Citrus Sinensis ID: 004776
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 731 | ||||||
| 219879370 | 829 | class III HD-Zip protein 8 [Citrus trifo | 0.958 | 0.845 | 0.992 | 0.0 | |
| 224092274 | 828 | predicted protein [Populus trichocarpa] | 0.952 | 0.840 | 0.902 | 0.0 | |
| 359476025 | 839 | PREDICTED: homeobox-leucine zipper prote | 0.969 | 0.845 | 0.871 | 0.0 | |
| 383930759 | 840 | class III HD-Zip protein 8 [Prunus persi | 0.972 | 0.846 | 0.868 | 0.0 | |
| 147790308 | 839 | hypothetical protein VITISV_009744 [Viti | 0.954 | 0.831 | 0.869 | 0.0 | |
| 206572107 | 844 | putative HB8 HD-ZipIII [Malus x domestic | 0.978 | 0.847 | 0.869 | 0.0 | |
| 224142954 | 823 | predicted protein [Populus trichocarpa] | 0.946 | 0.840 | 0.885 | 0.0 | |
| 302398629 | 841 | BZIP domain class transcription factor [ | 0.974 | 0.846 | 0.864 | 0.0 | |
| 225442501 | 837 | PREDICTED: homeobox-leucine zipper prote | 0.956 | 0.835 | 0.860 | 0.0 | |
| 297743212 | 835 | unnamed protein product [Vitis vinifera] | 0.956 | 0.837 | 0.860 | 0.0 |
| >gi|219879370|gb|ACL51017.1| class III HD-Zip protein 8 [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 1445 bits (3741), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 696/701 (99%), Positives = 697/701 (99%)
Query: 22 MDNGKYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCR 81
MDNGKYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECPILSNIEPKQIKVWFQ+RRCR
Sbjct: 1 MDNGKYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECPILSNIEPKQIKVWFQDRRCR 60
Query: 82 EKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENTFFRQQTQNAATLATTDT 141
EKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENTFFRQQTQNAATLATTDT
Sbjct: 61 EKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENTFFRQQTQNAATLATTDT 120
Query: 142 SCESVVTSGQHHLTPQQQHQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMK 201
SCESV TSGQHHLTPQQQHQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMK
Sbjct: 121 SCESVATSGQHHLTPQQQHQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMK 180
Query: 202 PGPDSIGIVAISHGCTGVAARACGLVGLDPTRVAEILKDRPSWYRDCRSVEVVNVLPTGS 261
PGPDSIGIVAISHGCTGVAARACGLVGLDPTRVAEILKDRPSWYRDCRSVEVVNVLPTGS
Sbjct: 181 PGPDSIGIVAISHGCTGVAARACGLVGLDPTRVAEILKDRPSWYRDCRSVEVVNVLPTGS 240
Query: 262 SGTIELLYMQLYAPTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNGPSMPQAPHFV 321
SGTIELLYMQLYAPTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNGPSMPQAPHFV
Sbjct: 241 SGTIELLYMQLYAPTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNGPSMPQAPHFV 300
Query: 322 RAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALRHL 381
RAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALRHL
Sbjct: 301 RAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALRHL 360
Query: 382 RQISQEVSQPSVTGWGRRPAALRALSQRLSRGFNEALNGFTDEGWSMLESDGIDDVTVHV 441
RQISQEVSQPSVTGWGRRPAALRALSQRLSRGFNEALNGFTDEGWSMLESDGIDDVTVHV
Sbjct: 361 RQISQEVSQPSVTGWGRRPAALRALSQRLSRGFNEALNGFTDEGWSMLESDGIDDVTVHV 420
Query: 442 NSSPSKMMGVQLSYVNGFPSMSNAVLCAKASMLLQDVPPAILLRFLREHRSEWADSSIDA 501
NSSPSKMMGVQLSYVNGFPSMSNAVLCAKASMLLQDVPPAILLRFLREHRSEWADSSIDA
Sbjct: 421 NSSPSKMMGVQLSYVNGFPSMSNAVLCAKASMLLQDVPPAILLRFLREHRSEWADSSIDA 480
Query: 502 YSAAAVKAGPCSLPVPRAGNFGGQVILPLAHTIEHEEFLEVIKLENMAHYREDMIMPSDI 561
YSAAAVKAGPCSLPVPRAGNFGGQVILPLAHTIEHEEFLEVIKLENMAHYREDMIMPSDI
Sbjct: 481 YSAAAVKAGPCSLPVPRAGNFGGQVILPLAHTIEHEEFLEVIKLENMAHYREDMIMPSDI 540
Query: 562 FLLQLCSGVDENAVGNCAELVFAPIDASFSDDAPIIPSGFRIIPLDSGKDTPSPNRTLDL 621
FLLQLCSGVDENAVGNCAELVFAPIDASFSDDAPIIPSGFRIIPLDSGKDTPSPNRTLDL
Sbjct: 541 FLLQLCSGVDENAVGNCAELVFAPIDASFSDDAPIIPSGFRIIPLDSGKDTPSPNRTLDL 600
Query: 622 ASALEVGPTGNKASGDSSTQCGSTKSVITIAFQFAFEMHLQENVASMARQYVRGIIASVQ 681
ASALEVGPTGNKASGDSSTQCGS KSVITIAFQFAFEMHLQENVASMARQYVRGIIASVQ
Sbjct: 601 ASALEVGPTGNKASGDSSTQCGSKKSVITIAFQFAFEMHLQENVASMARQYVRGIIASVQ 660
Query: 682 RVALALSPSRFGSNAGLRPPPGSPEAHTLARWICQSYRCVF 722
RVALALSPSRFGSNAGLRPPPGSPEAHTLARWICQSYRC
Sbjct: 661 RVALALSPSRFGSNAGLRPPPGSPEAHTLARWICQSYRCYL 701
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224092274|ref|XP_002309538.1| predicted protein [Populus trichocarpa] gi|60327635|gb|AAX19057.1| class III HD-Zip protein 8 [Populus trichocarpa] gi|222855514|gb|EEE93061.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359476025|ref|XP_002283717.2| PREDICTED: homeobox-leucine zipper protein ATHB-15-like [Vitis vinifera] gi|296081833|emb|CBI20838.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|383930759|gb|AFH56718.1| class III HD-Zip protein 8 [Prunus persica] | Back alignment and taxonomy information |
|---|
| >gi|147790308|emb|CAN61201.1| hypothetical protein VITISV_009744 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|206572107|gb|ACI13686.1| putative HB8 HD-ZipIII [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|224142954|ref|XP_002324794.1| predicted protein [Populus trichocarpa] gi|60327633|gb|AAX19056.1| class III HD-Zip protein 7 [Populus trichocarpa] gi|222866228|gb|EEF03359.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302398629|gb|ADL36609.1| BZIP domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|225442501|ref|XP_002284003.1| PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743212|emb|CBI36079.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 731 | ||||||
| TAIR|locus:2134088 | 833 | HB-8 "AT4G32880" [Arabidopsis | 0.945 | 0.829 | 0.794 | 2e-301 | |
| TAIR|locus:2034086 | 837 | ATHB-15 "AT1G52150" [Arabidops | 0.942 | 0.823 | 0.773 | 1.5e-287 | |
| TAIR|locus:2061544 | 852 | PHB "AT2G34710" [Arabidopsis t | 0.942 | 0.808 | 0.660 | 1.7e-240 | |
| TAIR|locus:2175856 | 842 | REV "AT5G60690" [Arabidopsis t | 0.922 | 0.800 | 0.633 | 3.3e-230 | |
| TAIR|locus:2028140 | 841 | PHV "AT1G30490" [Arabidopsis t | 0.930 | 0.808 | 0.635 | 3.7e-229 | |
| TAIR|locus:2119048 | 762 | ATML1 "AT4G21750" [Arabidopsis | 0.336 | 0.322 | 0.258 | 1.1e-24 | |
| TAIR|locus:2135368 | 743 | PDF2 "AT4G04890" [Arabidopsis | 0.322 | 0.317 | 0.264 | 2.6e-24 | |
| TAIR|locus:2207235 | 721 | HDG2 "AT1G05230" [Arabidopsis | 0.094 | 0.095 | 0.434 | 4e-20 | |
| TAIR|locus:2127008 | 802 | ANL2 "ANTHOCYANINLESS 2" [Arab | 0.377 | 0.344 | 0.245 | 2.3e-17 | |
| TAIR|locus:2098866 | 808 | HDG1 "AT3G61150" [Arabidopsis | 0.106 | 0.096 | 0.388 | 3.2e-17 |
| TAIR|locus:2134088 HB-8 "AT4G32880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2893 (1023.4 bits), Expect = 2.0e-301, P = 2.0e-301
Identities = 556/700 (79%), Positives = 616/700 (88%)
Query: 22 MDNGKYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCR 81
MDNGKYVRYTPEQVEALERLY++CPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCR
Sbjct: 11 MDNGKYVRYTPEQVEALERLYNDCPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCR 70
Query: 82 EKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVYENTFFRXXXXXXXXXXXXXX 141
EKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVS LVYEN++FR
Sbjct: 71 EKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSHLVYENSYFRQHPQNQGNLATTDT 130
Query: 142 SCESVVTSGXXXXXXXXXXXXXXRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMK 201
SCESVVTSG RDASPAGLLSIA+ETLTEF+SKATGTAVEWVQMPGMK
Sbjct: 131 SCESVVTSGQHHLTPQHQP----RDASPAGLLSIADETLTEFISKATGTAVEWVQMPGMK 186
Query: 202 PGPDSIGIVAISHGCTGVAARACGLVGLDPTRVAEILKDRPSWYRDCRSVEVVNVLPTGS 261
PGPDSIGIVAISHGCTG+AARACGLVGLDPTRVAEILKD+P W RDCRS+++VNVL T +
Sbjct: 187 PGPDSIGIVAISHGCTGIAARACGLVGLDPTRVAEILKDKPCWLRDCRSLDIVNVLSTAN 246
Query: 262 SGTIELLYMQLYAPTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNGPSMPQAPHFV 321
GT+EL+YMQLYAPTTLAPARDFW+LRYTSV+EDGSLV+CERSLNNTQNGPSMP +PHFV
Sbjct: 247 GGTLELIYMQLYAPTTLAPARDFWMLRYTSVMEDGSLVICERSLNNTQNGPSMPPSPHFV 306
Query: 322 RAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALRHL 381
RAE+LPSGYLIRPCEGGGSI+HIVDH DLEPWSVPEVLR LYESSTL+AQ+TTMAALR+L
Sbjct: 307 RAEILPSGYLIRPCEGGGSILHIVDHFDLEPWSVPEVLRSLYESSTLLAQRTTMAALRYL 366
Query: 382 RQISQEVSQPSVTGWGRRPAALRALSQRLSRGFNEALNGFTDEGWSMLESDGIDDVTVHV 441
RQISQE+SQP+VTGWGRRPAALRALSQRLS+GFNEA+NGF+DEGWS+LESDGIDDVT+ V
Sbjct: 367 RQISQEISQPNVTGWGRRPAALRALSQRLSKGFNEAVNGFSDEGWSILESDGIDDVTLLV 426
Query: 442 NSSPSKMMGVQ-LSYVNGFPSMSNAVLCAKASMLLQDVPPAILLRFLREHRSEWXXXXXX 500
NSSP+KMM L + NG+ SM +AVLCAKASMLLQ+VPP+ILLRFLREHR EW
Sbjct: 427 NSSPTKMMMTSSLPFANGYTSMPSAVLCAKASMLLQNVPPSILLRFLREHRQEWADNSID 486
Query: 501 XXXXXXVKAGPCSLPVPRAGNFGGQVILPLAHTIEHEEFLEVIKLENMAHYREDMIMPSD 560
+KAGPCSLP+PR G+FGGQVILPLAHTIE+EEF+EVIKLE++ HY+EDM+MP+D
Sbjct: 487 AYSAAAIKAGPCSLPIPRPGSFGGQVILPLAHTIENEEFMEVIKLESLGHYQEDMMMPAD 546
Query: 561 IFLLQLCSGVDENAVGNCAELVFAPIDASFSDDAPIIPSGFRIIPLDSGKDTPSPNRTLD 620
IFLLQ+CSGVDENAV +CAEL+FAPIDASFSDDAPIIPSGFRIIPLDS + SPNRTLD
Sbjct: 547 IFLLQMCSGVDENAVESCAELIFAPIDASFSDDAPIIPSGFRIIPLDSKSEGLSPNRTLD 606
Query: 621 LASALEVGPTGNKASGDSSTQCGSTKSVITIAFQFAFEMHLQENVASMARQYVRGIIASV 680
LASAL+VG ++ +GDS G++KSV+TIAFQ AFEMH+QENVASMARQYVR +IASV
Sbjct: 607 LASALDVG---SRTAGDSCGSRGNSKSVMTIAFQLAFEMHMQENVASMARQYVRSVIASV 663
Query: 681 QRVALALSPSRFGSNAGLRPPPGSPEAHTLARWICQSYRC 720
QRVALALSPS +GLRPPP SPEAHTLARWI SYRC
Sbjct: 664 QRVALALSPSSH-QLSGLRPPPASPEAHTLARWISHSYRC 702
|
|
| TAIR|locus:2034086 ATHB-15 "AT1G52150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061544 PHB "AT2G34710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175856 REV "AT5G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028140 PHV "AT1G30490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207235 HDG2 "AT1G05230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127008 ANL2 "ANTHOCYANINLESS 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| HB8 | SubName- Full=Class III HD-Zip protein 8; (828 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 731 | |||
| cd08875 | 229 | cd08875, START_ArGLABRA2_like, C-terminal lipid-bi | 2e-83 | |
| pfam01852 | 205 | pfam01852, START, START domain | 2e-55 | |
| smart00234 | 205 | smart00234, START, in StAR and phosphatidylcholine | 6e-38 | |
| cd00177 | 193 | cd00177, START, Lipid-binding START domain of mamm | 1e-18 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 2e-17 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 3e-17 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 8e-17 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 2e-10 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 2e-05 | |
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 5e-05 | |
| cd08869 | 197 | cd08869, START_RhoGAP, C-terminal lipid-binding ST | 6e-05 | |
| cd08874 | 205 | cd08874, START_STARD9-like, C-terminal START domai | 1e-04 | |
| cd08868 | 208 | cd08868, START_STARD1_3_like, Cholesterol-binding | 2e-04 | |
| cd08907 | 205 | cd08907, START_STARD8-like, C-terminal lipid-bindi | 0.004 |
| >gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
Score = 263 bits (675), Expect = 2e-83
Identities = 78/233 (33%), Positives = 113/233 (48%), Gaps = 22/233 (9%)
Query: 169 PAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKP---GPDSIGIVAISH------GCTGV 219
+GLL +AEE + E L A G W++ PGMKP PD + H G T
Sbjct: 1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTE 60
Query: 220 AARACGLVGLDPTRVAEILKDRPSWYR----DCRSVEVVNVLPTGS----SGTIELLYMQ 271
A+RACGLV ++ ++ EIL D W + + V+ TG+ +GT++L+Y +
Sbjct: 61 ASRACGLVMMNAIKLVEILMDVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAE 120
Query: 272 LYAPTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNGPSMPQAPHFVRAEMLPSGYL 331
L P+ L P R+F+ LRY LEDG V + S++ Q P FVR LPSG L
Sbjct: 121 LQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQT---APPPASFVRCRRLPSGCL 177
Query: 332 IRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALRHLRQI 384
I+ G S + V+H++++ P L Y S+ +A T RQ
Sbjct: 178 IQDMPNGYSKVTWVEHVEVDEK--PVHLLYRYLVSSGLAFGATRWVATLQRQC 228
|
This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. Length = 229 |
| >gnl|CDD|216740 pfam01852, START, START domain | Back alignment and domain information |
|---|
| >gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
| >gnl|CDD|176878 cd08869, START_RhoGAP, C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >gnl|CDD|176883 cd08874, START_STARD9-like, C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >gnl|CDD|176877 cd08868, START_STARD1_3_like, Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176916 cd08907, START_STARD8-like, C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 731 | |||
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 100.0 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 99.74 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 99.72 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.7 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.52 | |
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.49 | |
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.49 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.49 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.49 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.42 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.42 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.41 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.41 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.4 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.39 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.35 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.32 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.31 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 99.29 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.24 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.24 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 99.19 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 99.18 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.18 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.14 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.12 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 99.1 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 99.05 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 99.03 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 99.03 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 99.03 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 99.01 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 98.98 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 98.87 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 98.81 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 98.71 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 98.69 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 98.58 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 98.58 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 98.57 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 98.52 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 98.3 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 98.26 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.17 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 98.11 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 98.07 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 97.85 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 97.84 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 97.74 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 97.69 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 97.63 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 97.59 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.57 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 97.54 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 97.41 | |
| cd08913 | 240 | START_STARD14-like Lipid-binding START domain of m | 97.26 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 97.16 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 97.11 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 97.09 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 97.05 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 95.69 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 95.64 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 94.81 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 94.73 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 94.5 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 94.5 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 94.19 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 93.74 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 93.44 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 93.36 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 92.32 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 92.09 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 91.68 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 91.29 | |
| cd08864 | 208 | SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- | 91.01 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 90.17 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 88.53 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 88.39 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 88.09 | |
| KOG2761 | 219 | consensus START domain-containing proteins involve | 87.85 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 86.59 | |
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 86.25 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 85.67 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 85.05 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 83.84 | |
| smart00340 | 44 | HALZ homeobox associated leucin zipper. | 82.64 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 82.22 |
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-77 Score=607.70 Aligned_cols=211 Identities=36% Similarity=0.618 Sum_probs=194.7
Q ss_pred hhhhHHHHHHHHHHHHHHhcCCCcceeeCCCCCC---CCCccceeec------cCCCccccccceeEEeeChhHHHHHhc
Q 004776 169 PAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKP---GPDSIGIVAI------SHGCTGVAARACGLVGLDPTRVAEILK 239 (731)
Q Consensus 169 ~~~l~~lA~~am~Ell~la~~~eplWi~~~g~~~---g~~~~~~~~~------~~~~~~EASR~~glV~m~~~~LVe~lm 239 (731)
+++|++||++||+||++||++++|+|++++|+++ ++|.|+..+. +.||++||||+||+|+||+.+|||+||
T Consensus 1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~~~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe~lm 80 (229)
T cd08875 1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVEILM 80 (229)
T ss_pred ChHHHHHHHHHHHHHHHHhccCCCCceecCCCCccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHHHHh
Confidence 3579999999999999999999999999999876 7777754332 336999999999999999999999999
Q ss_pred CcchhhhhCCcc----eEeeeccCCC----cchHHHHHHHhhccccccCCceeeEEeeeeeeCCCeEEEEEeecCCCCCC
Q 004776 240 DRPSWYRDCRSV----EVVNVLPTGS----SGTIELLYMQLYAPTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNG 311 (731)
Q Consensus 240 D~~~W~~~f~~~----~~l~~~~~g~----~G~lqLm~aE~~v~SPLVp~Re~~fLRyckq~~~G~waVvDvSld~~~~~ 311 (731)
|+++|.++||++ +|+.++++|+ +|+|||||+|||+||||||+|||||||||||++||+|||||||+|+.+.
T Consensus 81 D~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~~~- 159 (229)
T cd08875 81 DVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQT- 159 (229)
T ss_pred ChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeeccccc-
Confidence 999999999876 8999999996 7899999999999999999999999999999999999999999998753
Q ss_pred CCCCCCCccccccccCCcceEeecCCCccEEEEEEeeeccCCCccccchhhhhhhHHHHHHHHHHHH-HHHh
Q 004776 312 PSMPQAPHFVRAEMLPSGYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAAL-RHLR 382 (731)
Q Consensus 312 ~~~~~~~~~~r~~rlPSGclIq~~~nG~skVtwVeH~e~d~~~vh~l~rpl~~Sg~afgar~w~~aL-r~~e 382 (731)
.++.++|+||||+|||||||||+|||||||||||+|||++.+|.+||++++||+||||+||+++| ||||
T Consensus 160 --~p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwVeH~e~d~~~~~~l~~~l~~sg~AfgA~rw~a~lqRqce 229 (229)
T cd08875 160 --APPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEKPVHLLYRYLVSSGLAFGATRWVATLQRQCE 229 (229)
T ss_pred --CCCCCCccEEEEecCcEEEEECCCCceEEEEEEEEeccCCcccccchhhhhhhHHHHHHHHHHHHHHhcC
Confidence 33455789999999999999999999999999999999999999999999999999999999999 7997
|
This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. |
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >smart00340 HALZ homeobox associated leucin zipper | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 731 | ||||
| 1bw5_A | 66 | The Nmr Solution Structure Of The Homeodomain Of Th | 1e-05 | ||
| 2dmu_A | 70 | Solution Structure Of The Homeobox Domain Of Homeob | 2e-04 | ||
| 2m0c_A | 75 | Solution Nmr Structure Of Homeobox Domain Of Human | 9e-04 |
| >pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 | Back alignment and structure |
|
| >pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 | Back alignment and structure |
| >pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 731 | |||
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 6e-26 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 4e-25 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 5e-23 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 2e-17 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 4e-17 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 1e-16 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 3e-14 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 2e-13 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 5e-13 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 8e-13 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 1e-12 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 3e-12 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 4e-12 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 7e-12 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 1e-11 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 1e-11 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 1e-11 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 2e-11 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 3e-11 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 4e-11 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 2e-10 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 2e-10 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 7e-10 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 9e-10 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 2e-09 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 5e-09 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 1e-08 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 9e-08 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 1e-07 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 1e-07 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 2e-07 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 6e-07 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 8e-07 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 1e-06 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 1e-06 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 2e-06 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 2e-06 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 2e-06 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 2e-06 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 2e-06 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 2e-06 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 3e-06 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 3e-06 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 3e-06 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 3e-06 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 3e-06 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 4e-06 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 5e-06 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 5e-06 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 6e-06 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 7e-06 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 8e-06 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 8e-06 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 8e-06 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 9e-06 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 1e-05 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 1e-05 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 2e-05 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 2e-05 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 2e-05 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 2e-05 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 2e-05 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 3e-05 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 3e-05 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 4e-05 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 4e-05 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 6e-05 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 7e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-04 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 1e-04 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 1e-04 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 1e-04 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 2e-04 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 2e-04 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 2e-04 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 5e-04 |
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 | Back alignment and structure |
|---|
Score = 106 bits (265), Expect = 6e-26
Identities = 48/231 (20%), Positives = 78/231 (33%), Gaps = 19/231 (8%)
Query: 151 QHHLTPQQQHQHPPRDASPAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSIGIV 210
+ + S A + + +A WV +
Sbjct: 9 SGVDLGTENLYFQSMEESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNT--DLAFK 66
Query: 211 AISHGCTGVAARACGLVGLDPTRVAE-ILKDRPSWYRDCRSVEVVNVLPTGSSGTIELLY 269
+ G +A V P+ V +L++R W D +VV L E+
Sbjct: 67 KVGDGNPLKLWKASVEVEAPPSVVLNRVLRERHLWDEDFVQWKVVETL----DRQTEIYQ 122
Query: 270 MQLYAPTTLAPARDFWLLRYTSV-LEDGSLVVCERSLNNTQNGPSMPQAPHFVRAEMLPS 328
L + P+RDF +LR L G + S+ + Q VRA ++ S
Sbjct: 123 YVLNSMAPH-PSRDFVVLRTWKTDLPKGMCTLVSLSVEH-----EEAQLLGGVRAVVMDS 176
Query: 329 GYLIRPCEGGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALR 379
YLI PC G S + + +DL+ PE + L A + +A +R
Sbjct: 177 QYLIEPCGSGKSRLTHICRIDLKGH-SPEWYSKGF--GHLCAAE--VARIR 222
|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Length = 189 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Length = 229 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Length = 214 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 731 | |||
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 99.82 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.69 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.67 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.66 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.64 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.64 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.62 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.62 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.62 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.62 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.62 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.62 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.61 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.61 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.61 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.61 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.61 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.61 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.6 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.6 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.6 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.6 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.6 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.6 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.58 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.58 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.58 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.58 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.58 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.57 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.57 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.57 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.57 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.57 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.57 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.56 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.56 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.56 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.56 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.56 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.55 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.55 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.55 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.55 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.54 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.53 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.53 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.52 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.52 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.52 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.52 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.51 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.5 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.49 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.49 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.48 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.48 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.47 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.47 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.46 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.46 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.45 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.45 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.44 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.44 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.44 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.43 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.42 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.41 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.4 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.4 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 99.36 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 99.35 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.34 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 99.34 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.31 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.22 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.09 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.02 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.02 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 98.99 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 98.96 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 98.94 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 98.91 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 98.5 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 98.45 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.33 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 96.58 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 94.76 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 94.6 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 94.01 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 93.63 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 93.52 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 93.27 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 92.5 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 92.0 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 90.5 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 89.23 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 88.69 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 87.86 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 86.08 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 85.62 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 84.27 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 80.11 |
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.82 E-value=1.2e-19 Score=183.48 Aligned_cols=198 Identities=21% Similarity=0.261 Sum_probs=159.7
Q ss_pred hhhhHHHHHHHHHHHHHHhcCCCcceeeCCCCCCCCCccceeec-cCCCccccccceeEEeeChhHHHHHhcC-----cc
Q 004776 169 PAGLLSIAEETLTEFLSKATGTAVEWVQMPGMKPGPDSIGIVAI-SHGCTGVAARACGLVGLDPTRVAEILKD-----RP 242 (731)
Q Consensus 169 ~~~l~~lA~~am~Ell~la~~~eplWi~~~g~~~g~~~~~~~~~-~~~~~~EASR~~glV~m~~~~LVe~lmD-----~~ 242 (731)
+..+.++|++||+|++++++.+ ..|..... +.| +.++-. ..+..+.+-|..|+|.+.+.+|++.||+ +.
T Consensus 21 ~~~y~~~a~~~~~~~l~~~~~~-~~W~~~~~-~~g---v~v~~~~~~~~~~~~~k~~~~v~~~~~~v~~~l~~~d~~~r~ 95 (231)
T 2r55_A 21 QSMAAQMSEAVAEKMLQYRRDT-AGWKICRE-GNG---VSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRV 95 (231)
T ss_dssp HHHHHHHHHHHHHHHHHHHHCC-SSCEEEEC-CSS---EEEEEEECSSSSSEEEEEEEEESSCHHHHHHHHCC--CCSHH
T ss_pred HHHHHHHHHHHHHHHHHHhcCC-CCCEEEEe-CCC---EEEEEEccCCCCCcEEEEEEEECCCHHHHHHHHHhhCcchhh
Confidence 5679999999999999999754 68987532 222 222211 1244568889999999999999999977 89
Q ss_pred hhhhhCCcceEeeeccCCCcchHHHHHHHhh--ccccccCCceeeEEeeeeeeCCCeEEEEEeecCCCCCCCCCCCCCcc
Q 004776 243 SWYRDCRSVEVVNVLPTGSSGTIELLYMQLY--APTTLAPARDFWLLRYTSVLEDGSLVVCERSLNNTQNGPSMPQAPHF 320 (731)
Q Consensus 243 ~W~~~f~~~~~l~~~~~g~~G~lqLm~aE~~--v~SPLVp~Re~~fLRyckq~~~G~waVvDvSld~~~~~~~~~~~~~~ 320 (731)
+|-..|...++|+.+... .. ++| ++. .++++|++|||.++||+++.++|.|+|+.+|++. +..|+...+
T Consensus 96 ~Wd~~~~~~~vle~i~~~--~~--i~~-~~~~~~~~~~v~~RDfv~~r~~~~~~~g~~vi~~~Sv~~----~~~P~~~~~ 166 (231)
T 2r55_A 96 KWDENVTGFEIIQSITDT--LC--VSR-TSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEH----PLCPPKPGF 166 (231)
T ss_dssp HHCTTCSEEEEEEECSSS--EE--EEE-EECCCBTTTTBCCEEEEEEEEEEECTTSCEEEEEEECCC----TTSCCCTTC
T ss_pred hhccccceeEEEEEcCCC--EE--EEE-EEeccccCCccCCCeEEEEEEEEEcCCCEEEEEEEeccC----CCCCCCCCC
Confidence 999999999999988632 11 222 232 3456899999999999999999999999999984 345566789
Q ss_pred ccccccCCcceEeecC--CCccEEEEEEeeeccCCCccccchhhhhhhHHHHHHHHHHHHH-HHhhh
Q 004776 321 VRAEMLPSGYLIRPCE--GGGSIIHIVDHMDLEPWSVPEVLRPLYESSTLIAQKTTMAALR-HLRQI 384 (731)
Q Consensus 321 ~r~~rlPSGclIq~~~--nG~skVtwVeH~e~d~~~vh~l~rpl~~Sg~afgar~w~~aLr-~~e~l 384 (731)
+|++.++|||+||+++ +|.|+|||+.|+|..-+ +| +.++++.+..+...|++.|| +|+.+
T Consensus 167 VR~~~~~~g~~i~p~~~~~~~t~vt~~~~~Dp~G~-iP---~~lvn~~~~~~~~~~~~~Lr~~~~~~ 229 (231)
T 2r55_A 167 VRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGY-LP---QNVVDSFFPRSMTRFYANLQKAVKQF 229 (231)
T ss_dssp EEEEECSEEEEEEECC--CCCEEEEEEECEECCSS-CC---HHHHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred EEEEEEeeEEEEEEeCCCCCcEEEEEEEEeCCCCC-cc---HHHHHHHHhHhHHHHHHHHHHHHHHh
Confidence 9999999999999998 78999999999998876 55 68888888999999999996 88764
|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 731 | ||||
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-18 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 4e-17 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 4e-17 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 1e-15 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 1e-15 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 2e-15 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 3e-15 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 4e-15 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 8e-15 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 1e-14 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 1e-14 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 2e-14 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 2e-14 | |
| d2psoa1 | 197 | d.129.3.2 (A:908-1104) Star-related lipid transfer | 2e-14 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 2e-14 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 4e-14 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 5e-14 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 6e-14 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 7e-14 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 3e-13 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 4e-13 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 5e-13 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 6e-13 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 8e-13 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 2e-12 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 2e-12 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 3e-12 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 4e-12 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 4e-12 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 2e-11 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 3e-11 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 4e-10 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 7e-10 | |
| d1em2a_ | 214 | d.129.3.2 (A:) Lipid transport domain of Mln64 {Hu | 4e-07 | |
| d1ln1a_ | 203 | d.129.3.2 (A:) Phosphatidylcholine transfer protei | 3e-06 |
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-a9 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 78.3 bits (193), Expect = 2e-18
Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
Query: 26 KYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCREK-Q 84
K YT Q LE+ + + RR ++ R N+ +Q+K+WFQNRR + K
Sbjct: 16 KRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLL----NLTERQVKIWFQNRRMKMKKI 71
Query: 85 RKEASR 90
K+ ++
Sbjct: 72 NKDRAK 77
|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Length = 203 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 731 | |||
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.7 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.69 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.68 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.68 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.68 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.67 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.67 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.65 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.64 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.64 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.63 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.63 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.63 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.63 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.62 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.58 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.58 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.57 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.57 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.57 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.57 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.56 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.54 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.49 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.47 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.46 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.41 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.4 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.4 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.34 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.31 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 98.82 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 98.65 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 98.48 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 98.16 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 94.28 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 94.05 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 92.09 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 91.81 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 86.84 |
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-b13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.70 E-value=4.2e-18 Score=137.10 Aligned_cols=58 Identities=31% Similarity=0.558 Sum_probs=55.4
Q ss_pred CCCCcccCCHHHHHHHHHhHhcCCCCCHHHHHHHHHhcCccCCCChhhhhhhhhhhhhHHHH
Q 004776 23 DNGKYVRYTPEQVEALERLYHECPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQ 84 (731)
Q Consensus 23 ~rrkR~r~T~~Ql~~LE~~F~~~~~Ps~~~r~~LA~~L~~~~gLs~rQVkvWFQNRRaK~Kr 84 (731)
++|+|+.||++|+.+||..|..++||+..+|.+||..| ||+++||++||||||+|+||
T Consensus 1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l----~l~~~qV~vWFqNrR~k~kk 58 (58)
T d2craa1 1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAAT----SLSERQITIWFQNRRVKEKK 58 (58)
T ss_dssp CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHT----CCCHHHHHHHHHHHHHTTTS
T ss_pred CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHc----CCCHHHeeecccchhhhccC
Confidence 36788999999999999999999999999999999999 99999999999999999875
|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|