ss_pred             HHHHHHHH
Confidence            44444433



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query741
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 9e-14
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-05
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 1e-09
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-08
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-07
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-04
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 2e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 3e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-04
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 6e-05
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 3e-04
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 4e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 9e-14, Method: Composition-based stats. Identities = 46/135 (34%), Positives = 71/135 (52%) Query: 449 GEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSA 508 EAW G A G+ EAI+ KALE +P SA+ + G +K D++ A+E Sbjct: 1 AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQK 60 Query: 509 CVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSE 568 ++LD + A+ LG A G+Y +A E + KA++LD EAW +L Y + + Sbjct: 61 ALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYD 120 Query: 569 KALECLQQVLYIDKR 583 +A+E Q+ L +D R Sbjct: 121 EAIEYYQKALELDPR 135
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query741
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-49
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-47
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-47
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-47
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-46
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-37
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-34
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-48
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-44
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-39
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-30
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-24
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-48
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-47
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-47
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-46
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-46
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-46
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-43
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-40
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-38
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-21
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-47
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-46
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-36
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-14
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-46
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-42
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-34
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-44
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-40
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-37
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-33
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-28
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-16
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-44
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-42
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-40
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-37
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-30
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-26
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-43
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-40
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-39
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-38
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-36
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-33
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-37
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-31
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-24
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-40
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-39
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-38
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-21
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-40
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-33
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-27
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-39
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-31
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-29
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-27
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-20
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-38
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-38
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-38
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-36
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-33
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-25
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-38
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-25
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-24
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-16
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-37
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-37
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-36
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-35
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-35
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-34
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-34
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-33
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-30
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-30
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-30
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-27
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-25
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-23
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-22
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-19
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-34
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-29
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-24
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-34
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-25
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-30
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-30
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-32
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-18
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-25
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-18
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-18
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-16
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-27
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-22
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-26
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-24
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-17
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-25
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-24
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-22
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-05
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-24
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-11
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-23
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-17
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-21
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-20
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-13
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-08
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 6e-21
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-20
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-18
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-15
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 8e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-14
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-17
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 9e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-16
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-13
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-16
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-13
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 7e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 4e-16
2kat_A115 Uncharacterized protein; NESG, structure, structur 4e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-16
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 4e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 6e-11
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 9e-16
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 8e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-15
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-15
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 9e-15
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 6e-15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 7e-13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 6e-11
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-15
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-15
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-14
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-13
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-10
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-14
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-10
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-14
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-10
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-14
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 7e-14
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 8e-13
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-11
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-10
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 5e-14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-11
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-11
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 7e-13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 9e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 9e-11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-12
2l6j_A111 TPR repeat-containing protein associated with HSP; 7e-12
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-08
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-12
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-10
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-11
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-10
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-04
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 5e-10
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-06
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-10
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 8e-10
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 8e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 8e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-10
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 9e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-10
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 5e-09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 7e-08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 7e-09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 5e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 8e-07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 4e-06
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 4e-08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 6e-07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 2e-07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 4e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 4e-07
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 6e-07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 4e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  176 bits (450), Expect = 3e-49
 Identities = 48/223 (21%), Positives = 90/223 (40%)

Query: 385 LSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTEAIQS 444
           +     +   G + +A     Q+ +++P     L+   +     R L+ +    T AI+ 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 445 NPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVE 504
           NP   EA+   G      G+  EAI+    AL  +P+  D             D   AV+
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 505 DLSACVKLDKENKSAYTYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDL 564
              + ++ + +     + LG  L ++G  ++A+  +LKAI+   NF  AW +L   +   
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 565 ANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQHKKAIKD 607
                A+   ++ + +D  F  AY   G +L       +A+  
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA 225


>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 741
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-31
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-28
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-27
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-21
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-19
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-13
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-19
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-15
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.003
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-16
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 5e-10
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-09
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-15
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 6e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-11
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-15
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-08
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-07
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-14
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-13
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 6e-05
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-07
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-10
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 2e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.003
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 8e-06
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 8e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-04
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 5e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.001
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.004
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-05
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 8e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  123 bits (309), Expect = 5e-31
 Identities = 42/250 (16%), Positives = 87/250 (34%)

Query: 350 FKWDMLKETSNEAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILK 409
                    +       K C  +  +++        + G     +G+   AI  F++ + 
Sbjct: 138 RSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVT 197

Query: 410 EDPMYPEALIGRGTARAFQRELEAAISDFTEAIQSNPSAGEAWKRRGQARAALGESVEAI 469
            DP + +A I  G      R  + A++ +  A+  +P+               G    AI
Sbjct: 198 LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAI 257

Query: 470 QDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAYTYLGLALSS 529
               +A+E +P+  D          +      A +  +  ++L   +  +   L      
Sbjct: 258 DTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE 317

Query: 530 IGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYH 589
            G  ++A   + KA+++   F  A  +L    Q     ++AL   ++ + I   F+ AY 
Sbjct: 318 QGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYS 377

Query: 590 LRGLLLHGLG 599
             G  L  + 
Sbjct: 378 NMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query741
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 100.0
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.92
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.92
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.91
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.91
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.77
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.76
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.75
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.75
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.74
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.73
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.7
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.69
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.69
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.68
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.66
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.61
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.57
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.53
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.47
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.45
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.42
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.37
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.13
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.12
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.12
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.07
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.33
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.14
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.08
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.96
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.62
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.47
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.13
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.02
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 80.25
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=293.86  Aligned_cols=383  Identities=16%  Similarity=0.125  Sum_probs=274.3

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHH
Q ss_conf             9999992189999999999998043-772459879999996024999999999999849997459999999999869999
Q 004622           42 ELAKLCSLRNWSKAIRILDSLLAQS-YEIQDICNRAFCYSQLELHKHVIRDCDKALQLDPTLLQAYILKGCAFSALGRKE  120 (741)
Q Consensus        42 ~~~~~~~~g~~~~Ai~~~~~al~~~-~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~  120 (741)
                      .+..+|+.|+|++|+..|+++++.+ .++..+..+|.+|.++|++++|+..++++++++|+++.+++.+|.++..+|+++
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99999986999999999999998689989999999999998699999999999999859998999999999964200022


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCCCCCCCHHHHHCCCCCCCCCC
Q ss_conf             99999999997459995999999999999999730000013667677541012111235668530122101588753455
Q 004622          121 EALSVWEKGYEHALHQSADLKQFLELEELLTAAKQDRSVTCEYDVSNSMSSLTVSESGLNANDKMSETSENHNKSDICDS  200 (741)
Q Consensus       121 ~A~~~~~~al~l~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  200 (741)
                      +|+..+..++..+|.... ...........                                                  
T Consensus        85 ~A~~~~~~~~~~~~~~~~-~~~~~~~~~~~--------------------------------------------------  113 (388)
T d1w3ba_          85 EAIEHYRHALRLKPDFID-GYINLAAALVA--------------------------------------------------  113 (388)
T ss_dssp             HHHHHHHHHHHHCTTCHH-HHHHHHHHHHH--------------------------------------------------
T ss_pred             CCCCCCCCCCCCCCCCCC-CCCCCCCCCCC--------------------------------------------------
T ss_conf             222222212112222222-22222222222--------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             77775420001267899898778742214999888434565567641000135999989998877777522236689986
Q 004622          201 SSQSRDVSETCSKSSHDPDLCNGRSDEAKGGSSVPVSKSGLHINGKLREVSENHNGSSDGSKSTHASRDASEINRQSSDD  280 (741)
Q Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  280 (741)
                                                                                                      
T Consensus       114 --------------------------------------------------------------------------------  113 (388)
T d1w3ba_         114 --------------------------------------------------------------------------------  113 (388)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCHHCHHHHHH
Q ss_conf             65578987776542222456788647898524478724991048999998650079980069999999971330899789
Q 004622          281 FDICNGPIDKASVNERHGRQTNGTHDVHDKLSSDSASLNDSNTNSESYSKSSISDNKSSDSTESRSKLSFKWDMLKETSN  360 (741)
Q Consensus       281 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~la~~~~~~g~~~~a~~  360 (741)
                                                           ...+..+...........                         
T Consensus       114 -------------------------------------~~~~~~~~~~~~~~~~~~-------------------------  131 (388)
T d1w3ba_         114 -------------------------------------AGDMEGAVQAYVSALQYN-------------------------  131 (388)
T ss_dssp             -------------------------------------HSCSSHHHHHHHHHHHHC-------------------------
T ss_pred             -------------------------------------CCCCCCCCCCCCCCCCCC-------------------------
T ss_conf             -------------------------------------222222222211122222-------------------------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             99975889998731048853999999999999819999999999999996999899999999999982369999999999
Q 004622          361 EAKRNKKFCVTRISKSKSISVDFRLSRGIAQVNEGKYASAISIFDQILKEDPMYPEALIGRGTARAFQRELEAAISDFTE  440 (741)
Q Consensus       361 ~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~  440 (741)
                                       +.........+......+....+...+.+.+...|..+.++..+|.++...+++++|...+.+
T Consensus       132 -----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~  194 (388)
T d1w3ba_         132 -----------------PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEK  194 (388)
T ss_dssp             -----------------TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             -----------------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             -----------------222222222222221100013567888874025861068998636301024719999999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             99819990999999999999839919999999999821999999999999999975999999999999997178999999
Q 004622          441 AIQSNPSAGEAWKRRGQARAALGESVEAIQDLSKALEFEPNSADILHERGIVNFKFKDFNAAVEDLSACVKLDKENKSAY  520 (741)
Q Consensus       441 al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~  520 (741)
                      ++..+|++..++..+|.++...|++++|+..+.++....|.....+..+|.++...|++++|+..++++++.+|+++.++
T Consensus       195 al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~  274 (388)
T d1w3ba_         195 AVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAY  274 (388)
T ss_dssp             HHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHH
T ss_pred             HHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             99849464999999715522005299999999985777554799999999999987899999999999998499989999


Q ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC
Q ss_conf             99999999819999999999999971804099999999999991892999999999993185529999999999998899
Q 004622          521 TYLGLALSSIGEYKKAEEAHLKAIQLDRNFLEAWGHLTQFYQDLANSEKALECLQQVLYIDKRFSKAYHLRGLLLHGLGQ  600 (741)
Q Consensus       521 ~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~  600 (741)
                      ..+|.++...|++++|+..++.++...|.....+..++.++...|++++|+..++++++..|+++.++..+|.++...|+
T Consensus       275 ~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~  354 (388)
T d1w3ba_         275 CNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGK  354 (388)
T ss_dssp             HHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999748799999999865404873001015799999987899999999999998688989999999999998599


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             599999999846304984389999999999985989
Q 004622          601 HKKAIKDLSSGSRTMMPHLIWNLTRWRNLCFNAWPF  636 (741)
Q Consensus       601 ~~~A~~~~~~al~~~p~~~~~~~~~~la~~~~~~g~  636 (741)
                      +++|+..|+++++++|++ ... +..+|.++..+||
T Consensus       355 ~~~A~~~~~~al~l~P~~-~~a-~~~lg~~~~~~~D  388 (388)
T d1w3ba_         355 LQEALMHYKEAIRISPTF-ADA-YSNMGNTLKEMQD  388 (388)
T ss_dssp             CHHHHHHHHHHHTTCTTC-HHH-HHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHHCCCC-HHH-HHHHHHHHHHCCC
T ss_conf             999999999999709998-999-9999999998589



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure