Citrus Sinensis ID: 004662

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------74
MAEGGGKVLYIAVMDEEEKAEQANNSAAAAASFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPGSCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIRPEVGSSAAELISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKAWPVTSVDSNGKPILVTGTEERMGNPMYGPLKIGKAESVNLQFGHFGISAWISDGCTSHAGSVDESRAETDCGSRNHSSCCSSPRMSDGHSKELKEEQSVHGSDEEVDDPLEADSDEDLSDKTDEQALEEIGSVDEESKSDEEYDDLAMQDTQGSGYLSDAEEEFKEKMVPVTEAQTPNMRGEKYSQNLDRFLRTRSEQLPETFCPYSPPRTEKNERKLIPSGNRRVRKRSLSISALGKHGAITSDPILSGGPQR
cccccccEEEEEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccEEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHcccEEEccHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHcccccccccccHHcccHHHcccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHcEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHcHccccccccccccccccccccccHHccccHHHHHHHcccEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHcccccEEcHHHHHHHHHHHccHcccccHHHcHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcHHHHHHHHHHHcccccHHHHHHHccccHHHHHEEcccccccEccEEcccccccccccccccccccccccccccEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHcccccccccccHHHHHHHHHHHcHcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccc
MAEGGGKVLYIAVMDEEEKAEQANNSAAAAAsfrytrpvLQSTLQLMGCKARHAFKISQRVFKMIrtesptsahhqegaevfgshclkgnlekddgcnpgscfckeevsesgdrskripfelykrrttvviSRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLcgtsgcgkSTLSALLGSRLGITTVISTDSIRHMMRSFvdekqnpllwastyhagefldpDAVAEAKAKKHARKLAGAalsvpkdeasnssatgksdirpevgssaaelispkqMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLmkkhpsiipFMIYITNEDKHMERFAVRAKymtldpaknkYVKYIRNIRTIQDYLCQRadkhlvpkinntnvdkSVAAIHATVFSCLrrreggeqlydpttnTVTVIAEEYRNQcaahslssKGMFQLIQRKGSSRHLMALLNTdgsvakawpvtsvdsngkpilvtgteermgnpmygplkigkaesvnlqfghfgisawisdgctshagsvdesraetdcgsrnhssccssprmsdghskelkeeqsvhgsdeevddpleadsdedlsdktDEQALEEIgsvdeesksdeeyddlamqdtqgsgylsdAEEEFkekmvpvteaqtpnmrgekySQNLDRFLRTrseqlpetfcpyspprteknerklipsgnrrvrKRSLSISAlgkhgaitsdpilsggpqr
MAEGGGKVLYIAVMDEEEKAEQANNSAAAAASFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPGSCFCkeevsesgdrskripfelykrrttvvisretFIDVVCDALTEykyvghnqraDLVLACRIRERKESVTvllcgtsgcgkstlsallgsrlgiTTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDAVAEAKAKKHARKLAgaalsvpkdeasnssatgksdirpevGSSAAELISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKymtldpaknkyvKYIRNIRTIQDYLCQRADKHLVPkinntnvdksvAAIHATVFSCLrrreggeqlydptTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGsvakawpvtsvdsngkpilvtgteermgnPMYGPLKIGKAESVNLQFGHFGISAWISDGCTSHAGSVDESRaetdcgsrnhssccssprmsdghsKELKEEqsvhgsdeevddpleadsdedlsdktDEQALeeigsvdeesksdeeyDDLAMQDTQGSGYLSDAEEEFKEKmvpvteaqtpnmrgekySQNLDRFLRTRSEQlpetfcpyspprteknerklipsgnrrvrkrslsisalgkhgaitsdpilsggpqr
MAEGGGKVLYIAVMDeeekaeqannsaaaaasFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPGSCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIRPEVGSSAAELISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKAWPVTSVDSNGKPILVTGTEERMGNPMYGPLKIGKAESVNLQFGHFGISAWISDGCTSHAGSVDESRAETDCGSRNHSSCCSSPRMSDGHSKELKEEQSVHGSDEEVDDPLEADSDEDLSDKTDEQALEEIGsvdeesksdeeyddLAMQDTQGSGYLSDAEEEFKEKMVPVTEAQTPNMRGEKYSQNLDRFLRTRSEQLPETFCPYSPPRTEKNERKLIPSGNRRVRKRSLSISALGKHGAITSDPILSGGPQR
*******VLYIAV*****************ASFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIR**************VFGSHCLKGNLE***GCNPGSCFC************RIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDP**********************************************************GFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKAWPVTSVDSNGKPILVTGTEERMGNPMYGPLKIGKAESVNLQFGHFGISAWISDGCT******************************************************************************************************************************************************************************************************
*****GK**YIAVM***********************PVLQSTLQLMGCKARHAFKISQRVFKMI*************************************************************TTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPD******************************************************AIEGFKAQSEMVIDSLDRL**********VVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRA**********KYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRRE*****YDPTTNTVTVIAEEYRNQCAA******G***LIQRKGSSRHLMALLNTDGSVAKAWPVTS*****************************AESVNLQFGHFGISAWI**************************************************************************************************DTQ***********************************LDR*L**************************************************T****L******
MAEGGGKVLYIAVMDEE************AASFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPGSCFCK*********SKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDAVA***********AGAAL************************SAAELISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKAWPVTSVDSNGKPILVTGTEERMGNPMYGPLKIGKAESVNLQFGHFGISAWISDGCTS**************************************************************DKTDEQALEEI************YDDLAMQDTQGSGYLSDAEEEFKEKMVPVTEAQTPNMRGEKYSQNLDRFLRTRSEQLPETFCPYSPPRTEKNERKLIPSGNRRVRKRSLSISALGKHGAITSDPILSGGPQR
***GGGKVLYIAVMDEE**************SFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKG*********PGSCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDA***********************************************ISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKAWPVTSVDSNGKP*********MGNPMYGPLKIGKAESVNLQFGHFGISAWI***************************************************************************************SDEEYDDLAMQDTQGSGYLSD********************RGEKYSQNLDRFLRTRSEQLPETF***************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEGGGKVLYIAVMDEEEKAEQANNSAAAAASFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPGSCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIRPEVGSSAAELISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKAWPVTSVDSNGKPILVTGTEERMGNPMYGPLKIGKAESVNLQFGHFGISAWISDGCTSHAGSVDESRAETDCGSRNHSSCCSSPRMSDGHSKELKEEQSVHGSDEEVDDPLEADSDEDLSDKTDEQALEEIGSVDEESKSDEEYDDLAMQDTQGSGYLSDAEEEFKEKMVPVTEAQTPNMRGEKYSQNLDRFLRTRSEQLPETFCPYSPPRTEKNERKLIPSGNRRVRKRSLSISALGKHGAITSDPILSGGPQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query738 2.2.26 [Sep-21-2011]
Q8T1P1839 Uncharacterized protein D yes no 0.512 0.450 0.385 3e-81
Q8TGY9327 2-phosphoglycerate kinase yes no 0.287 0.648 0.287 2e-24
Q58877309 2-phosphoglycerate kinase yes no 0.279 0.666 0.259 2e-17
A9A9N2313 2-phosphoglycerate kinase yes no 0.261 0.616 0.283 1e-16
A6UQ76313 2-phosphoglycerate kinase yes no 0.276 0.651 0.282 2e-16
Q5JDW9290 2-phosphoglycerate kinase yes no 0.291 0.741 0.276 3e-16
A4FW93313 2-phosphoglycerate kinase yes no 0.261 0.616 0.271 5e-16
O27911306 2-phosphoglycerate kinase yes no 0.280 0.676 0.259 7e-16
Q6LXC1312 2-phosphoglycerate kinase yes no 0.276 0.653 0.263 9e-16
A6VH17312 2-phosphoglycerate kinase yes no 0.261 0.618 0.271 1e-15
>sp|Q8T1P1|Y3453_DICDI Uncharacterized protein DDB_G0273453/DDB_G0273565 OS=Dictyostelium discoideum GN=DDB_G0273453 PE=4 SV=2 Back     alignment and function desciption
 Score =  303 bits (777), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 167/433 (38%), Positives = 251/433 (57%), Gaps = 55/433 (12%)

Query: 34  RYTRPVLQSTLQLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLEK 93
           RY R  L  TL+ MGCK+ HA +IS  VF+ +  +     + Q  A    +     ++ K
Sbjct: 124 RYARFHLNLTLKFMGCKSIHARQISNTVFEQLE-KCRIEQNKQLTATNNNAIVTTDSITK 182

Query: 94  DDGCNPGSCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHN 153
            +     +       + +   +   P  +Y     V I R  F  ++   L+ Y+Y    
Sbjct: 183 TEQSTTTTTTTTTTTTTTTATTTTQP-PIY----CVSIQRNIFYYIIGHILSCYQYSKPQ 237

Query: 154 QRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFV 213
              D  ++C ++++K S T+LL GTSGCGKSTL+ALL SR+G T VISTD+IR ++R F+
Sbjct: 238 YIIDFPVSCEVQDKKHSFTILLGGTSGCGKSTLTALLASRIGFTAVISTDNIRQLLRKFI 297

Query: 214 DEKQNPLLWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIR 273
             +++P+LWASTYHAGE +                             SN S        
Sbjct: 298 SRQESPILWASTYHAGEII-----------------------------SNPS-------- 320

Query: 274 PEVGSSAAELISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMG 333
                     +S K+  ++G++AQ+EM+ + LD LI  +E+R ES++VEGVHL    ++ 
Sbjct: 321 ----------LSHKEKILQGYEAQNEMIFNKLDILIGHYEKRKESLIVEGVHLDTKLILR 370

Query: 334 LMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRAD 393
           L+KKHPS IPF++YI+NE KH ERFA+R+KYMTLDP +NKY KY +NIR I D+LC  AD
Sbjct: 371 LVKKHPSCIPFLMYISNEAKHKERFAIRSKYMTLDPHQNKYTKYFKNIRIINDHLCHGAD 430

Query: 394 KHLVPKINNTNVDKSVAAIHATVFSCLRRR-EGGEQLYDPTTNTVTVIAEEYRNQCAAHS 452
           +H++P+I+NT++D+S+A IH T+F+CL+R+ + GE  Y+  T+ + ++  +Y  Q     
Sbjct: 431 EHMIPQIDNTSIDRSLATIHGTIFACLKRKVQCGESYYNHETDKMNMLYNQYE-QIQHQF 489

Query: 453 LSSKGMFQLIQRK 465
            SSKGM +LIQ+K
Sbjct: 490 WSSKGMLRLIQKK 502

Dictyostelium discoideum (taxid: 44689)
>sp|Q8TGY9|PGK2_METKA 2-phosphoglycerate kinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|Q58877|PGK2_METJA 2-phosphoglycerate kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|A9A9N2|PGK2_METM6 2-phosphoglycerate kinase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|A6UQ76|PGK2_METVS 2-phosphoglycerate kinase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|Q5JDW9|PGK2_PYRKO 2-phosphoglycerate kinase OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|A4FW93|PGK2_METM5 2-phosphoglycerate kinase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|O27911|PGK2_METTH 2-phosphoglycerate kinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|Q6LXC1|PGK2_METMP 2-phosphoglycerate kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=pgk2 PE=3 SV=1 Back     alignment and function description
>sp|A6VH17|PGK2_METM7 2-phosphoglycerate kinase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pgk2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query738
255587268716 conserved hypothetical protein [Ricinus 0.955 0.984 0.736 0.0
224132008738 predicted protein [Populus trichocarpa] 0.986 0.986 0.745 0.0
224104683729 predicted protein [Populus trichocarpa] 0.975 0.987 0.743 0.0
356539336704 PREDICTED: uncharacterized protein DDB_G 0.943 0.988 0.704 0.0
356542650704 PREDICTED: uncharacterized protein DDB_G 0.943 0.988 0.702 0.0
225436536723 PREDICTED: uncharacterized protein DDB_G 0.955 0.975 0.724 0.0
297734942704 unnamed protein product [Vitis vinifera] 0.936 0.981 0.719 0.0
449456152 873 PREDICTED: uncharacterized protein LOC10 0.962 0.813 0.672 0.0
449496276823 PREDICTED: uncharacterized LOC101212242 0.962 0.862 0.671 0.0
358346941753 Mutant low phytic acid protein [Medicago 0.953 0.934 0.663 0.0
>gi|255587268|ref|XP_002534208.1| conserved hypothetical protein [Ricinus communis] gi|223525703|gb|EEF28172.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/736 (73%), Positives = 606/736 (82%), Gaps = 31/736 (4%)

Query: 6   GKVLYIAVMDEEEKAEQANNSAAAAASFRYTRPVLQSTLQLMGCKARHAFKISQRVFKMI 65
            K+LYI V+D EEK ++         SFRYTRPVLQSTLQLMGCKARHAFKISQRVF+++
Sbjct: 9   AKLLYIVVVDAEEKGKE---------SFRYTRPVLQSTLQLMGCKARHAFKISQRVFELM 59

Query: 66  RTESPTSAHHQEGAEVFGSHCLKGNLEKDDGCNPGSCFCKEEVSESGDRSKRIPFELYKR 125
           R+ES + A   +  EV G    KGN  K+                    +K +PFELYKR
Sbjct: 60  RSESSSDALLPK-LEVTGVDISKGNEWKEFS------------------TKSLPFELYKR 100

Query: 126 RTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKST 185
           RTTV++ RE F++VVC++LTEYKYVG NQRADLVLACRIRERKESVTVLLCGTSGCGKST
Sbjct: 101 RTTVIVRREAFLNVVCESLTEYKYVGPNQRADLVLACRIRERKESVTVLLCGTSGCGKST 160

Query: 186 LSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDAVAEAKAKKH 245
           LSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGE+LDP AVAEAKAKK 
Sbjct: 161 LSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEYLDPVAVAEAKAKKK 220

Query: 246 ARKLAGAALSVPKDEASNSSATGKSDIR-PEVGSSAAELISPKQMAIEGFKAQSEMVIDS 304
           A+KLA    +  KDE  + S   K+D + P++GSS  ELISPKQMA+EGFKAQSEMVIDS
Sbjct: 221 AKKLASIPNARHKDEEYDGSTMVKADSQAPDMGSSITELISPKQMAVEGFKAQSEMVIDS 280

Query: 305 LDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKY 364
           L RLITAWEER ESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKH+ERFAVRAKY
Sbjct: 281 LHRLITAWEERKESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHLERFAVRAKY 340

Query: 365 MTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAAIHATVFSCLRRRE 424
           MTLDPAKNKYVKYIRNIRTIQDYLC+RADKHLVPKINNTNVDKSVAAIHATVFSCLRRRE
Sbjct: 341 MTLDPAKNKYVKYIRNIRTIQDYLCKRADKHLVPKINNTNVDKSVAAIHATVFSCLRRRE 400

Query: 425 GGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHLMALLNTDGSVAKA 484
            GE LYDPTT+TV V+ EEYRNQCAA+SLSSKGMFQLIQRKGS RHLMAL+NTDGSVAKA
Sbjct: 401 TGEPLYDPTTHTVAVVDEEYRNQCAANSLSSKGMFQLIQRKGSFRHLMALVNTDGSVAKA 460

Query: 485 WPVTSVDSNGKPILVTGTEERMGNPMYGPLKIGKAESVNLQFGHFGISAWISDGCTSHAG 544
           WPV +VDS+GKP+L  G +  +G PMYGPL+IGKAE VNLQFGHFGISAW SDG TSHAG
Sbjct: 461 WPVDTVDSSGKPVLGYGIDNCIGIPMYGPLQIGKAEPVNLQFGHFGISAWPSDGGTSHAG 520

Query: 545 SVDESRAE-TDCGSRNHSSCCSSPRMSDGHSKELKEEQSVHGSDEEVDDPLEADSDEDLS 603
           SVDESRA+ TD GS+ HSSCCSSPRMSDG SKELKEEQSVHGSDEEVDDP E DSDED S
Sbjct: 521 SVDESRADWTDTGSKYHSSCCSSPRMSDGPSKELKEEQSVHGSDEEVDDPPEVDSDEDFS 580

Query: 604 DKTDEQALEEIGSVDEES-KSDEEYDDLAMQDTQGSGYLSDAEEEFKEKMVPVTEAQTPN 662
           D  D+   EEIGSVDEES KSDEEYDDLAMQD Q +GY SD ++E K+K+ P++  ++  
Sbjct: 581 DDGDQHVHEEIGSVDEESTKSDEEYDDLAMQDVQENGYWSDDDDESKDKVAPISGGRSSP 640

Query: 663 MRGEKYSQNLDRFLRTRSEQLPETFCPYSPPRTEKNERKLIPSGNRRVRKRSLSISALGK 722
           ++G+KY QNLDRFLRTRSE L E  C YS    EK  R++  SG+ ++R+RSLSI A+GK
Sbjct: 641 LKGDKYMQNLDRFLRTRSEPLAEPLCAYSSLLAEKGGRRMSNSGSGKMRRRSLSIPAIGK 700

Query: 723 HGAITSDPILSGGPQR 738
           HG+  + PILSG P R
Sbjct: 701 HGSEVAGPILSGAPHR 716

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132008|ref|XP_002328162.1| predicted protein [Populus trichocarpa] gi|222837677|gb|EEE76042.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104683|ref|XP_002313526.1| predicted protein [Populus trichocarpa] gi|222849934|gb|EEE87481.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356539336|ref|XP_003538154.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like [Glycine max] Back     alignment and taxonomy information
>gi|356542650|ref|XP_003539779.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like [Glycine max] Back     alignment and taxonomy information
>gi|225436536|ref|XP_002277270.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734942|emb|CBI17176.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456152|ref|XP_004145814.1| PREDICTED: uncharacterized protein LOC101212242 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449496276|ref|XP_004160091.1| PREDICTED: uncharacterized LOC101212242 [Cucumis sativus] Back     alignment and taxonomy information
>gi|358346941|ref|XP_003637522.1| Mutant low phytic acid protein [Medicago truncatula] gi|355503457|gb|AES84660.1| Mutant low phytic acid protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query738
TAIR|locus:2159270738 AT5G60760 "AT5G60760" [Arabido 0.963 0.963 0.634 9.6e-231
TAIR|locus:2096865717 AT3G45090 [Arabidopsis thalian 0.811 0.835 0.670 1.7e-208
DICTYBASE|DDB_G0273565839 DDB_G0273565 "unknown" [Dictyo 0.245 0.215 0.502 4e-80
DICTYBASE|DDB_G0273453839 DDB_G0273453 "unknown" [Dictyo 0.245 0.215 0.502 4e-80
TAIR|locus:2159270 AT5G60760 "AT5G60760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2226 (788.7 bits), Expect = 9.6e-231, P = 9.6e-231
 Identities = 477/752 (63%), Positives = 561/752 (74%)

Query:     7 KVLYIAVMDXXXXXXXXXXXXXXX--XXFRYTRPVLQSTLQLMGCKARHAFKISQRVFKM 64
             KV+YI V+D                   FRYTRPVLQSTLQLMGCKARHAFKIS+RVF++
Sbjct:     6 KVMYIVVVDGTDTAETVEEDGTGTWKDSFRYTRPVLQSTLQLMGCKARHAFKISRRVFEL 65

Query:    65 IRTE-----SPT-SAHHQEGAEV--FGSHCLKGNLEKDDGCNPGSCFCKEEVSESGDRSK 116
             IR+E     SP+ S  H + +E    G      N+EK    N  +    ++V    D+SK
Sbjct:    66 IRSEGSLILSPSLSPSHSKESEFQKTGDASACANVEK---ANKVNSLATDDV----DKSK 118

Query:   117 RIPFELYKRRTTVVISRETFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLC 176
               PFE+YKRRTTVV+SRE F++VVCDAL EYKYVGH+QRADL+L+CRIRERKESVTVLLC
Sbjct:   119 SKPFEVYKRRTTVVVSREIFVNVVCDALAEYKYVGHDQRADLILSCRIRERKESVTVLLC 178

Query:   177 GTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLWASTYHAGEFLDPDA 236
             GTSGCGKSTLSALLGSRLGITTV+STDSIRHMMRSFVDEKQNPLLWASTYHAGE+LDP A
Sbjct:   179 GTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFVDEKQNPLLWASTYHAGEYLDPVA 238

Query:   237 VAEAKAKKH-ARKLAGAALSVPKDEASNSSATGKSDI--RPEVGSS--AAELISPKQMAI 291
             VAE+KA++  A+K+     S+ +DE + +S  GK+    + +VGS+     L+SPKQMA+
Sbjct:   239 VAESKARRRRAKKMD----SI-EDEKAKASEGGKAKNTQQTDVGSTKNTPVLLSPKQMAV 293

Query:   292 EGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNE 351
             EGFKAQSEMVID+LDRLITAWEER ESV+VEGVHLSLNFVMGLMKKHPSI+PFM+YI NE
Sbjct:   294 EGFKAQSEMVIDNLDRLITAWEERKESVIVEGVHLSLNFVMGLMKKHPSIVPFMVYIANE 353

Query:   352 DKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPKINNTNVDKSVAA 411
             +KH+ERFAVRAKYMTLDP KNKYVKYIRNIRTIQDYLC+RADKHLVPKINNTNVDKSVAA
Sbjct:   354 EKHLERFAVRAKYMTLDPEKNKYVKYIRNIRTIQDYLCKRADKHLVPKINNTNVDKSVAA 413

Query:   412 IHATVFSCLRRREGGEQLYDPTTNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKGSSRHL 471
             IHATVFSCLRRRE GE LYD TTNTV+VI +EYRNQC A+SLSSKGMFQLIQRKGSSRHL
Sbjct:   414 IHATVFSCLRRREAGEHLYDATTNTVSVIDDEYRNQCTANSLSSKGMFQLIQRKGSSRHL 473

Query:   472 MALLNTDGSVAKAWPVTS-VDSNGKPILVTGTEERMG--NPMYGPLKIGKAESVNLQFGH 528
             MALLNTDG+ A+ WPVT  VD +GKP+      E  G  +P+YG L+  KAE VNLQFG 
Sbjct:   474 MALLNTDGTFARTWPVTGKVDESGKPVFCNEMIEENGMEHPVYGYLQ--KAEPVNLQFGL 531

Query:   529 FGISAWISDGCTSHAGSVDESRAE-TDCGSRNHSSCCSSPRMSDGHSKELKEEQSVHGSD 587
             FGISAW SDG TS AGSVD+ +A+  +  SR +SSCCSSPRMS+G SKELKE+QSVHGSD
Sbjct:   532 FGISAWPSDGATSRAGSVDDCKADMAETSSRYYSSCCSSPRMSEGTSKELKEDQSVHGSD 591

Query:   588 EEV-DDPLEADSDEDLSDKTDEQALEEIGXXXXXXXXXXXXXX-LAMQDTQGSGYLSDAE 645
             EEV DDP E D+D   SD  +++  +E+G               LAM+D     Y +D E
Sbjct:   592 EEVEDDPPEPDTD--FSDDDNKRDHDEVGSVDEQSTKSDEEYDDLAMED---KSYWTDEE 646

Query:   646 EEFKEKMVPVTEAQTPNMRGE-KYSQNLDRFLRTRSEQLPETFCPYSPPRTEKNERKLIP 704
             EE ++ +  ++E        E KY QNLD FLRT ++QL E     +   T +N    + 
Sbjct:   647 EESRDTIAIMSEKNNKQATKEDKYIQNLDLFLRTANQQLVEPLQLCASLLTCENGNTRLW 706

Query:   705 SGNRRVRKRSLSISALGKHGAITSDPILSGGP 736
              G  ++RKRSLSISA+GKHG+   D IL G P
Sbjct:   707 LGKEKMRKRSLSISAIGKHGSGLGDAILLGAP 738
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=IMP
TAIR|locus:2096865 AT3G45090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273565 DDB_G0273565 "unknown" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273453 DDB_G0273453 "unknown" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
3rd Layer2.7.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_66000265
hypothetical protein (738 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query738
COG2074299 COG2074, COG2074, 2-phosphoglycerate kinase [Carbo 1e-41
PRK04220301 PRK04220, PRK04220, 2-phosphoglycerate kinase; Pro 2e-36
PRK12337475 PRK12337, PRK12337, 2-phosphoglycerate kinase; Pro 3e-23
PRK12338319 PRK12338, PRK12338, hypothetical protein; Provisio 2e-20
PRK12339197 PRK12339, PRK12339, 2-phosphoglycerate kinase; Pro 2e-14
pfam13207114 pfam13207, AAA_17, AAA domain 2e-05
pfam13671143 pfam13671, AAA_33, AAA domain 5e-04
>gnl|CDD|224985 COG2074, COG2074, 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score =  153 bits (388), Expect = 1e-41
 Identities = 78/253 (30%), Positives = 120/253 (47%), Gaps = 56/253 (22%)

Query: 163 RIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRSFVDEKQNPLLW 222
           RIR+ K  + +L+ G SG GKST++  L  RLGI +VISTDSIR ++R  +  +  P L 
Sbjct: 82  RIRKMKRPLIILIGGASGVGKSTIAGELARRLGIRSVISTDSIREVLRKIISPELLPTLH 141

Query: 223 ASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIRPEVGSSAAE 282
            S+Y A + L                                                  
Sbjct: 142 TSSYDAWKALRDP----------------------------------------------- 154

Query: 283 LISPKQMAIEGFKAQSEMVIDSLDRLITAWEERNESVVVEGVHLSLNFVMGLMKK---HP 339
             + +   I GF+ Q+  V+  ++ +I    E  E +++EGVH     V GL+K+     
Sbjct: 155 --TDENPIIAGFEDQASAVMVGIEAVIERAIEEGEDLIIEGVH----LVPGLIKEEALGN 208

Query: 340 SIIPFMIYITNEDKHMERFAVRAKYMTLDPAKNKYVKYIRNIRTIQDYLCQRADKHLVPK 399
           ++  FM+YI +E+ H ERF  R +Y        +Y++Y + IRTI DYL +RA +H VP 
Sbjct: 209 NVFMFMLYIADEELHRERFYDRIRYTHASRPGGRYLEYFKEIRTIHDYLVERAREHGVPV 268

Query: 400 INNTNVDKSVAAI 412
           I N ++D++V  I
Sbjct: 269 IENDDIDETVDRI 281

Length = 299
>gnl|CDD|179793 PRK04220, PRK04220, 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>gnl|CDD|183452 PRK12337, PRK12337, 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237066 PRK12338, PRK12338, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|105560 PRK12339, PRK12339, 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 738
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK12337475 2-phosphoglycerate kinase; Provisional 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.98
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.98
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.98
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.98
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.98
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.98
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.98
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.98
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.98
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.98
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.98
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.98
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.98
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.98
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.98
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.98
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.98
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.98
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.98
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.98
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.98
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.98
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.97
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.97
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.97
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.97
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.97
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03234226 ABCG_White The White subfamily represents ABC tran 99.97
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.97
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.97
COG1123539 ATPase components of various ABC-type transport sy 99.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.97
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.97
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.97
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.97
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.97
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.97
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.97
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.97
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.97
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.97
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.97
PRK04220301 2-phosphoglycerate kinase; Provisional 99.97
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.97
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.97
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.97
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.97
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.97
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.97
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.97
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.97
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.97
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.97
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.97
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 99.97
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.97
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.97
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.97
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.97
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.97
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.97
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.97
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.97
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.97
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.97
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.97
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.97
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.97
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.97
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.97
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.97
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.97
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.96
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.96
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.96
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.96
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.96
COG4559259 ABC-type hemin transport system, ATPase component 99.96
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.96
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.96
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.96
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.96
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.96
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.96
cd03246173 ABCC_Protease_Secretion This family represents the 99.96
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.96
PRK13545549 tagH teichoic acids export protein ATP-binding sub 99.96
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.96
PLN03211659 ABC transporter G-25; Provisional 99.96
COG4172534 ABC-type uncharacterized transport system, duplica 99.96
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.96
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.96
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.96
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.96
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.96
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.96
PRK13409590 putative ATPase RIL; Provisional 99.96
PRK10938490 putative molybdenum transport ATP-binding protein 99.96
PRK10535648 macrolide transporter ATP-binding /permease protei 99.96
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.96
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.96
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.96
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.96
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.96
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.96
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.96
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.96
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.96
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.96
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.95
COG4136213 ABC-type uncharacterized transport system, ATPase 99.95
COG4619223 ABC-type uncharacterized transport system, ATPase 99.95
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.95
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.95
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.95
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.95
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.95
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.95
COG4586325 ABC-type uncharacterized transport system, ATPase 99.95
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.95
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.95
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.95
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.95
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.95
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.95
PRK11147635 ABC transporter ATPase component; Reviewed 99.95
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.95
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.95
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.95
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.95
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.95
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.95
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.95
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.95
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.95
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.95
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.95
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.94
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.94
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.94
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.94
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.94
PRK13409590 putative ATPase RIL; Provisional 99.94
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.94
PRK11147635 ABC transporter ATPase component; Reviewed 99.94
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.94
PLN031401470 ABC transporter G family member; Provisional 99.94
COG4988559 CydD ABC-type transport system involved in cytochr 99.94
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.94
KOG0061613 consensus Transporter, ABC superfamily (Breast can 99.94
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.94
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.94
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.94
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.94
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.94
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.94
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.94
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.93
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.93
PLN03073718 ABC transporter F family; Provisional 99.93
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.93
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.93
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.93
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.93
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.93
COG4987573 CydC ABC-type transport system involved in cytochr 99.93
COG0488530 Uup ATPase components of ABC transporters with dup 99.93
PLN032321495 ABC transporter C family member; Provisional 99.93
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.93
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.93
PLN031301622 ABC transporter C family member; Provisional 99.92
PLN03140 1470 ABC transporter G family member; Provisional 99.92
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.92
PTZ002431560 ABC transporter; Provisional 99.92
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.92
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.92
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.92
PLN03073718 ABC transporter F family; Provisional 99.92
COG4133209 CcmA ABC-type transport system involved in cytochr 99.92
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.92
PLN03232 1495 ABC transporter C family member; Provisional 99.91
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.91
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.91
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.91
PLN03130 1622 ABC transporter C family member; Provisional 99.9
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.9
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.9
PTZ00243 1560 ABC transporter; Provisional 99.9
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.89
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.89
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.87
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.87
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.87
COG0488530 Uup ATPase components of ABC transporters with dup 99.87
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.86
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.86
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.85
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.85
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 99.84
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.83
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.83
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.83
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.81
KOG00541381 consensus Multidrug resistance-associated protein/ 99.79
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.78
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.78
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.77
COG4178604 ABC-type uncharacterized transport system, permeas 99.77
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.76
PRK12338319 hypothetical protein; Provisional 99.76
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.75
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.75
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.75
PRK12339197 2-phosphoglycerate kinase; Provisional 99.75
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.74
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.74
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.71
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.69
KOG0062582 consensus ATPase component of ABC transporters wit 99.69
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.65
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.64
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.61
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.61
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.6
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.56
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.55
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.52
KOG0062582 consensus ATPase component of ABC transporters wit 99.51
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.51
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.5
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.5
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.46
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.46
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.42
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.42
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.38
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.36
PRK006351809 excinuclease ABC subunit A; Provisional 99.35
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.35
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.27
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.25
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.18
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.18
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.18
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.1
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 99.05
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.94
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.92
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.81
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.8
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.77
PRK00409782 recombination and DNA strand exchange inhibitor pr 98.75
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.71
PRK13695174 putative NTPase; Provisional 98.7
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 98.68
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.66
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.57
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 98.57
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.54
PHA02562562 46 endonuclease subunit; Provisional 98.52
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.52
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.47
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.47
PRK102461047 exonuclease subunit SbcC; Provisional 98.46
PRK03918880 chromosome segregation protein; Provisional 98.41
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.41
COG3910233 Predicted ATPase [General function prediction only 98.38
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.36
TIGR00634563 recN DNA repair protein RecN. All proteins in this 98.32
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.25
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.25
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.23
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.2
PRK09825176 idnK D-gluconate kinase; Provisional 98.2
smart00382148 AAA ATPases associated with a variety of cellular 98.19
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.17
PRK01156895 chromosome segregation protein; Provisional 98.15
PRK07196434 fliI flagellum-specific ATP synthase; Validated 98.13
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.11
PRK06315442 type III secretion system ATPase; Provisional 98.09
PRK13830818 conjugal transfer protein TrbE; Provisional 98.09
cd01128249 rho_factor Transcription termination factor rho is 98.08
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.06
PRK10869553 recombination and repair protein; Provisional 98.06
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.05
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.02
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.92
PRK06067234 flagellar accessory protein FlaH; Validated 97.84
PRK02224880 chromosome segregation protein; Provisional 97.8
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 97.76
PF1355562 AAA_29: P-loop containing region of AAA domain 97.76
PRK00454196 engB GTP-binding protein YsxC; Reviewed 97.72
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.71
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.71
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.69
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.68
PRK06002450 fliI flagellum-specific ATP synthase; Validated 97.63
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.58
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.58
PRK10416318 signal recognition particle-docking protein FtsY; 97.5
PRK05480209 uridine/cytidine kinase; Provisional 97.5
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 97.47
PLN02318656 phosphoribulokinase/uridine kinase 97.45
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.45
PRK00300205 gmk guanylate kinase; Provisional 97.44
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 97.42
TIGR026801353 conserved hypothetical protein TIGR02680. Members 97.4
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 97.4
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.39
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.39
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 97.39
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 97.38
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 97.37
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.36
PRK11545163 gntK gluconate kinase 1; Provisional 97.35
PRK08149428 ATP synthase SpaL; Validated 97.31
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.31
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 97.25
TIGR00767415 rho transcription termination factor Rho. Members 97.25
PRK09862506 putative ATP-dependent protease; Provisional 97.25
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 97.23
PRK05688451 fliI flagellum-specific ATP synthase; Validated 97.21
TIGR00611365 recf recF protein. All proteins in this family for 97.21
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-46  Score=386.46  Aligned_cols=203  Identities=22%  Similarity=0.296  Sum_probs=183.3

Q ss_pred             ceeEEEceEEEeeeCccccceeeeeccceeccCCcEEEEEcCCCchHHHHHHHHHcCccCce---eccCcccc--cceeE
Q 004662          137 IDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITT---VISTDSIR--HMMRS  211 (738)
Q Consensus       137 ~~Lev~nLsk~~~~g~~~~~~aL~dVSL~I~k~GEIvgLiGpNGAGKSTLLrlLaGLL~Pts---vi~~d~ir--~~~rg  211 (738)
                      ..+.+++++  +.|+...   +|+++||+|.+ ||+++|+||||||||||||+|+||+.|++   .+....+.  ...++
T Consensus         2 ~~l~i~~v~--~~f~~~~---vl~~i~L~v~~-GEfvsilGpSGcGKSTLLriiAGL~~p~~G~V~~~g~~v~~p~~~~~   75 (248)
T COG1116           2 ALLEIEGVS--KSFGGVE---VLEDINLSVEK-GEFVAILGPSGCGKSTLLRLIAGLEKPTSGEVLLDGRPVTGPGPDIG   75 (248)
T ss_pred             ceEEEEeeE--EEeCceE---EeccceeEECC-CCEEEEECCCCCCHHHHHHHHhCCCCCCCceEEECCcccCCCCCCEE
Confidence            468899999  4556654   99999999999 99999999999999999999999999998   23443332  34679


Q ss_pred             EEeCCCCCCCCCCHHHHHHh-cCCCCccHHHHHHHHHHHHHHcCCCCcccCCCCCCChhhhcchhHHHHHHhhcCCCeEE
Q 004662          212 FVDEKQNPLLWASTYHAGEF-LDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIRPEVGSSAAELISPKQMA  290 (738)
Q Consensus       212 ~VfQd~~l~~~lSV~Enl~~-l~~~g~~~~e~~~ra~elLe~vgL~~~~~r~p~~LSGGqkQR~~VaLARAL~~~PklLL  290 (738)
                      ||||++.||||+||++|+.+ +...+.++.+.++++.++|+.|||.++.++||++||||||||  |+|||||+.+|++||
T Consensus        76 ~vFQ~~~LlPW~Tv~~NV~l~l~~~~~~~~e~~~~a~~~L~~VgL~~~~~~~P~qLSGGMrQR--VaiARAL~~~P~lLL  153 (248)
T COG1116          76 YVFQEDALLPWLTVLDNVALGLELRGKSKAEARERAKELLELVGLAGFEDKYPHQLSGGMRQR--VAIARALATRPKLLL  153 (248)
T ss_pred             EEeccCcccchhhHHhhheehhhccccchHhHHHHHHHHHHHcCCcchhhcCccccChHHHHH--HHHHHHHhcCCCEEE
Confidence            99999999999999999998 777777788888899999999999999999999999999999  999999999999999


Q ss_pred             -EeCccccCHHHHHHHH-HHHHHHHccCcEEEE------ehHHHHHHHHHHHhhcCCCceeEEEEeC
Q 004662          291 -IEGFKAQSEMVIDSLD-RLITAWEERNESVVV------EGVHLSLNFVMGLMKKHPSIIPFMIYIT  349 (738)
Q Consensus       291 -DEPtsgLD~~~r~~L~-~LI~~l~e~G~TVII------Eav~LaDrIv~~vL~~g~G~I~~~i~i~  349 (738)
                       ||||++||..++..++ .+++.|.+.+.|||+      |++.++|||+  +|.++|++|...+.++
T Consensus       154 lDEPFgALDalTR~~lq~~l~~lw~~~~~TvllVTHdi~EAv~LsdRiv--vl~~~P~~i~~~~~i~  218 (248)
T COG1116         154 LDEPFGALDALTREELQDELLRLWEETRKTVLLVTHDVDEAVYLADRVV--VLSNRPGRIGEELEID  218 (248)
T ss_pred             EcCCcchhhHHHHHHHHHHHHHHHHhhCCEEEEEeCCHHHHHhhhCEEE--EecCCCcceeeEEecC
Confidence             9999999999999995 777889999999988      9999999999  9999999888888877

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query738
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 8e-07
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 9e-07
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 2e-06
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 5e-06
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 2e-05
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 9e-05
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 2e-04
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 2e-04
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 79.9 bits (196), Expect = 2e-15
 Identities = 77/489 (15%), Positives = 153/489 (31%), Gaps = 145/489 (29%)

Query: 35  YTRPVLQSTL--QLMGCKARHAFKISQRVFKMIRTESPTSAHHQEGAEVFGSHCLKGNLE 92
             + +L       ++   ++ A   + R+F  + ++       +E  + F    ++  L 
Sbjct: 41  MPKSILSKEEIDHII--MSKDAVSGTLRLFWTLLSKQ------EEMVQKF----VEEVLR 88

Query: 93  KDDGCNPGSCFCKEEVSESGDRSKRIPFELYKRRTTVVISRETFIDVVCDALTEY-KYVG 151
            +        F    +     R   +   +Y              D + +    + KY  
Sbjct: 89  INYK------FLMSPIKTE-QRQPSMMTRMY----------IEQRDRLYNDNQVFAKY-- 129

Query: 152 HNQRADLVLACR--IRERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMM 209
           +  R    L  R  + E + +  VL+ G  G GK+ ++           V  +  ++  M
Sbjct: 130 NVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALD---------VCLSYKVQCKM 180

Query: 210 RSFVDEKQNPLLWASTYHAGEFLDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGK 269
                     + W +         P+ V E   K          L    D    S +   
Sbjct: 181 -------DFKIFWLN---LKNCNSPETVLEMLQK----------LLYQIDPNWTSRSDHS 220

Query: 270 SDIRPEVGSSAAELISPKQMAIEGFKA--------QSEMVIDSLD---R-LITAWEERNE 317
           S+I+  + S  AEL   + +  + ++         Q+    ++ +   + L+T    R +
Sbjct: 221 SNIKLRIHSIQAEL--RRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTT---RFK 275

Query: 318 SVVVEGVHLSLNFVMGLMKKHPSIIPFMIYITNEDKHMERFAVRAKYMTLDPAK------ 371
            V         +F+      H S+    + +T  D+         KY+   P        
Sbjct: 276 QVT--------DFLSAATTTHISLDHHSMTLT-PDEVKSLL---LKYLDCRPQDLPREVL 323

Query: 372 --NKYVKYIRNI-RTIQDYLCQRAD--KHLVPKINNTNVDKSVAAIHATVFSCLRRREGG 426
             N     +  I  +I+D L    D  KH+       N DK    +   + S L   E  
Sbjct: 324 TTNPRR--LSIIAESIRDGLA-TWDNWKHV-------NCDK----LTTIIESSLNVLEPA 369

Query: 427 E--QLYD-----------PT-------TNTVTVIAEEYRNQCAAHSLSSKGMFQLIQRKG 466
           E  +++D           PT        + +        N+   +SL  K      Q K 
Sbjct: 370 EYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEK------QPKE 423

Query: 467 SSRHLMALL 475
           S+  + ++ 
Sbjct: 424 STISIPSIY 432
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 738
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 3e-05
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 4e-05
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 1e-04
d1deka_241 c.37.1.1 (A:) Deoxynucleoside monophosphate kinase 0.001
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.001
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 0.003
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.004
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 0.004
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein BH3686
species: Bacillus halodurans [TaxId: 86665]

 Score = 43.1 bits (100), Expect = 3e-05
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 173 VLLCGTSGCGKSTLSALLGSRLGITTVISTDSIRHMMRS 211
            ++ G +G GKST    L ++L  +  I  D I HM+  
Sbjct: 5   YIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVG 43
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Length = 241 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query738
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.63
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.25
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.37
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.19
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.59
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.5
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 97.43
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.38
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.37
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.36
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.28
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.27
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.26
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.23
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.23
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.23
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.22
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.21
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.19
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.17
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.14
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.1
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.08
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.06
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.0
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.99
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.98
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.93
d2qy9a2211 GTPase domain of the signal recognition particle r 96.91
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.9
d1okkd2207 GTPase domain of the signal recognition particle r 96.86
d1vmaa2213 GTPase domain of the signal recognition particle r 96.84
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 96.83
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.82
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.78
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.77
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.76
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.73
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.71
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.67
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.67
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.66
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.65
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.63
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.6
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.59
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.56
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.56
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.52
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.47
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.46
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.44
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.44
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.43
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.43
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.41
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.38
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.34
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.33
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.32
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.28
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.25
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.24
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.24
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.22
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.2
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.17
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.16
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.14
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.14
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.1
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.06
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.04
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.93
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.92
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.88
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.87
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.86
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.86
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.78
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.74
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.73
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.72
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.71
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.71
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.69
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.69
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.69
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.69
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.68
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.68
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.67
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.66
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.65
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.62
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.55
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.53
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.47
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.47
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.46
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.46
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.46
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.46
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.44
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.37
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.32
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.27
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.24
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.22
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.21
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.17
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.16
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.16
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.08
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.06
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.06
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.02
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.99
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.98
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 94.97
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.96
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.92
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.89
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.82
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.77
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.72
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.7
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.7
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.58
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.57
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.51
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.45
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.45
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.3
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.29
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.18
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.1
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.07
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.03
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.96
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.94
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.84
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.81
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.77
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.76
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.73
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.69
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.66
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.62
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.57
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.54
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.51
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.5
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.48
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.48
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.42
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.37
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.19
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.16
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.14
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.08
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.07
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.07
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.06
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.06
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.0
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.99
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.92
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.88
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.87
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.86
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.75
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.72
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.72
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.66
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.64
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.55
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.37
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.31
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.28
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.24
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.23
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.13
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.12
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.08
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.07
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.02
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.0
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.95
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 91.93
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.91
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.86
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 91.64
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.57
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.56
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.54
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.53
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 91.4
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.26
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.08
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.06
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 91.02
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 90.87
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 90.65
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 90.46
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 90.17
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 90.13
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 90.06
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.98
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.77
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 89.32
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.25
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.18
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 88.73
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 88.72
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 88.61
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 88.59
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 88.32
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 88.12
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.09
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 88.02
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 87.49
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 87.38
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.15
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 86.01
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 85.32
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 84.39
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 84.35
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 83.79
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 83.52
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 82.5
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 80.6
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 80.42
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=0  Score=328.37  Aligned_cols=203  Identities=17%  Similarity=0.157  Sum_probs=179.9

Q ss_pred             CCCEEEEECEEEEEEECCCCCCEEEEECCCEECCCCCEEEEECCCCCHHHHHHHHHHCCCCCCE---EC-CCC----CCC
Q ss_conf             5450699713788650764320254411440225794999993898439999999970926755---22-476----434
Q 004662          135 TFIDVVCDALTEYKYVGHNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITT---VI-STD----SIR  206 (738)
Q Consensus       135 ~m~~L~v~nLsk~k~~g~~~~~~iL~~ISL~I~k~GeIigLiGpSGAGKSTLlklLaGLL~pts---vI-~td----~iR  206 (738)
                      +|..|+++||+  +.||+..   +|+++||++++ |++++|+||||||||||+++|+|++.|++   .+ +.+    ...
T Consensus         3 ~M~~I~v~nls--k~yg~~~---al~~vsl~v~~-Ge~~~liGpsGaGKSTLl~~i~Gl~~p~sG~I~i~g~~i~~~~~~   76 (239)
T d1v43a3           3 KMVEVKLENLT--KRFGNFT---AVNKLNLTIKD-GEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPK   76 (239)
T ss_dssp             CCCCEEEEEEE--EEETTEE---EEEEEEEEECT-TCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCGG
T ss_pred             CCCEEEEEEEE--EEECCEE---EECCEEEEECC-CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCCC
T ss_conf             10749998799--9999999---98130678879-989999999998299999999758999878799916413547700


Q ss_pred             CCEEEEEECCCCCCCCCCHHHHHHH-CCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHCC
Q ss_conf             5406999588998978989999982-178872089999999999999399971158989889554222357889986329
Q 004662          207 HMMRSFVDEKQNPLLWASTYHAGEF-LDPDAVAEAKAKKHARKLAGAALSVPKDEASNSSATGKSDIRPEVGSSAAELIS  285 (738)
Q Consensus       207 ~~~rg~V~Qd~~l~~~lSV~Eni~~-L~~~gl~~~e~~~rv~elLe~vgL~~~~~k~~~~LSGGqkQR~~VaIARALi~~  285 (738)
                      +..+|||||++++++++||++|+.+ +..+++++.+.++++.++|+.++|.++.+++|.+||||||||  |+|||||+.+
T Consensus        77 ~r~ig~v~Q~~~l~~~ltv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~LSGGq~QR--vaiAraL~~~  154 (239)
T d1v43a3          77 DRNISMVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQR--VAVARAIVVE  154 (239)
T ss_dssp             GGTEEEEEC------CCCHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCGGGTTSCTTTCCSSCHHH--HHHHHHHTTC
T ss_pred             CCEEEEEEECHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHH--HHHHHHHCCC
T ss_conf             01589980033534222099999999987399999999999999987598556609954699999889--9997664049


Q ss_pred             CCEEE-EECCCCCCHHHHHHHHHHHHHHH-CCCCEEEE------EHHHHHHHHHHHHHHCCCCCEEEEEEEC
Q ss_conf             99699-91863419999999999999998-06947998------5588779999997421998055999807
Q 004662          286 PKQMA-IEGFKAQSEMVIDSLDRLITAWE-ERNESVVV------EGVHLSLNFVMGLMKKHPSIIPFMIYIT  349 (738)
Q Consensus       286 PkiLL-DEPtsaLDp~vr~~I~~LI~~l~-eeG~TIII------Eav~LaDrIv~~iLk~g~g~I~~~i~i~  349 (738)
                      |++|| ||||++|||..+..+++++..+. +.|.|+|+      ++..+|||++  +|+  +|+|....+..
T Consensus       155 P~iLllDEPts~LD~~~~~~i~~ll~~l~~~~g~tii~vTHd~~~a~~~~dri~--vm~--~G~iv~~G~~~  222 (239)
T d1v43a3         155 PDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIA--VMN--RGQLLQIGSPT  222 (239)
T ss_dssp             CSEEEEESTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHHHHHHHCSEEE--EEE--TTEEEEEECHH
T ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCEEE--EEE--CCEEEEECCHH
T ss_conf             982430688666898999899999999987319807999489999998699999--998--99999985999
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure