Citrus Sinensis ID: 005273

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700----
MSLNLKLHSGFLSLALPYYSCCSTPRTRHLRSRNQTVPAIRCAKRTGKQRYPSEKKKLKQKHKQVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY
ccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccEEEEEEEEEEcccccccccccHHHHHHHHHcccHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccEEEEccEEcEEEEEccEEEEEEEcccccccccccEEEEEcEEEEcccccHHHHHHHHHHccEEEEEcccEEEEEEEccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccccccccccccccEEEEEccccccEEEEccccccEEEEcccccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEEcccHHHHHccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccEEEccccccccccccccEEEccccccccHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHcccccccccc
ccccEEEEccccccccccccccccccccHEccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHcccHHHHccccccEEEEEcccHHcccccEEEEEEEEEEEccHHHHHHHHHccccccccccccEHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEcccHHHHHHHHHHHHcccccEEEEccccHHHccHHHHHHHHccccccccccEEccccccccccccEEEEccccccHHHHHHHHHHHccccHHHHEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEccEEEEEEEEcccccccccccEEcccEEEEEEcccHHHHHHHHHHcccEEEcccEEEEEEEccccHHHHHHHcccccccccccccccccccEEEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccEEEcccccccccHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccccHHEHHHHHccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHccccccccEEEEcEEEcccccEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccEEEc
mslnlklhSGFLSlalpyysccstprtrhlrsrnqtvpaircakrtgkqrypsekkKLKQKHKQVLNDVNNKFEGFWRLsklavpvhkdpgkdfiGVSHALLDEITKVLqfpvasmlpaeaFTVVRKSFdarkvlkepkfvytvdmdvsklldleprTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDckkvsddtllRKEIssgseglynyprtrkpkvavvgggpsGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMesnfcfgeggagtwsdgklvtrigrnsNSVLAVMNTLVhfgapanilvdgkshlgtdrlIPLLRNFRQHLQRLGvtikfgtrVDDLLIENARIVgvkvsdskdnsqsdIQKLGFDAVILAVGHSARDIYEMLVSHninlvpkdfavGLRMEHPQELINSIQYSELATEVqkgrgkvpvadykvakyvsgedgdalsgvvttnrscysfcmcpggqivltstnplelcingmsfsrrssRWANAALVVTVsakdfdtldlhgplagVKFQREFEQRAAImgggnfvvpaQKVTDFLenklsasplppssyrlgvkaaslhelfptHLTDALKHSISMfdeelpgfisdtgllhgvetrtscplqiprnnetcestslkglypvgegagyagGIVSAAADGMYAGFAVakdfglfpaDIESILGKAQAAGFAKY
MSLNLKLHSGFLSLALPYYSCCSTprtrhlrsrnqtvpaircakrtgkqrypsekkklkqkhkQVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFtvvrksfdarkvlkepkfvytvdmdvsklldleprTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDckkvsddtllRKEISsgseglynyprtrkPKVAVVGGGPSGLFASLVLAELGADVTLiergqaveqrgrDIGALVVRRMLEMESNfcfgeggagtwsdGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVtikfgtrvddLLIENARIvgvkvsdskdnsqsdIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATevqkgrgkvpvaDYKVAKyvsgedgdalsGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETrtscplqiprnnetcestsLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAqaagfaky
MSLNLKLHSGFLSLALPYYSCCSTPRTRHLRSRNQTVPAIRCAKRTGKQRYPSEkkklkqkhkqVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY
*****KLHSGFLSLALPYYSCCSTPRT*************************************VLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEI****EGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKV**********IQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENK**********YRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKA********
*******HSGFLSLALPYYSCCSTPRTRHLRSRNQTVPAI***********************************FWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENK**A******SYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFP*********AQ*A*****
MSLNLKLHSGFLSLALPYYSCCSTPRTRHLRSRNQTVPAIRCAKR******************QVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVK*********SDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY
*SLNLKLHSGFLSLALPYYSCCSTPRTRHLRSRNQTVPAIRCAKRTGKQRYPSEKKKLKQKHKQVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGE*G***S**VTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLNLKLHSGFLSLALPYYSCCSTPRTRHLRSRNQTVPAIRCAKRTGKQRYPSEKKKLKQKHKQVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query704 2.2.26 [Sep-21-2011]
Q05627533 Uncharacterized protein C yes no 0.717 0.947 0.372 2e-89
>sp|Q05627|Y202_CLOB8 Uncharacterized protein Cbei_0202 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_0202 PE=4 SV=2 Back     alignment and function desciption
 Score =  330 bits (847), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 207/555 (37%), Positives = 317/555 (57%), Gaps = 50/555 (9%)

Query: 137 EPKFVYTVDM---DVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKK 193
           E K    ++M   D+S+L D+  R+ D   + + KV    ++  K+    L++ IHD K 
Sbjct: 20  EKKICKKLNMSKEDISRL-DIIKRSIDARKKNDIKVSFSVNVFCKKEKM-LLSRIHD-KD 76

Query: 194 VSDDTLLRKE-ISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQ 252
           +S + +   E I SG+E +       K +  VVG GP+G+FA+L LA  G    + ERG+
Sbjct: 77  ISFEEIREIESIKSGTEEI-------KARPVVVGFGPAGIFAALTLARYGYKPIVYERGE 129

Query: 253 AVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHF 312
            V++R   +        L +ESN  FGEGGAG +SDGKL TRI  +  S   V++ L+  
Sbjct: 130 DVDKRTETVEKFWKDGRLNLESNVQFGEGGAGAFSDGKLTTRIKDHRCSF--VLDELIKA 187

Query: 313 GAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSD 372
           GAPA I  + K+H+GTD L  +++N R+ ++RLG  + F ++++ +  ++ ++  + V+ 
Sbjct: 188 GAPAEIKYESKAHVGTDLLKGVVKNIREEIKRLGGEVNFNSKLEKITYKDGKLESIVVNG 247

Query: 373 SKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSI 432
                    + +  +A++LA+GHS+RD YEML   N+++  K FA+G+R+EHPQELIN  
Sbjct: 248 ---------KNITCEALVLAIGHSSRDTYEMLYRENVSMDAKAFAIGVRIEHPQELINVN 298

Query: 433 QYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTS 492
           QY            K+  ADY++  Y S +            R  YSFCMCPGG +V  +
Sbjct: 299 QYGN-----NHNHPKLHAADYRLT-YQSEK----------LKRGVYSFCMCPGGVVVAAA 342

Query: 493 TNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMG 552
           +    L  NGMS+  R    AN+ALVVTVS +DF       PL G++FQR +E  A  +G
Sbjct: 343 SEEGRLVSNGMSYHARDLDNANSALVVTVSPEDFKG---SSPLRGMEFQRHYESLAFKLG 399

Query: 553 GGNFVVPAQKVTDFLENKLS---ASPLPPSSYRLGVKAASLHELFPTHLTDALKHSISMF 609
           GGN+  P Q V DF+++++S      +P  SY  G +   L E  P ++ +ALK  I  F
Sbjct: 400 GGNYKAPVQLVGDFMKDRVSTKLGEVIP--SYTAGYEFRELKECLPDYVVEALKEGIINF 457

Query: 610 DEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAA 669
           D+++ G+  +  +L G+ETRTS P+++ R N + ES ++ GLYP GEGAG+AGGI+SAA 
Sbjct: 458 DKKIKGYAREDAILTGIETRTSAPVRLNR-NASLESINVCGLYPTGEGAGFAGGIISAAV 516

Query: 670 DGMYAGFAVAKDFGL 684
           DG+     + + F L
Sbjct: 517 DGIKVAEHIIEKFDL 531

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (taxid: 290402)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query704
224142353706 predicted protein [Populus trichocarpa] 0.991 0.988 0.739 0.0
359491515704 PREDICTED: uncharacterized protein Cbei_ 0.974 0.974 0.737 0.0
255585048723 conserved hypothetical protein [Ricinus 0.950 0.925 0.741 0.0
297798894706 hypothetical protein ARALYDRAFT_491679 [ 0.951 0.949 0.715 0.0
356522858691 PREDICTED: uncharacterized protein Cbei_ 0.941 0.959 0.729 0.0
110741867714 hypothetical protein [Arabidopsis thalia 0.968 0.955 0.698 0.0
145350106707 FAD/NAD(P)-binding oxidoreductase-like p 0.968 0.964 0.698 0.0
297734339671 unnamed protein product [Vitis vinifera] 0.926 0.971 0.713 0.0
5725436761 putative protein [Arabidopsis thaliana] 0.968 0.896 0.686 0.0
449454097744 PREDICTED: uncharacterized protein Cbei_ 0.975 0.923 0.696 0.0
>gi|224142353|ref|XP_002324523.1| predicted protein [Populus trichocarpa] gi|222865957|gb|EEF03088.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1049 bits (2712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/703 (73%), Positives = 597/703 (84%), Gaps = 5/703 (0%)

Query: 7   LHSGFLSLALPYYSCCST-PRTRHLRSRNQTVPAIRCA-KRTGKQRYPSEKKKLKQKHKQ 64
           L S  L L+LP+ +  S  P         QT+P I CA KRTGKQRYPSEKKKLK KHK+
Sbjct: 4   LRSVLLPLSLPFPNSTSILPYPTRRLHHPQTLPKIICATKRTGKQRYPSEKKKLKLKHKE 63

Query: 65  VLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTV 124
            L DV NKF+G WRLSKLAV V  DPGKDF+GVS  LL EI K ++FPVASMLP EAF+V
Sbjct: 64  ALTDVKNKFDGIWRLSKLAVSVQDDPGKDFLGVSDGLLQEIAKAIKFPVASMLPPEAFSV 123

Query: 125 VRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDL 184
           +RKSFDARK+LKE KFVYTVDMDVS+L++LEPRT DFIS LE +VG +EHM  +R SGD+
Sbjct: 124 IRKSFDARKMLKEAKFVYTVDMDVSELINLEPRTRDFISDLEPRVGLIEHMPRERVSGDI 183

Query: 185 INIIHDCKKVSDDTLLRKEISSG---SEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAEL 241
           I++I DCKKV  ++LL++   +G   + G Y Y  +RKPK+AVVG GPSGLFASLVLAEL
Sbjct: 184 ISVIQDCKKVEGESLLKEGGVNGYSSNAGAYKYTGSRKPKIAVVGSGPSGLFASLVLAEL 243

Query: 242 GADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNS 301
           GADVTLIERGQ VEQRGRDIGAL+VRR+LE+ESNFCFGEGGAGTWSDGKLVTRIGRNS+S
Sbjct: 244 GADVTLIERGQPVEQRGRDIGALMVRRILELESNFCFGEGGAGTWSDGKLVTRIGRNSDS 303

Query: 302 VLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIE 361
           VLAVM TLVHFGAP NIL+DGK HLGTDRL+PLLRNFRQ+LQ  GV+IKFGTRVDDL+IE
Sbjct: 304 VLAVMKTLVHFGAPENILIDGKPHLGTDRLVPLLRNFRQNLQDQGVSIKFGTRVDDLIIE 363

Query: 362 NARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLR 421
           +  +VGVKVSDSKD  + D QKLGFDAVILAVGHSARDIY ML+SH+I+L+PKDFAVGLR
Sbjct: 364 DGHVVGVKVSDSKDKQKLDCQKLGFDAVILAVGHSARDIYHMLLSHDIDLMPKDFAVGLR 423

Query: 422 MEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFC 481
           +EHPQELINS+QYS L TEV +GRGK+PVADYKVA YVS EDG   S    T+RSCYSFC
Sbjct: 424 IEHPQELINSVQYSSLGTEVHRGRGKIPVADYKVASYVSREDGKTPSSSGPTSRSCYSFC 483

Query: 482 MCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQ 541
           MCPGGQ+VLTST+P E+CINGMSFSRR+S+WANAALVVTVS +DF++L+ HGPLAG+ FQ
Sbjct: 484 MCPGGQVVLTSTDPSEICINGMSFSRRASKWANAALVVTVSTQDFNSLNFHGPLAGIDFQ 543

Query: 542 REFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHELFPTHLTDA 601
           REFE+RAA+MGGG+FVVP Q  TDFL+ KLS + LPPSSYRLGVKAA LHELFP H+TDA
Sbjct: 544 REFERRAAVMGGGDFVVPVQTATDFLDGKLSVTSLPPSSYRLGVKAAKLHELFPMHITDA 603

Query: 602 LKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYA 661
           L+HS+S+FD+ELPGFIS+  LLHGVETRTS P+QIPR+++T ES SLKGLYPVGEGAGYA
Sbjct: 604 LRHSVSVFDKELPGFISNEALLHGVETRTSSPIQIPRSSDTYESMSLKGLYPVGEGAGYA 663

Query: 662 GGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY 704
           GGIVSAA DGM+AGFAVAK FGLF   IES+LGKAQ AGFAKY
Sbjct: 664 GGIVSAAVDGMHAGFAVAKRFGLFLDGIESVLGKAQGAGFAKY 706

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359491515|ref|XP_002278822.2| PREDICTED: uncharacterized protein Cbei_0202-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255585048|ref|XP_002533232.1| conserved hypothetical protein [Ricinus communis] gi|223526952|gb|EEF29153.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297798894|ref|XP_002867331.1| hypothetical protein ARALYDRAFT_491679 [Arabidopsis lyrata subsp. lyrata] gi|297313167|gb|EFH43590.1| hypothetical protein ARALYDRAFT_491679 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356522858|ref|XP_003530060.1| PREDICTED: uncharacterized protein Cbei_0202-like [Glycine max] Back     alignment and taxonomy information
>gi|110741867|dbj|BAE98875.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145350106|ref|NP_194801.4| FAD/NAD(P)-binding oxidoreductase-like protein [Arabidopsis thaliana] gi|332660401|gb|AEE85801.1| FAD/NAD(P)-binding oxidoreductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297734339|emb|CBI15586.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|5725436|emb|CAB52445.1| putative protein [Arabidopsis thaliana] gi|7269973|emb|CAB79790.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449454097|ref|XP_004144792.1| PREDICTED: uncharacterized protein Cbei_0202-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query704
TAIR|locus:2131954707 PDE327 "PIGMENT DEFECTIVE 327" 0.992 0.988 0.688 1.3e-256
UNIPROTKB|Q74E43533 GSU1121 "FAD-dependent oxidore 0.289 0.382 0.476 1.5e-92
TIGR_CMR|GSU_1121533 GSU_1121 "conserved hypothetic 0.289 0.382 0.476 1.5e-92
UNIPROTKB|Q9KTT2538 VC_0806 "Putative uncharacteri 0.285 0.373 0.447 8.3e-88
TIGR_CMR|VC_0806538 VC_0806 "conserved hypothetica 0.285 0.373 0.447 8.3e-88
UNIPROTKB|Q87XR2537 PSPTO_4114 "Uncharacterized pr 0.312 0.409 0.406 1.1e-87
UNIPROTKB|Q4KH66537 PFL_1288 "Pyridine nucleotide- 0.328 0.430 0.405 3.5e-85
UNIPROTKB|Q48LQ5537 PSPPH_1411 "Uncharacterized pr 0.416 0.545 0.375 3.3e-82
UNIPROTKB|Q480A7561 CPS_2911 "Putative uncharacter 0.660 0.828 0.364 8.5e-77
TIGR_CMR|CPS_2911561 CPS_2911 "conserved hypothetic 0.660 0.828 0.364 8.5e-77
TAIR|locus:2131954 PDE327 "PIGMENT DEFECTIVE 327" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2470 (874.5 bits), Expect = 1.3e-256, P = 1.3e-256
 Identities = 490/712 (68%), Positives = 579/712 (81%)

Query:     1 MSLNLKLHSGFLSLALPYYSC-CSTPRTRHLRS--RNQTVPAIRCAKRTGKQRYPSEXXX 57
             MSL+    + FLS +L   S     P +R + S  R QT   +  AKRTGK+RYPSE   
Sbjct:     1 MSLS---QTNFLSSSLLSSSHDLRIPYSRAVLSYPRIQTHRILCAAKRTGKRRYPSERRK 57

Query:    58 XXXXXXXVLNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASML 117
                     +  V NK EG WRLSKL VPV  DPGKDF+G+S  LL  I KV++FPVASML
Sbjct:    58 LRTEQKEAVAKVKNKLEGVWRLSKLGVPVGDDPGKDFLGISEGLLQAIAKVIEFPVASML 117

Query:   118 PAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHM-L 176
             P EAF+V+RKSFDARK+LKE KFVYTVD+DV  LL+LEPR  DFI RLE K+G +EH+  
Sbjct:   118 PEEAFSVIRKSFDARKILKEAKFVYTVDLDVKTLLELEPRAHDFIFRLEPKIGLIEHVPT 177

Query:   177 DKRASGDLINIIHDCKKVSDDTL---LRKEISSGSEGLYNYPRTR-KPKVAVVGGGPSGL 232
             +K  SGDLI++++DCK+++ +T       +I +GS   +++   R KPK+AVVGGGPSGL
Sbjct:   178 EKSVSGDLISVVNDCKRINSETASGEYEPQIINGSGDPHHHGGGRSKPKIAVVGGGPSGL 237

Query:   233 FASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLV 292
             FA+LVLAE GADVTLIERGQAVE+RGRDIGALVVR++L+MESNFCFGEGGAGTWSDGKLV
Sbjct:   238 FAALVLAEFGADVTLIERGQAVEERGRDIGALVVRKILDMESNFCFGEGGAGTWSDGKLV 297

Query:   293 TRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFG 352
             TRIG+NS +VLAV+ TLV FGAP NILV+GK HLGTD+L+PLLRNFR +LQ  GVTIKFG
Sbjct:   298 TRIGKNSATVLAVLKTLVRFGAPDNILVNGKPHLGTDKLVPLLRNFRHYLQSAGVTIKFG 357

Query:   353 TRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLV 412
             TRVDDLL+E++R+VGV+VSDS +  Q+  Q L  DAV+LAVGHSARD YEML S N+ L+
Sbjct:   358 TRVDDLLVEDSRVVGVRVSDSTNQLQTTSQNLKVDAVVLAVGHSARDTYEMLHSRNVELI 417

Query:   413 PKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVT 472
             PKDFAVGLR+EHPQELINSIQYS+LA EV KGRGKVPVADYKV +YV+ +  D      +
Sbjct:   418 PKDFAVGLRIEHPQELINSIQYSDLANEVLKGRGKVPVADYKVVQYVNDKTEDLSQS--S 475

Query:   473 TNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLH 532
             + RSCYSFCMCPGGQ+VLTSTNP ELCINGMSFSRRSS+WANAALVVTVSAKDFD L+L 
Sbjct:   476 SKRSCYSFCMCPGGQVVLTSTNPTELCINGMSFSRRSSKWANAALVVTVSAKDFDVLNLK 535

Query:   533 GPLAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLSASPLPPSSYRLGVKAASLHE 592
             GPLAG++FQREFE+RAAIMGGG+F VP Q+VTDFL+NKLS +PLPPSSYRLGVK+A+LHE
Sbjct:   536 GPLAGIEFQREFERRAAIMGGGDFTVPVQRVTDFLQNKLSETPLPPSSYRLGVKSANLHE 595

Query:   593 LFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLY 652
             LFP H+T+AL+ SISMF++ELPGFIS+  LLHGVETRTS P++IPR+NET ESTSLKGLY
Sbjct:   596 LFPAHITEALRESISMFEKELPGFISEEALLHGVETRTSSPVRIPRSNETYESTSLKGLY 655

Query:   653 PVGEGAGYAGGIVSAAADGMYAGFAVAKDFGLFPADIESILGKAQAAGFAKY 704
             PVGEGAGYAGGIVSAA DGM++GFAVAK F LF   IES++GKAQ AG  KY
Sbjct:   656 PVGEGAGYAGGIVSAAVDGMFSGFAVAKSFDLFDGTIESVIGKAQGAGLVKY 707
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0015979 "photosynthesis" evidence=IMP
UNIPROTKB|Q74E43 GSU1121 "FAD-dependent oxidoreductase, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1121 GSU_1121 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KTT2 VC_0806 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0806 VC_0806 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q87XR2 PSPTO_4114 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KH66 PFL_1288 "Pyridine nucleotide-disulfide oxidoreductase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q48LQ5 PSPPH_1411 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q480A7 CPS_2911 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2911 CPS_2911 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query704
COG2509486 COG2509, COG2509, Uncharacterized FAD-dependent de 5e-92
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 3e-11
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 7e-10
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 9e-10
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 2e-07
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 3e-07
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 6e-07
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 6e-07
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 6e-07
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 2e-06
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 1e-05
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 1e-05
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 1e-05
PRK08274466 PRK08274, PRK08274, tricarballylate dehydrogenase; 2e-05
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 3e-05
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 4e-05
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 4e-05
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 5e-05
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 6e-05
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 7e-05
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-04
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 1e-04
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-04
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 2e-04
TIGR03997645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 2e-04
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 2e-04
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 6e-04
PLN00093450 PLN00093, PLN00093, geranylgeranyl diphosphate red 7e-04
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 7e-04
PRK00711416 PRK00711, PRK00711, D-amino acid dehydrogenase sma 8e-04
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.001
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.001
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 0.002
PRK10015429 PRK10015, PRK10015, oxidoreductase; Provisional 0.002
PRK06126545 PRK06126, PRK06126, hypothetical protein; Provisio 0.002
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 0.002
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 0.002
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 0.003
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 0.003
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisio 0.003
PRK08243392 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygen 0.004
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 0.004
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 0.004
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.004
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 0.004
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 0.004
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 0.004
>gnl|CDD|225307 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information 
 Score =  294 bits (755), Expect = 5e-92
 Identities = 166/576 (28%), Positives = 250/576 (43%), Gaps = 127/576 (22%)

Query: 118 PAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLD 177
           PA  F     S DARKV      +Y VD+     LD+E R      + E K+        
Sbjct: 28  PAGLFAAYELSGDARKVPI--LKIYVVDVG----LDIEQRL---CPKDEKKLEKCPKC-- 76

Query: 178 KRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLV 237
                                                     P   V+G G +GLF+  +
Sbjct: 77  -----------------------------------------DPCPIVIGFGGAGLFSDGI 95

Query: 238 LAELGADVTLI-ERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIG 296
           L        L   RG  V +R +D         L  ESN  FG  GAGT+SD  L  +I 
Sbjct: 96  LN-------LRPIRGGDVHERTKDTDEFWELVNLVDESNVQFGAPGAGTFSD--LTEQI- 145

Query: 297 RNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVD 356
                +          GA   IL   + H+GTD L  +++N R++L+ LG  I+F T V+
Sbjct: 146 ---KDIEFRAA-----GAGEEILPIYQRHIGTDILPKVVKNIREYLESLGGEIRFNTEVE 197

Query: 357 DLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVS-HNINLVPKD 415
           D+ IE+  ++GVK++  ++        +  D V+LA G S RD +EML     + +  K 
Sbjct: 198 DIEIEDNEVLGVKLTKGEE--------IEADYVVLAPGRSGRDWFEMLHKKLGVKMRAKP 249

Query: 416 FAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNR 475
           F +G+R+EHPQ +++       A +            Y   KY                 
Sbjct: 250 FDIGVRVEHPQSVMDPHTRLGAAPKFL----------YYTKKY---------------GD 284

Query: 476 SCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKD-FDTLDLHGP 534
              +FCMCPGG++V  +     + +NG S+  R S   N AL+VT+   + F+       
Sbjct: 285 GVRTFCMCPGGEVVAENYEDGFVVVNGHSYYARKSENTNFALLVTIEFTEPFED------ 338

Query: 535 LAGVKFQREFEQRAAIMGGGNFVVPAQKVTDFLENKLS------ASPLPPSSYRLGVKAA 588
             G+++ R   + A  +GGG      Q+V DFL+ + S         + P + +  V   
Sbjct: 339 --GIEYGRSIARLATTLGGGK--AIIQRVGDFLKGRRSTWSRIGRVFVEP-TLKP-VTPG 392

Query: 589 SLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSL 648
            L    P  + + L  ++   D+ +PG  SD  LL+GVET+    ++I  + +   STS+
Sbjct: 393 DLSLALPDRVVEDLIEALENLDKVIPGVASDDTLLYGVETKFYS-VRIKVDED--LSTSI 449

Query: 649 KGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFGL 684
           KGLYP G+GAG A GIVSAAADG+ A   +A+ +G 
Sbjct: 450 KGLYPAGDGAGLARGIVSAAADGIKAAEGIARKYGA 485

Length = 486
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|236214 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|177713 PLN00093, PLN00093, geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|234819 PRK00711, PRK00711, D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|182194 PRK10015, PRK10015, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236198 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 704
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 100.0
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 100.0
COG2081408 Predicted flavoproteins [General function predicti 100.0
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.97
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 99.95
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 99.94
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.93
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.92
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 99.92
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 99.92
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.88
PF01134392 GIDA: Glucose inhibited division protein A; InterP 99.87
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.87
PLN02815594 L-aspartate oxidase 99.86
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.86
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.86
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.86
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.86
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.86
PRK06175433 L-aspartate oxidase; Provisional 99.85
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.85
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 99.85
PRK07395553 L-aspartate oxidase; Provisional 99.85
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.85
PRK07512513 L-aspartate oxidase; Provisional 99.85
PRK08071510 L-aspartate oxidase; Provisional 99.85
PRK07804541 L-aspartate oxidase; Provisional 99.84
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.84
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.84
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.84
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.84
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 99.84
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.83
PRK08401466 L-aspartate oxidase; Provisional 99.83
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 99.83
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 99.83
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.82
PRK09077536 L-aspartate oxidase; Provisional 99.82
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.81
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 99.81
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.8
PRK08275554 putative oxidoreductase; Provisional 99.78
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 99.76
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.75
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.75
PRK07121492 hypothetical protein; Validated 99.75
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.75
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.73
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.72
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.72
PRK08274466 tricarballylate dehydrogenase; Validated 99.72
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.71
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 99.69
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.68
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 99.68
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 99.67
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 99.66
PRK12842574 putative succinate dehydrogenase; Reviewed 99.64
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.64
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 99.63
PRK12839572 hypothetical protein; Provisional 99.62
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.62
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.62
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.62
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.6
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.59
PRK12831464 putative oxidoreductase; Provisional 99.56
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.56
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.56
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.55
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.54
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.54
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.51
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.51
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.48
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.47
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.45
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.44
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.43
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.43
PRK12814652 putative NADPH-dependent glutamate synthase small 99.39
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.39
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.39
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.37
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.3
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.29
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.28
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.27
PLN02661357 Putative thiazole synthesis 99.27
PRK13984604 putative oxidoreductase; Provisional 99.22
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.21
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.19
PRK10157428 putative oxidoreductase FixC; Provisional 99.15
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.11
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.08
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.08
PRK10015429 oxidoreductase; Provisional 99.08
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.07
PRK11728393 hydroxyglutarate oxidase; Provisional 99.07
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.05
PRK06185407 hypothetical protein; Provisional 99.02
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.02
PRK06184502 hypothetical protein; Provisional 99.01
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.0
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.0
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 98.99
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.99
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.97
PRK08244493 hypothetical protein; Provisional 98.97
PRK06847375 hypothetical protein; Provisional 98.97
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.96
COG0579429 Predicted dehydrogenase [General function predicti 98.96
PRK06834488 hypothetical protein; Provisional 98.96
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.96
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.95
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.95
PLN02464627 glycerol-3-phosphate dehydrogenase 98.94
PRK06126545 hypothetical protein; Provisional 98.94
PRK07190487 hypothetical protein; Provisional 98.93
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.93
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.91
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.9
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.9
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.9
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.9
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.89
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.89
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.89
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.89
PRK08163396 salicylate hydroxylase; Provisional 98.88
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.87
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.87
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.86
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 98.85
PLN02463447 lycopene beta cyclase 98.85
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.85
PRK08013400 oxidoreductase; Provisional 98.84
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.84
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.84
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.84
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.84
KOG2403642 consensus Succinate dehydrogenase, flavoprotein su 98.83
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.83
KOG0404322 consensus Thioredoxin reductase [Posttranslational 98.83
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.83
PRK07236386 hypothetical protein; Provisional 98.82
PRK07045388 putative monooxygenase; Reviewed 98.82
PLN02697529 lycopene epsilon cyclase 98.81
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.81
PRK09126392 hypothetical protein; Provisional 98.8
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.8
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.8
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.8
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.8
PLN02985514 squalene monooxygenase 98.8
PRK13977576 myosin-cross-reactive antigen; Provisional 98.8
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 98.79
PRK07588391 hypothetical protein; Provisional 98.79
PRK06475400 salicylate hydroxylase; Provisional 98.78
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.77
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.77
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.77
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.76
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.76
PRK06753373 hypothetical protein; Provisional 98.76
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.75
PRK05868372 hypothetical protein; Validated 98.75
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.75
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.75
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.75
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.73
PRK11445351 putative oxidoreductase; Provisional 98.72
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.72
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.72
PRK08294 634 phenol 2-monooxygenase; Provisional 98.72
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 98.71
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.7
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.7
PRK07538413 hypothetical protein; Provisional 98.69
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.69
PRK05257494 malate:quinone oxidoreductase; Validated 98.67
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.66
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.65
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.64
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.64
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.63
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.63
PRK10262321 thioredoxin reductase; Provisional 98.63
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.63
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.63
PRK09897534 hypothetical protein; Provisional 98.62
PLN02852491 ferredoxin-NADP+ reductase 98.62
PRK06116450 glutathione reductase; Validated 98.62
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.61
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.61
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.61
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.61
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.61
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.6
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 98.59
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.58
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.58
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.57
PRK06116450 glutathione reductase; Validated 98.56
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.56
PRK06370463 mercuric reductase; Validated 98.56
PRK07233434 hypothetical protein; Provisional 98.56
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.56
PRK06370463 mercuric reductase; Validated 98.56
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 98.55
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.55
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.54
PRK06996398 hypothetical protein; Provisional 98.54
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.54
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.53
PTZ00367567 squalene epoxidase; Provisional 98.53
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.53
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.52
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.51
TIGR02053463 MerA mercuric reductase. This model represents the 98.51
PRK14727479 putative mercuric reductase; Provisional 98.51
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.51
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.5
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.5
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.5
KOG1298509 consensus Squalene monooxygenase [Lipid transport 98.49
PRK14694468 putative mercuric reductase; Provisional 98.49
PRK13748561 putative mercuric reductase; Provisional 98.48
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.48
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.48
PLN02507499 glutathione reductase 98.48
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.48
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.47
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.47
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.47
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.46
PLN02507499 glutathione reductase 98.46
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.46
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.45
PTZ00188506 adrenodoxin reductase; Provisional 98.44
PTZ00058561 glutathione reductase; Provisional 98.44
PRK07208479 hypothetical protein; Provisional 98.43
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.43
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.42
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.42
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.41
PLN02546558 glutathione reductase 98.41
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.41
PRK07846451 mycothione reductase; Reviewed 98.41
COG3573552 Predicted oxidoreductase [General function predict 98.41
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.4
PTZ00052499 thioredoxin reductase; Provisional 98.4
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.4
PLN02546558 glutathione reductase 98.39
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.38
PTZ00052499 thioredoxin reductase; Provisional 98.38
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.37
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.36
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.36
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.36
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 98.36
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.35
KOG2852380 consensus Possible oxidoreductase [General functio 98.35
PRK02106560 choline dehydrogenase; Validated 98.35
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.35
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.34
PRK14694468 putative mercuric reductase; Provisional 98.34
PRK13512438 coenzyme A disulfide reductase; Provisional 98.34
PTZ00058561 glutathione reductase; Provisional 98.32
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.32
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.31
TIGR02053463 MerA mercuric reductase. This model represents the 98.31
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.31
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.3
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.3
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.3
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.29
PRK13512438 coenzyme A disulfide reductase; Provisional 98.28
PRK14727479 putative mercuric reductase; Provisional 98.28
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.25
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.25
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.25
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.24
PRK13748561 putative mercuric reductase; Provisional 98.24
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.24
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.23
PLN02612567 phytoene desaturase 98.23
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.22
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 98.22
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.21
PLN02487569 zeta-carotene desaturase 98.21
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.19
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.19
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.17
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.14
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.14
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.13
PRK10262321 thioredoxin reductase; Provisional 98.12
PRK13523337 NADPH dehydrogenase NamA; Provisional 98.12
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.11
PTZ00153659 lipoamide dehydrogenase; Provisional 98.1
PLN02529738 lysine-specific histone demethylase 1 98.1
KOG2853509 consensus Possible oxidoreductase [General functio 98.09
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.09
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.07
PTZ00153659 lipoamide dehydrogenase; Provisional 98.06
PRK12831464 putative oxidoreductase; Provisional 98.06
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.04
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.03
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.03
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.01
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 98.01
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.01
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.01
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.98
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.98
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 97.97
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.95
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.94
PRK07846451 mycothione reductase; Reviewed 97.93
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 97.93
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.93
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.88
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 97.86
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.84
PLN02785587 Protein HOTHEAD 97.83
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.81
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.81
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 97.79
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 97.78
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.78
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.77
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.75
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 97.75
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.75
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.74
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.7
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.67
PLN02411391 12-oxophytodienoate reductase 97.66
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.65
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.64
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.64
COG3349485 Uncharacterized conserved protein [Function unknow 97.63
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.63
PRK10605362 N-ethylmaleimide reductase; Provisional 97.61
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 97.61
KOG2960328 consensus Protein involved in thiamine biosynthesi 97.59
PRK12779944 putative bifunctional glutamate synthase subunit b 97.56
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.52
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.51
PLN02576496 protoporphyrinogen oxidase 97.5
PRK12814652 putative NADPH-dependent glutamate synthase small 97.48
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.48
PLN02268435 probable polyamine oxidase 97.47
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.43
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.43
KOG4716503 consensus Thioredoxin reductase [Posttranslational 97.42
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.41
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.41
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.4
PLN02328808 lysine-specific histone demethylase 1 homolog 97.4
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.35
KOG4716503 consensus Thioredoxin reductase [Posttranslational 97.35
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.34
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.33
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.3
PRK12416463 protoporphyrinogen oxidase; Provisional 97.3
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.27
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.26
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.21
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.19
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.19
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 97.18
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 97.14
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.13
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 97.08
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.03
PLN02568539 polyamine oxidase 96.98
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.97
PLN02676487 polyamine oxidase 96.87
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.86
PRK13984604 putative oxidoreductase; Provisional 96.8
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 96.76
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.71
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.66
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.65
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.59
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 96.55
PLN03000 881 amine oxidase 96.5
PLN02976 1713 amine oxidase 96.39
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 96.32
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 96.25
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.04
KOG0404322 consensus Thioredoxin reductase [Posttranslational 96.04
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 95.96
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.69
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.68
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 95.66
PLN02172461 flavin-containing monooxygenase FMO GS-OX 95.42
PLN02852491 ferredoxin-NADP+ reductase 95.32
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.28
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 95.12
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 95.05
PRK065671028 putative bifunctional glutamate synthase subunit b 94.65
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 94.58
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 94.12
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 93.86
KOG2755334 consensus Oxidoreductase [General function predict 93.77
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 93.5
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.27
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 93.24
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.11
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 92.86
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.73
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 92.67
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 92.53
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 92.21
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 92.1
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 91.58
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 91.49
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 91.44
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.28
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 90.89
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 90.74
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 90.38
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 90.22
PRK06719157 precorrin-2 dehydrogenase; Validated 90.21
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.04
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.63
PF14691111 Fer4_20: Dihydroprymidine dehydrogenase domain II, 89.62
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.6
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.43
PRK06718202 precorrin-2 dehydrogenase; Reviewed 89.38
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.32
PRK06249313 2-dehydropantoate 2-reductase; Provisional 89.29
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.21
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 89.1
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 88.97
PRK05708305 2-dehydropantoate 2-reductase; Provisional 88.97
COG3573552 Predicted oxidoreductase [General function predict 88.73
PRK04148134 hypothetical protein; Provisional 88.6
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 88.55
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.47
PRK12921305 2-dehydropantoate 2-reductase; Provisional 88.29
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 88.05
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 87.84
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 87.22
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.18
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 87.11
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 86.95
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 86.95
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 86.9
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 86.19
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.99
PRK08229341 2-dehydropantoate 2-reductase; Provisional 85.7
PRK15116268 sulfur acceptor protein CsdL; Provisional 85.41
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 85.39
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 85.31
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 85.01
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.73
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 84.36
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 84.28
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.13
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.12
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 84.05
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 84.03
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 83.93
PRK12549284 shikimate 5-dehydrogenase; Reviewed 83.79
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 83.78
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 83.4
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.34
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 83.22
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 83.13
PRK08306296 dipicolinate synthase subunit A; Reviewed 83.06
TIGR02730493 carot_isom carotene isomerase. Members of this fam 83.05
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 83.01
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 82.97
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 82.97
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 82.68
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 82.63
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 82.53
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 82.37
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 82.04
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 81.96
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 81.74
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 81.73
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.61
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.59
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 81.57
PRK12548289 shikimate 5-dehydrogenase; Provisional 81.52
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 81.5
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 81.48
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 81.27
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 81.27
PRK11730715 fadB multifunctional fatty acid oxidation complex 81.08
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 81.08
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 80.86
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 80.81
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 80.76
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 80.74
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-63  Score=519.99  Aligned_cols=478  Identities=34%  Similarity=0.533  Sum_probs=395.3

Q ss_pred             ecccccCCCCCCCCcccchHHHHHHHHHHcCCCCCCCChhhHHHHHhcccccccccCCCeEEEEEEEeeccccccCCchh
Q 005273           80 SKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTW  159 (704)
Q Consensus        80 ~~~~~~~~~~~~~~~~g~~~~l~~~i~k~~~ipv~~~~p~~a~~i~~~~~DaR~~ladp~~~~kv~~~~~~~~~~~~~~~  159 (704)
                      +++++|++++.        ..+..++-+.+.+...   |.-.+.+++.+.|+| + .+..++|.++.+...+        
T Consensus         1 ~~i~~~~~~~~--------~~~~~~~~~vvivgag---~~g~f~a~~~s~~ar-~-~~~~~i~~vd~g~~~~--------   59 (486)
T COG2509           1 SEIKLPIDHDQ--------EALMNAALDVVIVGAG---PAGLFAAYELSGDAR-K-VPILKIYVVDVGLDIE--------   59 (486)
T ss_pred             CcccccCCCCh--------HHHhhhccceEEECCC---chHHHHHHHHhhhcc-c-CCceEEEEEEeccchh--------
Confidence            46788888775        4555556666666655   444789999999999 5 6899999999997643        


Q ss_pred             hhhhccccccccccccccccccCCceeeecccccccchhhhhhhhccCCCCccCCCCCCCCcEEEEcCCHHHHHHHHHHH
Q 005273          160 DFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLA  239 (704)
Q Consensus       160 ~~i~~~~~~~~~~e~~~~~~~~~~~v~i~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~vvG~G~aGl~aA~~l~  239 (704)
                         .|.||...            .+.+   .|.                        .-....+++|-|+||+.++..|+
T Consensus        60 ---~r~~~~~~------------~~~~---~c~------------------------~~~~~~I~~G~GgaG~fs~g~ln   97 (486)
T COG2509          60 ---QRLCPKDE------------KKLE---KCP------------------------KCDPCPIVIGFGGAGLFSDGILN   97 (486)
T ss_pred             ---hhhccccc------------cchh---hcC------------------------CCCCceeEeccccccccccccee
Confidence               23444211            0110   010                        01245789999999999999888


Q ss_pred             HcCCcEEEEEeCccccccccchhHHHHHHhhccccccccccCCcccccCcchhhhhccCchhHHHHHHHHHHcCCCceee
Q 005273          240 ELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANIL  319 (704)
Q Consensus       240 ~~g~~v~l~e~~~~~~~~~~~~~~~~~~~~l~~~~n~~~g~gG~~~~sdg~l~~~~~~~~~~~~~~l~~l~~~G~~~~~~  319 (704)
                         ++..   ++..+..+..+...+|....++..+|++||++|+++|++  +...+.+         ..+..+|++.+++
T Consensus        98 ---l~P~---~Gg~~~~~~~d~~~~~~~~~~vd~~~vqfG~~g~~~~~~--~~e~ikd---------~e~~aa~a~~eil  160 (486)
T COG2509          98 ---LRPI---RGGDVHERTKDTDEFWELVNLVDESNVQFGAPGAGTFSD--LTEQIKD---------IEFRAAGAGEEIL  160 (486)
T ss_pred             ---cccc---cccchhhhhCChHHHHHHHhccchhheecCCCcCcccCC--chhhhhH---------HHHHHhCCCceee
Confidence               3332   565565566677788888888999999999999999987  3333322         3577899999999


Q ss_pred             cCCccccCCCChHHHHHHHHHHHHHCCCEEEeCeEEEEEEEeCCEEEEEEEcCCCCCCCCceeEEecCeEEEcCCCChHH
Q 005273          320 VDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARD  399 (704)
Q Consensus       320 ~~g~~~~g~~~~~~l~~~L~~~l~~~Gv~i~~~t~V~~i~~~~g~v~GV~~~~~~~~~~~~~~~i~Ad~VVlAtG~~s~~  399 (704)
                      +..++|+|++.+..+++.+++.++++|++|+|+|+|.++..+++.+.+|.+.++        .++.+|.||+|.|+++++
T Consensus       161 ~~~~rHiGTD~l~~vvkni~~~l~~~G~ei~f~t~VeDi~~~~~~~~~v~~~~g--------~~i~~~~vvlA~Grsg~d  232 (486)
T COG2509         161 PIYQRHIGTDILPKVVKNIREYLESLGGEIRFNTEVEDIEIEDNEVLGVKLTKG--------EEIEADYVVLAPGRSGRD  232 (486)
T ss_pred             eccccccCccchHHHHHHHHHHHHhcCcEEEeeeEEEEEEecCCceEEEEccCC--------cEEecCEEEEccCcchHH
Confidence            999999999999999999999999999999999999999999998889998877        479999999999999999


Q ss_pred             HHHHHHhC-CCcccccceeeEEEEecchhhhcccccccchhhhcccCCCCccccccceecccCCCCCCCCccccchhhhh
Q 005273          400 IYEMLVSH-NINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCY  478 (704)
Q Consensus       400 ~~~~l~~~-gi~l~~~~~avG~~~~~p~~~~~~~~~~~l~~e~~~g~g~~~~~d~~~~~~~~~~~~~e~a~Rd~~~r~v~  478 (704)
                      |+.++.+. |+.+.++|+++|+|++||+.+|+...-             +..++|.+++..            ...|.+|
T Consensus       233 w~~~l~~K~Gv~~~~~p~dIGVRvE~p~~vmd~~~~-------------~~~~~k~~~~t~------------k~~~~Vr  287 (486)
T COG2509         233 WFEMLHKKLGVKMRAKPFDIGVRVEHPQSVMDPHTR-------------LGAAPKFLYYTK------------KYGDGVR  287 (486)
T ss_pred             HHHHHHHhcCcccccCCeeEEEEEecchHhhCcccc-------------ccccceeEEEec------------cCCCeEE
Confidence            99877655 999999999999999999999987431             122345555433            2467899


Q ss_pred             hhhccCCceEEEccCCCCcceecCcccccCCCccccceeEEeeecCCcCcccCCCCchhhHHHHHHHHHHHHhCCCceee
Q 005273          479 SFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFEQRAAIMGGGNFVV  558 (704)
Q Consensus       479 ~fc~~~gG~vv~~~~~~~~~~vng~s~~~r~~~~~n~~~~~~v~~~d~~p~~~~~~l~g~~~~~~~e~~a~~~gg~~~~~  558 (704)
                      +|||||+|.|+...|+.+.+.+||||++.++++|+|+++++.++..|  |+++     +++||++|+++++.+||++  +
T Consensus       288 tFCmcP~G~VV~e~~e~g~~~vNG~S~~~r~s~NtNfAllV~i~~te--p~~~-----~~ey~r~ia~lA~~lgGg~--~  358 (486)
T COG2509         288 TFCMCPGGEVVAENYEDGFVVVNGHSYYARKSENTNFALLVTIEFTE--PFED-----GIEYGRSIARLATTLGGGK--A  358 (486)
T ss_pred             EEEECCCCeEEeeeccCceEEEcccchhcccccCcceEEEEeccccC--CCCc-----hHHHHHHHHHHHHHhcCCc--c
Confidence            99999999999999999999999999999999999999999886654  4322     7999999999999999998  7


Q ss_pred             ccccHHhhhcCCCCC-CCC----CCCcccCceeEccCCccChHHHHHHHHHHHHhhhhcCCCCCCCCeEEEEEEeeecCc
Q 005273          559 PAQKVTDFLENKLSA-SPL----PPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRTSCP  633 (704)
Q Consensus       559 p~q~l~dfl~~~~~~-~~l----~~~~~~~~~~~~~l~~~~p~~~~~~l~~~l~~~~~~~~G~~~~~a~~~Gve~~~~~p  633 (704)
                      |.|++.||+.+|.+. ..+    ..+++.+ +++.||+..||..+++.|+++|++|++.+|||.++++++||||+++|| 
T Consensus       359 i~Q~~gDf~~gRrSt~~ri~~~~v~PTlk~-v~pgDls~~lP~~v~~~iiE~le~ldk~ipG~as~dtlLygvE~k~ys-  436 (486)
T COG2509         359 IIQRVGDFLKGRRSTWSRIGRVFVEPTLKP-VTPGDLSLALPDRVVEDLIEALENLDKVIPGVASDDTLLYGVETKFYS-  436 (486)
T ss_pred             hHHHhhHHHcCCcChHHHhhcccccccccc-cccCchhhhCCHHHHHHHHHHHHHhhccCCCcccccceeeeeeeeeee-
Confidence            899999999999873 122    2234555 889999999999999999999999999999999999999999999999 


Q ss_pred             eeccCCCCCccccCcCCeeEccccchhhHHHHHHHHHHHHHHHHHHhhcC
Q 005273          634 LQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDFG  683 (704)
Q Consensus       634 ~~i~~~~~tles~~i~GLy~~GE~aG~~GGi~sA~~~G~~Aa~~i~~~~~  683 (704)
                      +|+.+|.+  ++++++|||++||+||++|||++|+++|++||++|+.++.
T Consensus       437 ~ri~~d~~--~~t~i~gLy~aGdGAG~argI~~Aaa~Gi~~A~~i~~k~~  484 (486)
T COG2509         437 VRIKVDED--LSTSIKGLYPAGDGAGLARGIVSAAADGIKAAEGIARKYG  484 (486)
T ss_pred             eeEeeccc--ceeeecceEEccccccccchhHHHhhhhHHHHHHHHHHhc
Confidence            99999965  5579999999999999999999999999999999998764

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query704
3nlc_A549 Crystal Structure Of The Vp0956 Protein From Vibrio 8e-82
>pdb|3NLC|A Chain A, Crystal Structure Of The Vp0956 Protein From Vibrio Parahaemolyticus. Northeast Structural Genomics Consortium Target Vpr147 Length = 549 Back     alignment and structure 
Iteration: 1

 Score =  301 bits (771), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 214/607 (35%), Positives = 314/607 (51%), Gaps = 81/607 (13%)
Query: 78  RLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKE 137
           R++++ +P+  + G        ALLD ITK L  P   ++   +F V R+ +DARK    
Sbjct: 13  RINEIKLPLDHEEG--------ALLDAITKKLGIPAEKVI---SFNVFRRGYDARKKTN- 60
Query: 138 PKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDD 197
              +YT+D+ V                                 GD   ++    K ++D
Sbjct: 61  IHLIYTLDIIVE--------------------------------GDETALL---AKFAND 85
Query: 198 TLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQR 257
             +R+      + +   P     +  V+G GP GLFA LVLA+ G +  ++ERG+ V +R
Sbjct: 86  PHVRQTPDXEYKFVAKAPENLTERPIVIGFGPCGLFAGLVLAQXGFNPIIVERGKEVRER 145
Query: 258 GRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPAN 317
            +D      +R L  ESN  FGEGGAGT+SDGKL +++   +     V+   V  GAP  
Sbjct: 146 TKDTFGFWRKRTLNPESNVQFGEGGAGTFSDGKLYSQVKDPNFYGRKVITEFVEAGAPEE 205
Query: 318 ILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNS 377
           IL   K H+GT +L+  +   R  +  LG  I+F TRVDDL  E+ +I GV +S+     
Sbjct: 206 ILYVSKPHIGTFKLVTXIEKXRATIIELGGEIRFSTRVDDLHXEDGQITGVTLSNG---- 261
Query: 378 QSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSEL 437
               +++    V+LAVGHSARD +E L    +    K F+VG R+EH Q  I+  ++   
Sbjct: 262 ----EEIKSRHVVLAVGHSARDTFEXLHERGVYXEAKPFSVGFRIEHKQSXIDEARFGPN 317
Query: 438 ATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPGGQIVLTSTNPLE 497
           A     G   +  ADYK+  +                R+ YSFC CPGG +V  ++    
Sbjct: 318 A-----GHPILGAADYKLVHHCK------------NGRTVYSFCXCPGGTVVAATSEEGR 360
Query: 498 LCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHG-PLAGVKFQREFEQRAAIMGGGNF 556
           +  NG S   R+ R AN+A+VV +S +    +D  G PLAG++FQRE E  A  +GG N+
Sbjct: 361 VVTNGXSQYSRAERNANSAIVVGISPE----VDYPGDPLAGIRFQRELESNAYKLGGENY 416
Query: 557 VVPAQKVTDFLENKLSAS--PLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELP 614
             PAQK+ DFL+ +  +    + P S+  G+K   L +  P    +A++ +I  FD ++ 
Sbjct: 417 DAPAQKIGDFLKGRDPSQLGDVEP-SFTPGIKLTDLSKALPPFAVEAIREAIPAFDRKIK 475
Query: 615 GFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYA 674
           GF S+ GLL GVETRTS P+ I R  +  +S +LKG YP GEGAGYAGGI+SA  DG+  
Sbjct: 476 GFASEDGLLTGVETRTSSPVCIKRGKD-FQSVNLKGFYPAGEGAGYAGGILSAGIDGIKV 534
Query: 675 GFAVAKD 681
             AVA+D
Sbjct: 535 AEAVARD 541

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query704
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 1e-158
3atr_A453 Conserved archaeal protein; saturating double bond 2e-13
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 3e-13
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 4e-10
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 5e-10
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 6e-10
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 1e-09
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 2e-09
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 3e-09
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 3e-05
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 8e-09
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 8e-09
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 1e-07
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 1e-07
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 2e-07
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 3e-07
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 5e-07
2gqf_A401 Hypothetical protein HI0933; structural genomics, 1e-06
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 1e-06
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 2e-06
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 2e-06
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 3e-06
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 3e-06
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 3e-06
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 3e-06
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 3e-06
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 3e-06
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 5e-06
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 5e-06
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 6e-06
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 6e-06
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 1e-05
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 2e-05
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 2e-05
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 3e-05
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 3e-05
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 4e-05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 4e-05
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 6e-05
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 6e-05
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 7e-05
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 1e-04
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 1e-04
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 2e-04
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 2e-04
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 2e-04
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 2e-04
2bry_A497 NEDD9 interacting protein with calponin homology a 2e-04
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 2e-04
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 2e-04
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 3e-04
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 3e-04
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 3e-04
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 4e-04
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 4e-04
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 4e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 4e-04
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 4e-04
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 4e-04
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 5e-04
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 5e-04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 5e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 5e-04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 6e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 8e-04
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 8e-04
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 8e-04
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 9e-04
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 Back     alignment and structure
 Score =  467 bits (1202), Expect = e-158
 Identities = 213/619 (34%), Positives = 317/619 (51%), Gaps = 77/619 (12%)

Query: 66  LNDVNNKFEGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVV 125
           +   ++      R++++ +P+  + G        ALLD ITK L  P   +    +F V 
Sbjct: 1   MGHHHHHHSHMIRINEIKLPLDHEEG--------ALLDAITKKLGIPAEKV---ISFNVF 49

Query: 126 RKSFDARKVLKEPKFVYTVDMDVSKLLDLEPRTWDFISRLEAKVGSVEHMLDKRASGDLI 185
           R+ +DARK       +YT+D+ V                 E  +                
Sbjct: 50  RRGYDARKK-TNIHLIYTLDIIVEGD--------------ETAL---------------- 78

Query: 186 NIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGLFASLVLAELGADV 245
                  K ++D  +R+      + +   P     +  V+G GP GLFA LVLA++G + 
Sbjct: 79  -----LAKFANDPHVRQTPDMEYKFVAKAPENLTERPIVIGFGPCGLFAGLVLAQMGFNP 133

Query: 246 TLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAV 305
            ++ERG+ V +R +D      +R L  ESN  FGEGGAGT+SDGKL +++   +     V
Sbjct: 134 IIVERGKEVRERTKDTFGFWRKRTLNPESNVQFGEGGAGTFSDGKLYSQVKDPNFYGRKV 193

Query: 306 MNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARI 365
           +   V  GAP  IL   K H+GT +L+ ++   R  +  LG  I+F TRVDDL +E+ +I
Sbjct: 194 ITEFVEAGAPEEILYVSKPHIGTFKLVTMIEKMRATIIELGGEIRFSTRVDDLHMEDGQI 253

Query: 366 VGVKVSDSKDNSQSDIQKLGFDAVILAVGHSARDIYEMLVSHNINLVPKDFAVGLRMEHP 425
            GV +S+         +++    V+LAVGHSARD +EML    + +  K F+VG R+EH 
Sbjct: 254 TGVTLSNG--------EEIKSRHVVLAVGHSARDTFEMLHERGVYMEAKPFSVGFRIEHK 305

Query: 426 QELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVTTNRSCYSFCMCPG 485
           Q +I+  ++   A     G   +  ADYK+  +                R+ YSFCMCPG
Sbjct: 306 QSMIDEARFGPNA-----GHPILGAADYKLVHHCK------------NGRTVYSFCMCPG 348

Query: 486 GQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAKDFDTLDLHGPLAGVKFQREFE 545
           G +V  ++    +  NGMS   R+ R AN+A+VV +S +         PLAG++FQRE E
Sbjct: 349 GTVVAATSEEGRVVTNGMSQYSRAERNANSAIVVGISPEVDYP---GDPLAGIRFQRELE 405

Query: 546 QRAAIMGGGNFVVPAQKVTDFLENKLSAS-PLPPSSYRLGVKAASLHELFPTHLTDALKH 604
             A  +GG N+  PAQK+ DFL+ +  +       S+  G+K   L +  P    +A++ 
Sbjct: 406 SNAYKLGGENYDAPAQKIGDFLKGRDPSQLGDVEPSFTPGIKLTDLSKALPPFAVEAIRE 465

Query: 605 SISMFDEELPGFISDTGLLHGVETRTSCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGI 664
           +I  FD ++ GF S+ GLL GVETRTS P+ I R  +  +S +LKG YP GEGAGYAGGI
Sbjct: 466 AIPAFDRKIKGFASEDGLLTGVETRTSSPVCIKR-GKDFQSVNLKGFYPAGEGAGYAGGI 524

Query: 665 VSAAADGMYAGFAVAKDFG 683
           +SA  DG+    AVA+D  
Sbjct: 525 LSAGIDGIKVAEAVARDIV 543
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Length = 320 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query704
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 100.0
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.96
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.95
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.93
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.92
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.91
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.89
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.86
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.85
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.85
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.84
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.84
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.83
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 99.82
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.81
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 99.81
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.8
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.79
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.76
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.74
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 99.71
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.7
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.65
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.57
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.44
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.39
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.3
3dme_A369 Conserved exported protein; structural genomics, P 99.29
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.24
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.24
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.22
2bry_A497 NEDD9 interacting protein with calponin homology a 99.22
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.21
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.19
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.19
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.17
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.17
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.15
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.14
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.14
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.13
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.12
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.11
2cul_A232 Glucose-inhibited division protein A-related PROT 99.1
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.1
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.09
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.09
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.08
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.04
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.03
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.03
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.02
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.01
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.0
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.99
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.99
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.97
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.96
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.96
3atr_A453 Conserved archaeal protein; saturating double bond 98.96
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.95
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.95
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.94
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.93
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.92
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.91
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.91
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.9
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.88
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.88
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.88
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.87
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.86
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.85
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.84
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.82
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.82
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.8
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.79
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.77
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.76
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.75
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.75
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.74
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.74
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.72
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.71
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.71
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.7
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.7
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.7
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.7
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.7
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.69
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.68
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.66
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.66
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.66
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.65
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.65
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.65
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.64
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.63
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.62
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.61
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.61
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.6
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.6
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.59
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.59
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.58
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.58
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.58
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.57
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.57
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.56
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.55
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.55
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.55
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.55
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.55
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.55
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.54
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.53
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.53
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.53
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.53
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.52
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.51
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.51
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.51
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.5
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.5
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.49
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.49
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.49
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.49
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.48
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.48
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.46
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.45
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.45
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.44
4dna_A463 Probable glutathione reductase; structural genomic 98.44
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.44
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.44
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.43
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.43
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.43
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.43
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 98.43
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.42
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.42
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.42
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.41
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.41
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.41
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.41
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.41
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.4
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.4
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.4
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.4
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.4
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.4
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.4
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.4
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.38
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.38
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.38
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.38
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.38
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.37
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.37
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.37
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.37
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.37
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.37
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.37
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.37
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.37
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.36
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.36
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.36
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.36
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.36
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.36
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.36
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.36
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.35
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.35
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.34
4dna_A463 Probable glutathione reductase; structural genomic 98.33
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.33
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.32
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.31
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.31
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.31
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.3
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.3
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.3
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.3
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.3
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.29
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.29
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.29
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.28
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.28
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.28
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.26
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.26
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.25
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.25
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.24
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.24
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.24
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.24
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.24
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.24
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.24
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.22
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.21
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.2
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.2
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.19
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.19
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.18
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.17
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.15
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.14
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.14
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.14
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.14
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.14
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.14
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.13
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.11
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.09
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.07
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 98.04
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 98.04
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.04
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.02
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.01
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.01
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.99
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.99
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.98
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.97
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.96
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.96
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 97.93
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.92
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.89
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.85
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.83
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.83
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.82
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.8
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.79
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.77
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.76
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.75
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.75
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.64
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.64
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.63
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.6
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.57
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.52
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.51
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.5
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.45
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.42
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.41
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.41
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 97.4
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.38
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.36
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.35
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.34
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.28
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.27
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.23
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.21
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 97.19
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.19
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 97.18
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.14
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.05
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.03
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 97.02
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.99
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.96
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 96.91
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.69
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 96.61
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.54
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 96.52
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.5
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.44
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.42
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 96.39
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 96.38
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 96.17
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.15
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 96.11
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 95.84
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 95.69
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 95.63
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 95.4
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.21
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 94.99
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 94.56
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.53
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 94.5
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 94.31
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.04
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.72
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.5
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 93.39
1vg0_A650 RAB proteins geranylgeranyltransferase component A 93.14
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 92.86
1id1_A153 Putative potassium channel protein; RCK domain, E. 92.23
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.23
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.02
3c85_A183 Putative glutathione-regulated potassium-efflux S 91.73
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 91.47
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 90.8
2ywl_A180 Thioredoxin reductase related protein; uncharacter 90.01
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 89.95
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 89.89
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 89.87
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 89.79
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 89.61
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 89.48
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.15
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 88.76
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 88.73
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.67
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 88.63
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 88.39
2cul_A232 Glucose-inhibited division protein A-related PROT 88.25
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 88.1
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 88.05
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 87.83
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 87.51
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 87.44
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 87.39
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 87.31
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 87.27
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 87.18
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 87.17
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 87.13
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 86.92
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 86.91
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 86.69
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 86.61
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 86.6
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 86.56
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 86.44
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 86.2
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 86.15
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 86.13
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 86.11
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 86.07
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 86.04
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 85.79
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 85.77
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 85.63
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 85.62
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 85.23
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 85.1
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 84.99
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 84.83
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 84.62
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 84.51
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 84.41
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 84.34
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 84.32
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 84.31
4g65_A461 TRK system potassium uptake protein TRKA; structur 84.25
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 84.23
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 84.13
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 83.91
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 83.78
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 83.65
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 83.56
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 83.32
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 83.26
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 83.05
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 82.84
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 82.71
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 82.62
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 82.35
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 82.32
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 82.26
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 82.13
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 82.13
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 82.08
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 81.92
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 81.78
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 81.7
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 81.62
3tl2_A315 Malate dehydrogenase; center for structural genomi 81.58
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 81.57
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 81.49
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 81.28
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 81.28
2rir_A300 Dipicolinate synthase, A chain; structural genomic 81.23
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 81.2
3qha_A296 Putative oxidoreductase; seattle structural genomi 81.15
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 81.13
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 81.04
3l6d_A306 Putative oxidoreductase; structural genomics, prot 80.87
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 80.62
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 80.58
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 80.19
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 80.18
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 80.14
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 80.05
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
Probab=100.00  E-value=1.1e-75  Score=665.11  Aligned_cols=531  Identities=39%  Similarity=0.675  Sum_probs=452.4

Q ss_pred             ccceEeecccccCCCCCCCCcccchHHHHHHHHHHcCCCCCCCChhhHHHHHhcccccccccCCCeEEEEEEEeecc-cc
Q 005273           74 EGFWRLSKLAVPVHKDPGKDFIGVSHALLDEITKVLQFPVASMLPAEAFTVVRKSFDARKVLKEPKFVYTVDMDVSK-LL  152 (704)
Q Consensus        74 ~g~~~~~~~~~~~~~~~~~~~~g~~~~l~~~i~k~~~ipv~~~~p~~a~~i~~~~~DaR~~ladp~~~~kv~~~~~~-~~  152 (704)
                      .-|+|++|+++|+++++        ..|.+.|++.++|+...+.   .++|+++|+|||++ .++.|+|+|++.+.+ + 
T Consensus         9 ~~~~~~~~~~~~~~~~~--------~~l~~~~~~~l~~~~~~~~---~~~i~~~sidar~~-~~~~~~~~v~v~~~~~~-   75 (549)
T 3nlc_A            9 SHMIRINEIKLPLDHEE--------GALLDAITKKLGIPAEKVI---SFNVFRRGYDARKK-TNIHLIYTLDIIVEGDE-   75 (549)
T ss_dssp             --CEEEEEEEEETTCCT--------THHHHHHHHHHCCCGGGEE---EEEEEEEEECCC-----CEEEEEEEEEESSCH-
T ss_pred             cceeEEEeEEcCCCCCH--------HHHHHHHHHHhCCCHHHCC---eEEEEEeecccCCC-CCceEEEEEEEEEccch-
Confidence            45899999999999876        5799999999999987655   57889999999998 789999999999865 2 


Q ss_pred             ccCCchhhhhhccccccccccccccccccCCceeeecccccccchhhhhhhhccCCCCccCCCCCCCCcEEEEcCCHHHH
Q 005273          153 DLEPRTWDFISRLEAKVGSVEHMLDKRASGDLINIIHDCKKVSDDTLLRKEISSGSEGLYNYPRTRKPKVAVVGGGPSGL  232 (704)
Q Consensus       153 ~~~~~~~~~i~~~~~~~~~~e~~~~~~~~~~~v~i~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~vvG~G~aGl  232 (704)
                            ...+.++... .             .+.      ..+       ..  .+..+...+....+||+|||||++|+
T Consensus        76 ------~~~l~r~~~~-~-------------~~~------~~~-------~~--~~~~~~~~~~~~~~DVVIVGgGpaGL  120 (549)
T 3nlc_A           76 ------TALLAKFAND-P-------------HVR------QTP-------DM--EYKFVAKAPENLTERPIVIGFGPCGL  120 (549)
T ss_dssp             ------HHHHHTTTTC-T-------------TEE------ECC-------CC--CCCCCCCCCTTCCCCCEEECCSHHHH
T ss_pred             ------hHHHHhhccC-c-------------ccc------ccc-------cc--CCCCcCcCccCCCCCEEEECcCHHHH
Confidence                  1233332110 0             000      000       00  11111111233458999999999999


Q ss_pred             HHHHHHHHcCCcEEEEEeCccccccccchhHHHHHHhhccccccccccCCcccccCcchhhhhccCchhHHHHHHHHHHc
Q 005273          233 FASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTWSDGKLVTRIGRNSNSVLAVMNTLVHF  312 (704)
Q Consensus       233 ~aA~~l~~~g~~v~l~e~~~~~~~~~~~~~~~~~~~~l~~~~n~~~g~gG~~~~sdg~l~~~~~~~~~~~~~~l~~l~~~  312 (704)
                      +||+.|++.|++|+|+|+++.++.+.......|....+++.+++.++++|++.|+++++...+.........+++++..+
T Consensus       121 ~aA~~La~~G~kV~VlEr~~~~~~R~~~~~g~w~~~~~~~~~~i~~g~gGag~~sdgkl~~~i~~~~~~~~~v~~~~~~~  200 (549)
T 3nlc_A          121 FAGLVLAQMGFNPIIVERGKEVRERTKDTFGFWRKRTLNPESNVQFGEGGAGTFSDGKLYSQVKDPNFYGRKVITEFVEA  200 (549)
T ss_dssp             HHHHHHHHTTCCCEEECSSCCHHHHHHHHHHHHHHCCCCTTSSSSSSTTGGGTTSCCCCCCCSCCTTCHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCCeEEEEEccCcccccccchhcccccccccccccceeccCCcccccCCceEEEeccccccHHHHHHHHHHc
Confidence            99999999999999999999988888778888888888889999999999999999998877665544557788899999


Q ss_pred             CCCceeecCCccccCCCChHHHHHHHHHHHHHCCCEEEeCeEEEEEEEeCCEEEEEEEcCCCCCCCCceeEEecCeEEEc
Q 005273          313 GAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILA  392 (704)
Q Consensus       313 G~~~~~~~~g~~~~g~~~~~~l~~~L~~~l~~~Gv~i~~~t~V~~i~~~~g~v~GV~~~~~~~~~~~~~~~i~Ad~VVlA  392 (704)
                      |.+..+.....++.++.....+.+.|++.+++.|++|+++++|+++..+++++++|.+.++        .++.||.||+|
T Consensus       201 G~~~~i~~~~~p~~G~~~~~~l~~~L~~~l~~~Gv~I~~~t~V~~I~~~~~~v~gV~l~~G--------~~i~Ad~VVlA  272 (549)
T 3nlc_A          201 GAPEEILYVSKPHIGTFKLVTMIEKMRATIIELGGEIRFSTRVDDLHMEDGQITGVTLSNG--------EEIKSRHVVLA  272 (549)
T ss_dssp             TCCGGGGTBSSCCCCHHHHHHHHHHHHHHHHHTTCEEESSCCEEEEEESSSBEEEEEETTS--------CEEECSCEEEC
T ss_pred             CCCceEeeccccccccchHHHHHHHHHHHHHhcCCEEEeCCEEEEEEEeCCEEEEEEECCC--------CEEECCEEEEC
Confidence            9999988888999998888889999999999999999999999999998888999998865        36999999999


Q ss_pred             CCCChHHHHHHHHhCCCcccccceeeEEEEecchhhhcccccccchhhhcccCCCCccccccceecccCCCCCCCCcccc
Q 005273          393 VGHSARDIYEMLVSHNINLVPKDFAVGLRMEHPQELINSIQYSELATEVQKGRGKVPVADYKVAKYVSGEDGDALSGVVT  472 (704)
Q Consensus       393 tG~~s~~~~~~l~~~gi~l~~~~~avG~~~~~p~~~~~~~~~~~l~~e~~~g~g~~~~~d~~~~~~~~~~~~~e~a~Rd~  472 (704)
                      +|+++++++.++...|+.+.+.++.+|+++++|+..++..+|++..     ....+|..+|++++...            
T Consensus       273 ~G~~s~~~~~~l~~~Gi~~~~~~~~vgVrve~p~~~i~~~~f~~~~-----~~~~Lp~~~~~lv~~~~------------  335 (549)
T 3nlc_A          273 VGHSARDTFEMLHERGVYMEAKPFSVGFRIEHKQSMIDEARFGPNA-----GHPILGAADYKLVHHCK------------  335 (549)
T ss_dssp             CCTTCHHHHHHHHHTTCCCEECCEEEEEEEEEEHHHHHHHHTSTTT-----TCTTTCSCCCCCEEECT------------
T ss_pred             CCCChhhHHHHHHHcCCCcccceEEEEEEecCCchhchhhhccCcC-----CcccCCCCccEEEEECC------------
Confidence            9999998888999999999899999999999999999998885432     23456678899988753            


Q ss_pred             chhhhhhhhccCCceEEEccCCCCcceecCcccccCCCccccceeEEeeecC-CcCcccCCCCchhhHHHHHHHHHHHHh
Q 005273          473 TNRSCYSFCMCPGGQIVLTSTNPLELCINGMSFSRRSSRWANAALVVTVSAK-DFDTLDLHGPLAGVKFQREFEQRAAIM  551 (704)
Q Consensus       473 ~~r~v~~fc~~~gG~vv~~~~~~~~~~vng~s~~~r~~~~~n~~~~~~v~~~-d~~p~~~~~~l~g~~~~~~~e~~a~~~  551 (704)
                      ..|.+|+|||||+|+|+..+++.+.+++||||++.|++.|+|+++++++++. ||.    .+||+|++||+.||++++.+
T Consensus       336 ~~~~v~tFcm~pgG~vv~~~~~~~~~~~nG~s~~~r~~~~~n~a~~v~~~~~~~~~----~~pl~~~~~~~~~~~~a~~~  411 (549)
T 3nlc_A          336 NGRTVYSFCMCPGGTVVAATSEEGRVVTNGMSQYSRAERNANSAIVVGISPEVDYP----GDPLAGIRFQRELESNAYKL  411 (549)
T ss_dssp             TSCEEEEEEEEEEEEEEECCCSTTCCCEEEECCTTCCSSEEEEEEEEEECBTTTBC----CSTTHHHHHHHHHHHHHHHH
T ss_pred             CCCeEEEEeeCCCCcEEEEEecCCeeEECCCCcccCCCCCcceEEEEEeecCCCCC----CCCcHHHHHHHHHHHHHHHH
Confidence            3677999999999999999999999999999999999999999999998877 773    35899999999999999999


Q ss_pred             CCCceeeccccHHhhhcCCCCCC-CCCCCcccCceeEccCCccChHHHHHHHHHHHHhhhhcCCCCCCCCeEEEEEEeee
Q 005273          552 GGGNFVVPAQKVTDFLENKLSAS-PLPPSSYRLGVKAASLHELFPTHLTDALKHSISMFDEELPGFISDTGLLHGVETRT  630 (704)
Q Consensus       552 gg~~~~~p~q~l~dfl~~~~~~~-~l~~~~~~~~~~~~~l~~~~p~~~~~~l~~~l~~~~~~~~G~~~~~a~~~Gve~~~  630 (704)
                      ||++|.+|+|+++||+.||.+.. ....++|.+++++++|+.+||+.+.+.|+++|..|++++|||.++++++||||+|+
T Consensus       412 gg~~~~~~~q~~~d~~~g~~s~~~~~~~pt~~~~~~~~~l~~~~p~~~~~~l~e~~~~~~~~~~g~~~~~~~l~g~e~~~  491 (549)
T 3nlc_A          412 GGENYDAPAQKIGDFLKGRDPSQLGDVEPSFTPGIKLTDLSKALPPFAVEAIREAIPAFDRKIKGFASEDGLLTGVETRT  491 (549)
T ss_dssp             TTSSSCEEEEEHHHHHHTCTTCCCCSSCCCCSSCEEECCGGGTSCHHHHHHHHHHHHHHHTTSTTTTCTTCEEEEEECCS
T ss_pred             cCCCCcceEEeHHHHhCCCcCCCCCCcCCCCCCCcEEechhHhCcHHHHHHHHHHHHHhhccCcCCCCCCcEEEEEeecc
Confidence            99999999999999999998753 23556799999999999999999999999999999999999999999999999999


Q ss_pred             cCceeccCCCCCccccCcCCeeEccccchhhHHHHHHHHHHHHHHHHHHhhc
Q 005273          631 SCPLQIPRNNETCESTSLKGLYPVGEGAGYAGGIVSAAADGMYAGFAVAKDF  682 (704)
Q Consensus       631 ~~p~~i~~~~~tles~~i~GLy~~GE~aG~~GGi~sA~~~G~~Aa~~i~~~~  682 (704)
                      |||+||.|| ++|||.+++|||+|||++||+|||+||+++|++||++|++.+
T Consensus       492 ssp~ri~~~-~~~~~~~~~gly~~GegaG~a~gi~~Aa~~G~~~a~~i~~~~  542 (549)
T 3nlc_A          492 SSPVCIKRG-KDFQSVNLKGFYPAGEGAGYAGGILSAGIDGIKVAEAVARDI  542 (549)
T ss_dssp             SCSEECCCT-TTTSCTTCBTEEECHHHHTSCCSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCceeEEEC-CCceECCcCCEEEccccCChhhHHHHHHHHHHHHHHHHHHHh
Confidence            999999999 679988999999999999999999999999999999999875
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 704
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 9e-16
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 3e-15
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 1e-11
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 9e-10
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 2e-08
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 6e-08
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 8e-08
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 9e-08
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 3e-07
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 4e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 5e-07
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 6e-07
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 6e-07
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 6e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 6e-07
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-06
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 1e-06
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 1e-06
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 2e-06
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 3e-06
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 3e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 4e-06
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 5e-06
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 5e-06
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 7e-06
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 8e-06
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 9e-06
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 1e-05
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 1e-05
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 1e-05
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 1e-05
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-05
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 1e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 1e-05
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 1e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 1e-05
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 2e-05
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 3e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 3e-05
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 3e-05
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 4e-05
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 6e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 1e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 1e-04
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 1e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 1e-04
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 1e-04
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-04
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 2e-04
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 4e-04
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 5e-04
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 6e-04
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 7e-04
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 0.001
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.001
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.001
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 0.001
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 0.001
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.002
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 0.002
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 0.003
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 0.003
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 0.004
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 0.004
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: HI0933 N-terminal domain-like
domain: Flavoprotein BC4706
species: Bacillus cereus [TaxId: 1396]

 Score = 75.5 bits (184), Expect = 9e-16
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 13/174 (7%)

Query: 222 VAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEG 281
           V V+GGGPSGL A++  AE GA+V L+++G  + ++    G         +  +      
Sbjct: 5   VIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHI 64

Query: 282 GAGTWSDGKLVTRIGRNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQH 341
                      +           ++    + G        G+    +++   ++      
Sbjct: 65  PGNGRFLYSAFSIFNNED-----IITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTR 119

Query: 342 LQRLGVTIKFGTRVDDLLIENARIVGVKVSDSKDNSQSDIQKLGFDAVILAVGH 395
           L+ LGV I+  T V+ +  EN +   V +   +            + V++AVG 
Sbjct: 120 LKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLE--------TNHVVIAVGG 165
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query704
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.91
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.73
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.69
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.6
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.58
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.56
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.55
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.54
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.54
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.47
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.46
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.41
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.37
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.3
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.25
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.22
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.21
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.2
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.18
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.18
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.16
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.15
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.13
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.12
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.11
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.1
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.1
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.1
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.06
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.04
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.03
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.02
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.01
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.01
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.0
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.99
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.97
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.97
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.96
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.96
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.96
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.89
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.88
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.87
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.79
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.78
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.76
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.73
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.66
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.62
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.59
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.57
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.56
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.55
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.54
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.51
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.51
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.49
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.46
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.45
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.44
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.44
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.43
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.41
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.4
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.39
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.38
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.37
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.34
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.32
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.29
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.27
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.26
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 98.25
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.23
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.23
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.22
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.2
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.18
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.17
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.1
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.09
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.08
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 98.08
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.07
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.06
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.05
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.01
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.87
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.85
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.77
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 97.74
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.74
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.59
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 97.54
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.53
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.51
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.48
d1chua3116 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.13
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 97.09
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 97.02
d2bs2a3121 Fumarate reductase {Wolinella succinogenes [TaxId: 96.67
d1kf6a3132 Fumarate reductase {Escherichia coli [TaxId: 562]} 96.64
d1neka3120 Succinate dehydogenase {Escherichia coli [TaxId: 5 96.37
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.32
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.02
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.94
d1gtea1182 Dihydropyrimidine dehydrogenase, N-terminal domain 95.7
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 95.65
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.21
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.05
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.04
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 94.96
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.92
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 94.88
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.64
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.64
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.62
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.39
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.25
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.14
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.98
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.9
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 93.75
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.72
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.7
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.62
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 93.55
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 93.36
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 93.24
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.22
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.06
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.82
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 92.79
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 92.27
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 92.19
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 92.18
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.16
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.81
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.8
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.72
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.65
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.56
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.39
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 91.32
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.18
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.16
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 91.07
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.76
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.71
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 90.67
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.39
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 90.14
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.99
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.55
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 89.53
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 89.14
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 89.0
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.47
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 88.18
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.64
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.06
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 87.03
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.9
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.76
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 86.75
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 86.61
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 86.6
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.53
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.43
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 86.13
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 86.07
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 85.89
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 85.72
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.51
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 85.5
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 85.43
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 85.4
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 85.37
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 85.25
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 84.66
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 84.51
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 84.44
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 84.01
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 83.91
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 83.67
d1id1a_153 Rck domain from putative potassium channel Kch {Es 83.6
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.59
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 83.5
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 83.08
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 83.07
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 82.78
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 82.74
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 82.61
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 82.4
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 82.29
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 82.17
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.94
d2gqfa2148 Hypothetical protein HI0933 {Haemophilus influenza 81.87
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 81.87
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 81.78
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 81.45
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 81.41
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 81.31
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 80.83
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 80.77
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 80.71
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.37
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 80.28
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.13
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: HI0933 N-terminal domain-like
domain: Hypothetical protein HI0933
species: Haemophilus influenzae [TaxId: 727]

Probab=99.91  E-value=4.9e-24  Score=216.89  Aligned_cols=161  Identities=17%  Similarity=0.213  Sum_probs=106.4

Q ss_pred             CCcEEEEcCCHHHHHHHHHHHHcCCcEEEEEeCccccccccchhHHHHHHhhccccccccccCCcccc--cCcchhhhhc
Q 005273          219 KPKVAVVGGGPSGLFASLVLAELGADVTLIERGQAVEQRGRDIGALVVRRMLEMESNFCFGEGGAGTW--SDGKLVTRIG  296 (704)
Q Consensus       219 ~~~v~vvG~G~aGl~aA~~l~~~g~~v~l~e~~~~~~~~~~~~~~~~~~~~l~~~~n~~~g~gG~~~~--sdg~l~~~~~  296 (704)
                      .+||+|||||||||+||+.|+++|++|+||||++.+|.+....+.        ..||+.........+  .++.+.....
T Consensus         4 ~~DViIIGaG~aGl~aA~~la~~G~~V~vlEk~~~~G~k~~~sGg--------G~~n~~n~~~~~~~~~~~~~~~~~~~l   75 (253)
T d2gqfa1           4 YSENIIIGAGAAGLFCAAQLAKLGKSVTVFDNGKKIGRKILMSGG--------GFCNFTNLEVTPAHYLSQNPHFVKSAL   75 (253)
T ss_dssp             ECSEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCHHHHHGGG--------GTCCCEESSCCGGGEECSCTTSTHHHH
T ss_pred             CCcEEEECcCHHHHHHHHHHHHCCCcEEEEecCCCCCCceEecCC--------ccccccCcccCchhhhccChHHHHHHh
Confidence            479999999999999999999999999999999887643211110        112222111111111  1122221111


Q ss_pred             cCchhHHHHHHHHHHcCCCceeecCCccccCCCChHHHHHHHHHHHHHCCCEEEeCeEEEEEEEeCCE--EEEEEEcCCC
Q 005273          297 RNSNSVLAVMNTLVHFGAPANILVDGKSHLGTDRLIPLLRNFRQHLQRLGVTIKFGTRVDDLLIENAR--IVGVKVSDSK  374 (704)
Q Consensus       297 ~~~~~~~~~l~~l~~~G~~~~~~~~g~~~~g~~~~~~l~~~L~~~l~~~Gv~i~~~t~V~~i~~~~g~--v~GV~~~~~~  374 (704)
                      . ........+++...+.+......+..++ ++....+++.|.+.+++.||+|+++++|+++...++.  +..+...++ 
T Consensus        76 ~-~~~~~~~~~~~~~~g~~~~~~~~~~~~~-~~~a~~i~~~L~~~~~~~gV~i~~~~~V~~i~~~~~~~~v~~~~~~~~-  152 (253)
T d2gqfa1          76 A-RYTNWDFISLVAEQGITYHEKELGQLFC-DEGAEQIVEMLKSECDKYGAKILLRSEVSQVERIQNDEKVRFVLQVNS-  152 (253)
T ss_dssp             H-HSCHHHHHHHHHHTTCCEEECSTTEEEE-TTCTHHHHHHHHHHHHHHTCEEECSCCEEEEEECCSCSSCCEEEEETT-
T ss_pred             h-hhcccchhhhhhhcCcceeeecCCcccc-ccchhHHHHHHHHHHHHcCCCeecCceEEEEEeecCCceeEEEEecCC-
Confidence            0 0123446678888898877655554443 5567789999999999999999999999999876542  222332332 


Q ss_pred             CCCCCceeEEecCeEEEcCCCCh
Q 005273          375 DNSQSDIQKLGFDAVILAVGHSA  397 (704)
Q Consensus       375 ~~~~~~~~~i~Ad~VVlAtG~~s  397 (704)
                             .+++||.||+|||+.+
T Consensus       153 -------~~~~a~~VIiAtGG~S  168 (253)
T d2gqfa1         153 -------TQWQCKNLIVATGGLS  168 (253)
T ss_dssp             -------EEEEESEEEECCCCSS
T ss_pred             -------EEEEeCEEEEcCCccc
Confidence                   4799999999999865
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gqfa2 e.74.1.1 (A:195-342) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure