Citrus Sinensis ID: 004937

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720---
MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELKPEKELNLEKELRLEKDLKSEPKTKSSILVKKQTKKHFSRTIQEPVGSDFSSGATLATTGDIQNGSVATQAGGCERPTNTDAIVDGNSSLADNNLEKVEELSSAKGLLSKLGRKPAVPDENRRATYSISTQPVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKLQSTADVRKDDTAFRIPIPAKVHPVHRPISEGNSPLFRPANGLTPEGKTPHFSSAGKKPSTPVNAIKQKHNPFSRTSAEPENKVSKQVELNLPPSANQSKGDTVAGKQVSVKLETGVSRSTEMVPRNMHLLQSSPSKQQNGNVTSNSGNARVISPSSNNVPSQMAGAATFFPHGPEQGRSDSVHLMKTLNEKAQKQQNSSNQSAINTPPVMPSVPSVRRDDSGNAAAVAARAWMSIGAGGFKPPAENSTSPKNQISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAHFQNRPMVFPQLLTNDFARFQMQSPWRGLSPHSQPRPRQEGLPPDLNISFQSPGSPVKQSTGVLVDSQQPDLALQL
ccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHccHHHHHccHHHHHccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccHHHccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEHcccccccHHHHHHcccccccccccccccccccccccccHcccccccEEEEccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHccc
MPDKKSLELILDKLqkkdtygvyaepvdpeelpdyhdvienpmDFTTVRKKLangsyssldqfESDVFLICTNamqynapdtvYHKQARAIQELAKKKFHRLRAGIersekelkpekeLNLEKELRLEKdlksepktkssiLVKKQTKKHFsrtiqepvgsdfssgatlattgdiqngsvatqaggcerptntdaivdgnssladnnlEKVEELSSAKGLlsklgrkpavpdenrratysistqpvvrsdsifttfeGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALpagckfgrgwvgeyeplptpvlmLETCTQKESALFSKLQStadvrkddtafripipakvhpvhrpisegnsplfrpangltpegktphfssagkkpstpvnaikqkhnpfsrtsaepenkvskqvelnlppsanqskgdtvagkQVSVKLEtgvsrstemvprnmhllqsspskqqngnvtsnsgnarvispssnnvpsqmagaatffphgpeqgrsdSVHLMKTLNEKAQKQqnssnqsaintppvmpsvpsvrrddsgNAAAVAARAWMsigaggfkppaenstspknqisaeslynptreFHTQIsrargefplsvgmqfqteknsfppqgfmpqpvravneahfqnrpmvfpqllTNDFARfqmqspwrglsphsqprprqeglppdlnisfqspgspvkqstgvlvdsqqpdlalql
MPDKKSLELILDklqkkdtygvyaepvdpeelpdyhDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRagiersekelkpekelnlekelrlekdlksepktkssilvkkqtkkhfsrtiqepvgsdfsSGATLATTGDIQNGSVATQAGGCERPTNTDAIVDGNSSLADNNLEKVEELSsakgllsklgrkpavpdenrratysistqpvvrsdSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKLQSTADVRKDDTAfripipakvhpvhrpisegnsPLFRPANGLTPEGKTPhfssagkkpstpvnaikqkhnpfsrtsaepeNKVSKQVELNLppsanqskgdtvagkqvsVKLETgvsrstemVPRNMhllqsspskqqngnVTSNSGNARVISPSSNNVPSQMAGAATFFPHGPEQGRSDSVHLMKTLNEKAQKQqnssnqsaintppvMPSVPSVRRDDSGNAAAVAARAWMSIGAGGFKPPAENSTSPKNQISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAHFQNRPMVFPQLLTNDFARFQMQSPWRGLSPHSQPRPRQEGLPPDLNISFQSPgspvkqstgvlvdsqqpdlalql
MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIersekelkpekelnlekelrlekdlksePKTKSSILVKKQTKKHFSRTIQEPVGSDFSSGATLATTGDIQNGSVATQAGGCERPTNTDAIVDGNSSLADNNLEKVEElssakgllsklgRKPAVPDENRRATYSISTQPVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKLQSTADVRKDDTAFRIPIPAKVHPVHRPISEGNSPLFRPANGLTPEGKTPHFSSAGKKPSTPVNAIKQKHNPFSRTSAEPENKVSKQVELNLPPSANQSKGDTVAGKQVSVKLETGVSRSTEMVPRNMHLLQSSPSKQQNGNVTSNSGNARVISPSSNNVPSQMAGAATFFPHGPEQGRSDSVHLMKTLNEkaqkqqnssnqsaINTppvmpsvpsvRRDDSGNAAAVAARAWMSIGAGGFKPPAENSTSPKNQISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAHFQNRPMVFPQLLTNDFARFQMQSPWRGLSPHSQPRPRQEGLPPDLNISFQSPGSPVKQSTGVLVDSQQPDLALQL
********LILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKF*************************************************************************************************************************************************PVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKL**********TAFRIPIP******************************************************************************************************************************************************************************************************************ARAWMSI*************************************************************************HFQNRPMVFPQLLTNDFARFQ*******************************************************
MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFH*********************************************************************************************************************************************************TTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPL**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PDLALQL
MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELKPEKELNLEKELRLEKDLKSEPKTKSS*************TIQEPVGSDFSSGATLATTGDIQNGSVATQAGGCERPTNTDAIVDGNSSLADNNLEKVEELSSAKGLLSKLGRKPAVPDENRRATYSISTQPVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKLQSTADVRKDDTAFRIPIPAKVHPVHRPISEGNSPLFRPANGLTPEGKT************PVNAIKQKHN***************QVELNLPPSAN***********VSVKLETGVSRSTEMVPRNMHLLQS*************SGNARVISPSSNNVPSQMAGAATFFPHGPEQGRSDSVHLMKTLNE*************INTPPVMPSVPS***********VAARAWMSIGAGGFKP**********QISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAHFQNRPMVFPQLLTNDFARFQMQSPW**************GLPPDLNISFQSPGSPVKQSTGVLVDSQQPDLALQL
MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELK***************************************************GATLATTGDIQNGSVATQAGGCER*****************NLEKVEELSSAKGLLSKLGRKPAVPDENRRATYSISTQPVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLML*****************************************************************************************************E*****S***************************************************************************************VH********************************************************************NQISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAHFQNRPMVFPQLLTNDFARFQMQSPWRGLS**********GLPPDLNISFQ******************PD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELKPEKELNLEKELRLEKDLKSEPKTKSSILVKKQTKKHFSRTIQEPVGSDFSSGATLATTGDIQNGSVATQAGGCERPTNTDAIVDGNSSLADNNLEKVEELSSAKGLLSKLGRKPAVPDENRRATYSISTQPVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKLQSTADVRKDDTAFRIPIPAKVHPVHRPISEGNSPLFRPANGLTPEGKTPHFSSAGKKPSTPVNAIKQKHNPFSRTSAEPENKVSKQVELNLPPSANQSKGDTVAGKQVSVKLETGVSRSTEMVPRNMHLLQSSPSKQQNGNVTSNSGNARVISPSSNNVPSQMAGAATFFPHGPEQGRSDSVHLMKTLNEKAQKQQNSSNQSAINTPPVMPSVPSVRRDDSGNAAAVAARAWMSIGAGGFKPPAENSTSPKNQISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAHFQNRPMVFPQLLTNDFARFQMQSPWRGLSPHSQPRPRQEGLPPDLNISFQSPGSPVKQSTGVLVDSQQPDLALQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query723 2.2.26 [Sep-21-2011]
Q9ULD41205 Bromodomain and PHD finge yes no 0.211 0.126 0.358 2e-19
O956961058 Bromodomain-containing pr no no 0.120 0.082 0.459 1e-16
Q3UQU0596 Bromodomain-containing pr no no 0.124 0.151 0.444 1e-15
Q6NVM8596 Bromodomain-containing pr no no 0.127 0.154 0.434 1e-15
Q6GLP7527 Bromodomain-containing pr N/A no 0.127 0.174 0.434 1e-15
Q9H8M2597 Bromodomain-containing pr no no 0.124 0.150 0.444 2e-15
Q7ZUF2631 Bromodomain-containing pr no no 0.124 0.142 0.422 5e-15
Q5ZKG2651 Bromodomain-containing pr no no 0.146 0.162 0.351 5e-15
O88665651 Bromodomain-containing pr no no 0.146 0.162 0.324 2e-13
Q5R8B0651 Bromodomain-containing pr no no 0.146 0.162 0.324 3e-13
>sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 88/156 (56%), Gaps = 3/156 (1%)

Query: 1   MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSL 60
           MP    L   LD LQ+KD   ++AEPV+  E+PDY + I  PMDF+T+R+KL +  Y +L
Sbjct: 592 MPFNVLLRTTLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYRTL 651

Query: 61  DQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELKPEKELN 120
           ++FE D  LI TN M+YNA DT++H+ A  +++L        R   E    +  PE+  +
Sbjct: 652 EEFEEDFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYD--PERGTH 709

Query: 121 LEKELRLEKDLKSEPKTKSSILVKKQTKKHFSRTIQ 156
           L +  +LE   +   +   +IL+  + + H S  +Q
Sbjct: 710 LPESPKLEDFYRFSWEDVDNILI-PENRAHLSPEVQ 744
Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Homo sapiens (taxid: 9606)
>sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 Back     alignment and function description
>sp|Q3UQU0|BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus GN=Brd9 PE=2 SV=1 Back     alignment and function description
>sp|Q6NVM8|BRD9_XENTR Bromodomain-containing protein 9 OS=Xenopus tropicalis GN=brd9 PE=2 SV=1 Back     alignment and function description
>sp|Q6GLP7|BRD9_XENLA Bromodomain-containing protein 9 OS=Xenopus laevis GN=brd9 PE=2 SV=1 Back     alignment and function description
>sp|Q9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens GN=BRD9 PE=1 SV=2 Back     alignment and function description
>sp|Q7ZUF2|BRD9_DANRE Bromodomain-containing protein 9 OS=Danio rerio GN=brd9 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKG2|BRD7_CHICK Bromodomain-containing protein 7 OS=Gallus gallus GN=BRD7 PE=2 SV=1 Back     alignment and function description
>sp|O88665|BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus GN=Brd7 PE=1 SV=1 Back     alignment and function description
>sp|Q5R8B0|BRD7_PONAB Bromodomain-containing protein 7 OS=Pongo abelii GN=BRD7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query723
359494049 898 PREDICTED: uncharacterized protein LOC10 0.991 0.798 0.673 0.0
147776966 923 hypothetical protein VITISV_007685 [Viti 0.980 0.768 0.638 0.0
255578078 933 bromodomain-containing protein [Ricinus 0.994 0.770 0.653 0.0
356524269793 PREDICTED: uncharacterized protein LOC10 0.951 0.867 0.577 0.0
449517595 881 PREDICTED: uncharacterized protein LOC10 0.950 0.779 0.584 0.0
449444206 903 PREDICTED: uncharacterized protein LOC10 0.950 0.760 0.582 0.0
356524267 862 PREDICTED: uncharacterized protein LOC10 0.955 0.801 0.564 0.0
356569782 833 PREDICTED: uncharacterized protein LOC10 0.957 0.830 0.569 0.0
357494567 959 Bromodomain-containing protein [Medicago 0.969 0.730 0.546 0.0
356569784 857 PREDICTED: uncharacterized protein LOC10 0.951 0.802 0.558 0.0
>gi|359494049|ref|XP_002277977.2| PREDICTED: uncharacterized protein LOC100267501 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/735 (67%), Positives = 563/735 (76%), Gaps = 18/735 (2%)

Query: 1   MPDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSL 60
           +PDKKSLELILDKLQKKD YGVYAEPVDPEELPDYHDVIE+PMDF TVRKKL NGSY + 
Sbjct: 170 LPDKKSLELILDKLQKKDIYGVYAEPVDPEELPDYHDVIEHPMDFATVRKKLGNGSYRTF 229

Query: 61  DQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELKPEKELN 120
           ++FESDVFLICTNAMQYNAPDT+YHKQARAIQELA+KKF +LR  I RSEKELK E+   
Sbjct: 230 EEFESDVFLICTNAMQYNAPDTIYHKQARAIQELARKKFQKLRIDIGRSEKELKSEQ--- 286

Query: 121 LEKELRLEKDLKSEPKTKSSILVKKQTKKHFSRTIQEPVGSDFSSGATLATTGDIQNGSV 180
           L+ E R EKDLKSE K +S+ LVKKQ KK   RT QEPVGSDFSSGATLAT GD+QNG  
Sbjct: 287 LKPE-RSEKDLKSEQKMRSNPLVKKQIKKPIFRTAQEPVGSDFSSGATLATMGDVQNGFN 345

Query: 181 ATQAGGCERPTNTDA-IVDGNSSLADNNLEKVEELSSAKGLLSKLGRKPAVPDENRRATY 239
           ATQAGGCERP+N D  I++ N S  DNNLEK EEL S KGLLSK GRKP V DENRRATY
Sbjct: 346 ATQAGGCERPSNVDGLIIESNPSQIDNNLEKAEELFSGKGLLSKFGRKPFVVDENRRATY 405

Query: 240 SISTQPVVRSDSIFTTFEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQ 299
           SIS QP+V S++IF TFE E K LVAVGLHA++SYARSLARFAATLGPVAWKVAS+RIEQ
Sbjct: 406 SISNQPIVGSETIFNTFEAEAKQLVAVGLHADHSYARSLARFAATLGPVAWKVASQRIEQ 465

Query: 300 ALPAGCKFGRGWVGEYEPLPTPVLMLETCTQKESALFSKLQSTADVRKDDTAFRIPIPAK 359
           ALP G KFGRGWVGE+EPLPTPVLMLET  QKE  L  KLQ  A +RKD+   + P+PAK
Sbjct: 466 ALPVGSKFGRGWVGEFEPLPTPVLMLETRIQKEPFLVPKLQHNAVLRKDEKISKPPVPAK 525

Query: 360 VHPVHRPISEGNSPLFRPANGLTPEGKTPHFSSAGKKPSTPVNAIKQKHNPFSRTSAEPE 419
            H V  P  EG   LF PA+  T E K P F SAG K + PVN   Q+ NP SR   +PE
Sbjct: 526 EHSVSGPTLEGKQSLFCPASAPTTERKQPLFGSAGTKSTPPVNTGNQQQNPLSRNFTQPE 585

Query: 420 NKVSKQVELNLPPSANQSKGDTVAGKQVSVKLETGVSRSTEMVPRNMHLLQSSPSK---- 475
            KV KQVELN PPSA+Q+  D V+ KQ+    E    RS E V R+ ++LQS P K    
Sbjct: 586 KKVLKQVELNCPPSASQNHADLVSEKQLLNGSEAATPRSMEAVSRSRNILQSLPFKLPDT 645

Query: 476 -------QQNGNVTSNSGNARVISPSSNNVPSQMAGAATFFPHGPEQGRSDSVHLMKTLN 528
                    NG  +S     ++I  +S+ VPSQ+A   T+ PHG EQG SD V LM+ L 
Sbjct: 646 NGVVAGGLTNGKPSSRIDGNKMIGSASDTVPSQLARVPTYLPHGAEQGLSDPVQLMRKLA 705

Query: 529 EKAQKQQNSSNQSAINTPPVMPSVPSVRRDDSGNAAAVAARAWMSIGAGGFKPPAENSTS 588
           EKAQKQQ SSN S +++PP MPS+PS  R DS NAAA AARAWMSIGAGGFKP AENS +
Sbjct: 706 EKAQKQQKSSNHSPVDSPPAMPSIPSP-RSDSSNAAATAARAWMSIGAGGFKPVAENSIT 764

Query: 589 PKNQISAESLYNPTREFHTQISRARGEFPLSVGMQFQTEKNSFPPQGFMPQPVRAVNEAH 648
           PKN ISA+SLYNPTRE H Q++R RGEFP+S GM FQ+EKNSFP Q F+PQPVR + EA 
Sbjct: 765 PKNHISADSLYNPTRELHPQVTRFRGEFPVSGGMHFQSEKNSFPLQAFVPQPVR-IGEAQ 823

Query: 649 FQNRPMVFPQLLTNDFARFQMQSPWRGLSPHSQPRPRQEGLPPDLNISFQSPGSPVKQST 708
           FQNRP++FPQL+T D +RFQMQSPW+GL+P++QPR RQE LPPDLNI FQ  GSPV+QS+
Sbjct: 824 FQNRPVIFPQLVTADLSRFQMQSPWQGLNPNTQPRHRQETLPPDLNIGFQPSGSPVRQSS 883

Query: 709 GVLVDSQQPDLALQL 723
           GVLVDSQQPDLALQL
Sbjct: 884 GVLVDSQQPDLALQL 898

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147776966|emb|CAN63414.1| hypothetical protein VITISV_007685 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578078|ref|XP_002529909.1| bromodomain-containing protein [Ricinus communis] gi|223530586|gb|EEF32463.1| bromodomain-containing protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356524269|ref|XP_003530752.1| PREDICTED: uncharacterized protein LOC100799986 [Glycine max] Back     alignment and taxonomy information
>gi|449517595|ref|XP_004165831.1| PREDICTED: uncharacterized protein LOC101229993 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444206|ref|XP_004139866.1| PREDICTED: uncharacterized protein LOC101204699 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356524267|ref|XP_003530751.1| PREDICTED: uncharacterized protein LOC100799455 [Glycine max] Back     alignment and taxonomy information
>gi|356569782|ref|XP_003553075.1| PREDICTED: uncharacterized protein LOC100792844 [Glycine max] Back     alignment and taxonomy information
>gi|357494567|ref|XP_003617572.1| Bromodomain-containing protein [Medicago truncatula] gi|355518907|gb|AET00531.1| Bromodomain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356569784|ref|XP_003553076.1| PREDICTED: uncharacterized protein LOC100793896 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query723
TAIR|locus:2151948916 AT5G55040 "AT5G55040" [Arabido 0.492 0.388 0.482 3.2e-119
TAIR|locus:2030422652 AT1G20670 "AT1G20670" [Arabido 0.142 0.157 0.728 5e-69
TAIR|locus:2014594580 AT1G76380 "AT1G76380" [Arabido 0.142 0.177 0.699 4.2e-62
UNIPROTKB|E1C0A51171 BRPF3 "Uncharacterized protein 0.121 0.075 0.5 5.7e-16
UNIPROTKB|E9PSF3821 BRPF3 "Bromodomain and PHD fin 0.130 0.114 0.468 2.1e-15
UNIPROTKB|B7ZLN5871 BRPF3 "Bromodomain and PHD fin 0.130 0.107 0.468 2.3e-15
UNIPROTKB|Q17RB6935 BRPF3 "BRPF3 protein" [Homo sa 0.130 0.100 0.468 2.6e-15
UNIPROTKB|E2RK731207 BRPF3 "Uncharacterized protein 0.130 0.077 0.468 4.9e-14
UNIPROTKB|J9NVN91209 BRPF3 "Uncharacterized protein 0.130 0.077 0.468 4.9e-14
UNIPROTKB|E9PI601106 BRPF3 "Bromodomain and PHD fin 0.130 0.084 0.468 4.9e-14
TAIR|locus:2151948 AT5G55040 "AT5G55040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 755 (270.8 bits), Expect = 3.2e-119, Sum P(2) = 3.2e-119
 Identities = 181/375 (48%), Positives = 228/375 (60%)

Query:   136 KTKSSILVKKQTKKHFSRTIQEPVGSDFSSGATLATTGDIQNGSVATQAGGCERPTNTDA 195
             K K    VKKQ ++ FSR   E VGSDFSSGA LA+ G  QN  V+TQ GG E+ + TD 
Sbjct:   302 KVKPDSSVKKQVRQPFSRNGLEAVGSDFSSGANLASGGASQNEPVSTQIGGHEKHSYTDV 361

Query:   196 IVDGNSSLADNNLEKVEEXXXXXXXXXXXXRKPAVPDENRRATYSISTQPVVRSDSIFTT 255
             + +GN+SL D+ LEK E+            RK +V +E+RRATY  S Q   RS+SIFTT
Sbjct:   362 LFEGNTSLVDS-LEKAEDLSSGKGLFGKCGRKLSVVEEDRRATYEDSDQQGDRSESIFTT 420

Query:   256 FEGETKHLVAVGLHAEYSYARSLARFAATLGPVAWKVASRRIEQALPAGCKFGRGWVGEY 315
             FE E K  VAVGLHAE++Y RSLARFAATLGPVAWK+AS+RIEQALPA  KFGRGWVGEY
Sbjct:   421 FESEIKQFVAVGLHAEHAYGRSLARFAATLGPVAWKIASQRIEQALPADFKFGRGWVGEY 480

Query:   316 EPLPTPVLMLETCTQKE----SALFSKLQSTADVRKDDTAFRIPIPAKVHPVHRPISEGN 371
             EPLPTPVL+ ETCT KE    +++FSK +S A  + ++T F+ P+PAK     RP+ +GN
Sbjct:   481 EPLPTPVLLFETCTPKEPPKKASVFSKRKSNAATKTNETLFKTPLPAKEQQGSRPVRDGN 540

Query:   372 SPLFRPAN-GLTPEGKTPHF--SSAGKKPSTPVNAIKQKHNPFSRTSAEPENKVSKQVEL 428
                  PA+ G   EG +P F  +  G   S   +  +   NP      +P+N++ +QVEL
Sbjct:   541 HAFPFPASIGALSEG-SPSFVATQVGNLKSMSQHEYR---NPSQLDFVKPQNRIPQQVEL 596

Query:   429 NLPPSANQSKGDT--VAGKQVSVKLETGVS-RSTEMVPRNMHLLQSSPSKQQ---NGNVT 482
             NLPP A Q+   +  V   Q   K +T  S RS+  + RNM    S   K Q   NG   
Sbjct:   597 NLPPPAEQTNSGSGCVLENQSFGKSDTVASYRSSSDMMRNMSSTDSEHYKHQMTTNGIFP 656

Query:   483 SNSGNARVISPSSNN 497
                 N +V SP  NN
Sbjct:   657 GGLRNGKV-SPGVNN 670
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
TAIR|locus:2030422 AT1G20670 "AT1G20670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014594 AT1G76380 "AT1G76380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0A5 BRPF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSF3 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZLN5 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q17RB6 BRPF3 "BRPF3 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RK73 BRPF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NVN9 BRPF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PI60 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027307001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (784 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query723
cd0436999 cd04369, Bromodomain, Bromodomain 7e-33
smart00297107 smart00297, BROMO, bromo domain 2e-31
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 1e-28
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-27
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-26
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 4e-26
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 2e-24
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 5e-23
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 4e-22
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 3e-20
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 2e-19
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 5e-17
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 5e-17
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 2e-16
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 1e-15
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 6e-15
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 1e-14
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 2e-14
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-14
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 2e-14
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 4e-13
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 7e-13
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 5e-12
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 7e-12
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-11
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 2e-11
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 3e-11
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 7e-11
COG5076371 COG5076, COG5076, Transcription factor involved in 9e-11
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 1e-10
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 5e-10
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 6e-09
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 6e-07
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 2e-04
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 3e-04
cd05526110 cd05526, Bromo_polybromo_VI, Bromodomain, polybrom 3e-04
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 0.003
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information 
 Score =  121 bits (306), Expect = 7e-33
 Identities = 47/99 (47%), Positives = 68/99 (68%), Gaps = 2/99 (2%)

Query: 3  DKKSLELILDKLQKK--DTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSL 60
           KK L  +LD L+K   D    + EPVDP+E PDY++VI+NPMD +T++KKL NG Y SL
Sbjct: 1  LKKKLRSLLDALKKLKRDLSEPFLEPVDPKEAPDYYEVIKNPMDLSTIKKKLKNGEYKSL 60

Query: 61 DQFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKF 99
          ++FE+DV LI +NA  YN P +  +K A+ +++L +K  
Sbjct: 61 EEFEADVRLIFSNAKTYNGPGSPIYKDAKKLEKLFEKLL 99

Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine. Length = 99
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99956 cd05526, Bromo_polybromo_VI, Bromodomain, polybromo repeat VI Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 723
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.91
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.91
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.91
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.9
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.9
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.9
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.9
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.9
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.9
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.89
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.89
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.89
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.89
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.89
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.89
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.88
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.88
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.88
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.88
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.87
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.87
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.86
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.86
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.86
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.85
KOG1474640 consensus Transcription initiation factor TFIID, s 99.85
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.85
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.85
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.84
smart00297107 BROMO bromo domain. 99.84
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.84
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.83
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.82
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.81
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.81
KOG09551051 consensus PHD finger protein BR140/LIN-49 [General 99.8
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.78
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.7
COG5076371 Transcription factor involved in chromatin remodel 99.62
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.56
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.33
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.99
KOG00081563 consensus Transcription initiation factor TFIID, s 98.9
KOG1827629 consensus Chromatin remodeling complex RSC, subuni 98.89
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.87
KOG00081563 consensus Transcription initiation factor TFIID, s 98.81
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.75
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.37
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 98.36
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.0
KOG1474640 consensus Transcription initiation factor TFIID, s 97.83
COG5076371 Transcription factor involved in chromatin remodel 96.45
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.2
KOG06441113 consensus Uncharacterized conserved protein, conta 83.3
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information 
Probab=99.91  E-value=9.4e-25  Score=196.17  Aligned_cols=96  Identities=32%  Similarity=0.449  Sum_probs=93.4

Q ss_pred             cHHHHHHHHHHHHccCCCCcccCCCCCCCCCChhhhcCCccCHHHHHHHHhcCCCCCHHHHHHHHHHHHHhhhhcCCCCC
Q 004937            3 DKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPDT   82 (723)
Q Consensus         3 dkK~Le~ILd~L~k~d~s~pF~ePVd~eelPDYYeIIKkPMDLsTIkkKLkng~Y~SieEF~~DV~LIf~NA~~YN~pdS   82 (723)
                      |.++|..||+.|++++.+++|..||++..+||||++|++||||+||++||+++.|.++++|.+||.|||.||+.||+++|
T Consensus         1 ~~~~c~~il~~l~~~~~s~~F~~pv~~~~~pdY~~iIk~PmDL~tI~~kl~~~~Y~s~~ef~~D~~li~~Na~~yN~~~s   80 (97)
T cd05505           1 ELQKCEEILSKILKYRFSWPFREPVTADEAEDYKKVITNPMDLQTMQTKCSCGSYSSVQEFLDDMKLVFSNAEKYYENGS   80 (97)
T ss_pred             CHHHHHHHHHHHHhCCCcccccCCCChhhcccHHHHcCCcCCHHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHH
Q 004937           83 VYHKQARAIQELAKKK   98 (723)
Q Consensus        83 ~Iyk~A~~Le~lfek~   98 (723)
                      .+|.+|..|++.|...
T Consensus        81 ~i~~~a~~le~~f~~~   96 (97)
T cd05505          81 YVLSCMRKTEQCCVNL   96 (97)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            9999999999998764

The Williams-Beuren syndrome deletion transcript 9 is a putative transcriptional regulator. WSTF was found to play a role in vitamin D-mediated transcription as part of two chromatin remodeling complexes, WINAC and WICH. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query723
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 2e-16
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 3e-16
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 9e-16
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 8e-14
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 2e-11
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 5e-11
2e7n_A117 Solution Structure Of The Second Bromodomain From H 6e-11
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 8e-11
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 1e-10
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 1e-10
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 2e-10
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 2e-10
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 3e-10
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 4e-10
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 4e-10
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 4e-10
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 8e-10
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 1e-09
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 1e-09
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-09
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-09
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 2e-09
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 3e-09
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 4e-09
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 4e-09
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 6e-09
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 7e-09
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 8e-09
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 1e-08
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 2e-08
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 3e-08
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 4e-08
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 4e-08
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 4e-08
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 4e-08
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 5e-08
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 5e-08
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 8e-08
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 2e-07
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 3e-07
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 3e-07
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 3e-07
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 3e-07
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 3e-07
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 3e-07
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 3e-07
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 4e-07
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 4e-07
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 4e-07
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 8e-07
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 9e-07
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-06
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 1e-06
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 1e-06
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 1e-06
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 2e-06
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 3e-06
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 4e-06
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 4e-06
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 4e-06
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 7e-06
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 8e-06
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 9e-06
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 9e-06
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 1e-05
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 1e-05
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 1e-05
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-05
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 1e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 3e-05
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 6e-05
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 3e-04
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 5e-04
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 6e-04
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure 
Iteration: 1

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/87 (45%), Positives = 60/87 (68%)
Query: 7   LELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESD 66
           L  +LD+LQ KD   ++A+PV  +E+PDY D I++PMDF T+RK+L    Y +L +FE D
Sbjct: 18  LRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEED 77
Query: 67  VFLICTNAMQYNAPDTVYHKQARAIQE 93
             LI  N M+YNA DTV+++ A  +++
Sbjct: 78  FDLIIDNCMKYNARDTVFYRAAVRLRD 104
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query723
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 6e-47
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 4e-46
2d9e_A121 Peregrin; four-helix bundle, transcription activat 3e-45
3rcw_A135 Bromodomain-containing protein 1; transcription, s 5e-45
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 2e-40
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 9e-40
3dai_A130 ATPase family AAA domain-containing protein 2; anc 2e-39
3uv4_A158 Second bromodomain of human transcription initiat 2e-38
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 2e-38
2grc_A129 Probable global transcription activator SNF2L4; br 2e-37
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-37
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-29
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 5e-37
3p1f_A119 CREB-binding protein; structural genomics consorti 1e-36
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-36
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-28
3d7c_A112 General control of amino acid synthesis protein 5; 2e-36
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 7e-36
3nxb_A116 CAT eye syndrome critical region protein 2; struct 2e-34
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-33
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 4e-33
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-33
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 8e-33
2dat_A123 Possible global transcription activator SNF2L2; br 3e-32
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 9e-32
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-31
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 2e-31
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 3e-30
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-30
4alg_A154 Bromodomain-containing protein 2; signaling protei 2e-29
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 4e-29
2r0y_A311 Chromatin structure-remodeling complex protein RSC 6e-29
2r0y_A311 Chromatin structure-remodeling complex protein RSC 5e-23
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-29
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 3e-28
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-27
2r10_A361 Chromatin structure-remodeling complex protein RSC 4e-27
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-20
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-24
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 3e-20
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 4e-13
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
 Score =  161 bits (409), Expect = 6e-47
 Identities = 35/109 (32%), Positives = 64/109 (58%)

Query: 2   PDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLD 61
           P +++L  ++ +LQ+KD    ++ PV     P Y  +I++PMDF+T+++K+ N  Y S++
Sbjct: 8   PLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIE 67

Query: 62  QFESDVFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSE 110
           + + +  L+CTNAM YN P+T+Y+K A+ +     K   + R       
Sbjct: 68  ELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERLEHHHHH 116
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query723
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.92
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.92
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.92
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.92
3d7c_A112 General control of amino acid synthesis protein 5; 99.92
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.91
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.91
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.91
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.91
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.91
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.91
2grc_A129 Probable global transcription activator SNF2L4; br 99.91
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
2dat_A123 Possible global transcription activator SNF2L2; br 99.9
3uv4_A158 Second bromodomain of human transcription initiat 99.9
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.9
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.9
3p1f_A119 CREB-binding protein; structural genomics consorti 99.9
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.9
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.9
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.9
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.9
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.9
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.89
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.88
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.88
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.88
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.87
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.87
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.86
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.84
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.84
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.83
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.83
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.82
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.8
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.79
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.72
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.71
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.69
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.33
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=2.2e-25  Score=205.37  Aligned_cols=107  Identities=36%  Similarity=0.575  Sum_probs=102.8

Q ss_pred             CcHHHHHHHHHHHHccCCCCcccCCCCCCCCCChhhhcCCccCHHHHHHHHhcCCCCCHHHHHHHHHHHHHhhhhcCCCC
Q 004937            2 PDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPD   81 (723)
Q Consensus         2 PdkK~Le~ILd~L~k~d~s~pF~ePVd~eelPDYYeIIKkPMDLsTIkkKLkng~Y~SieEF~~DV~LIf~NA~~YN~pd   81 (723)
                      |....|..||+.|++++.+++|.+||++..+||||++|++||||+||++||+++.|.++++|+.||+|||.||+.||+++
T Consensus         7 pl~~~l~~il~~l~~~~~~~~F~~pv~~~~~pdY~~iIk~PmdL~tI~~kl~~~~Y~s~~ef~~D~~li~~Na~~yN~~~   86 (121)
T 2d9e_A            7 GFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKD   86 (121)
T ss_dssp             HHHHHHHHHHHHHHHHCSSCSSSSCCCTTTCTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred             HHHHHHHHHHHHHHcCCccHhhCCcCCccccCCHHHHcCCCcCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHCCCC
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHhHHH
Q 004937           82 TVYHKQARAIQELAKKKFHRLRAGIER  108 (723)
Q Consensus        82 S~Iyk~A~~Le~lfek~~kkL~~eie~  108 (723)
                      |.+|.+|..|++.|++.|++++..++.
T Consensus        87 s~~~~~A~~L~~~~~~~l~~~~~~~~~  113 (121)
T 2d9e_A           87 TIFYRAAVRLREQGGAVLRQARRQAEK  113 (121)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999998876554
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 723
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 1e-31
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 2e-31
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 3e-28
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 3e-28
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 2e-27
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 5e-26
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: TAFII250 double bromodomain module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  117 bits (295), Expect = 1e-31
 Identities = 28/109 (25%), Positives = 54/109 (49%)

Query: 7   LELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESD 66
           LE I++ ++       +  PV+ + + DY+ +I  PMD  T+R+ +    Y S ++F   
Sbjct: 31  LESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREH 90

Query: 67  VFLICTNAMQYNAPDTVYHKQARAIQELAKKKFHRLRAGIERSEKELKP 115
           + LI  N+  YN P     + ++++ +L  +K       + R EK + P
Sbjct: 91  LELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINP 139
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query723
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.92
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.91
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.9
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.9
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.9
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.92  E-value=2e-25  Score=200.41  Aligned_cols=102  Identities=31%  Similarity=0.563  Sum_probs=99.2

Q ss_pred             CcHHHHHHHHHHHHccCCCCcccCCCCCCCCCChhhhcCCccCHHHHHHHHhcCCCCCHHHHHHHHHHHHHhhhhcCCCC
Q 004937            2 PDKKSLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIENPMDFTTVRKKLANGSYSSLDQFESDVFLICTNAMQYNAPD   81 (723)
Q Consensus         2 PdkK~Le~ILd~L~k~d~s~pF~ePVd~eelPDYYeIIKkPMDLsTIkkKLkng~Y~SieEF~~DV~LIf~NA~~YN~pd   81 (723)
                      |+++.|+.||+.|++++.+++|..||+++.+|+||++|++||||+||++||+++.|.++++|+.||+|||.||+.||+++
T Consensus         3 p~~~~l~~il~~l~~~~~a~pF~~pvd~~~~pdY~~vI~~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yN~~~   82 (111)
T d1e6ia_           3 PHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGEN   82 (111)
T ss_dssp             TTHHHHHHHHHHHHHSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred             hHHHHHHHHHHHHHhCCCChhhcCCCCchhCcCHHHHcCCchhHHHHHHHHHccccchHHHHHHHHHHHHHHHHHHCCCC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHH
Q 004937           82 TVYHKQARAIQELAKKKFHRLR  103 (723)
Q Consensus        82 S~Iyk~A~~Le~lfek~~kkL~  103 (723)
                      |.++.+|..|++.|++.++++.
T Consensus        83 s~i~~~A~~l~~~f~~~~~~ip  104 (111)
T d1e6ia_          83 TSYYKYANRLEKFFNNKVKEIP  104 (111)
T ss_dssp             SHHHHHHHHHHHHHHHHHHTSG
T ss_pred             CHHHHHHHHHHHHHHHHHHHhh
Confidence            9999999999999999887653
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure