Citrus Sinensis ID: 005685

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680---

MSSDERRPLRSSNQEDLESAPDSPSNRTSTPSAAGGIKDLFKQLDRRFSDRRITFKDPPLSHSRSSSFDHHNYVDARDSLTESAPPEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVANQAKETDASDKRTLARGYSSLSPMEDKNEVLWRRTDGADELELSVVENAADSEAAEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKLSSDNSKGDSIASDVCNCCLTFLNSRSLSLLCLSISLLMTCK

ccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHcccccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEcccccccc

cccHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccHHHHHHHHHHHHHHHHHHccHHEEEEEEHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHccccccccHHHHHHHHHHccccccccccccccccccccEEEEEEHHHHHHHccccccccHHHHccccccEEcccccHHHHHHHHHHcccccEEEEccccEEEEEEEHHHHHHHHHHHHccccccccccccccccEEHHHccccEEEEcccccEEEEEc

mssderrplrssnqedlesapdspsnrtstpsaaggIKDLFKQLDRrfsdrritfkdpplshsrsssfdhhnyvdardsltesappEWALLLIGCLLGLASGLCVAFFNKGVHIIhewawagtpneGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIkqsssldrqgfdlvagVFPTIKAIQAAVTlgtgcslgpegpsvdigkscANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLrplraensppfTTAMIILASVISSTVSTVLLgtqsaftvpsydlksaaelPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKekfglppvvcpalgglgagiialrypgilywgFTNVEEILhtgktasapgiWLLTQLAAAKVVATALCkgsglvgglyapslMIGAAVGAVFGGSAAEIINsaipgnvavaePQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVpsvanqaketdasdkrtlargysslspmedknevlwrrtdgadeleLSVVENAADSEAAEEMLLEELKLLqfsippcqvsramSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSklssdnskgdsiasDVCNCCLTFLNSRSLSLLCLSISLLMTCK

mssderrplrssnqedlesapdspsnrtstpsaaggikDLFKQLDRRFsdrritfkdpplshsrsssfdhHNYVDARDSLTESAPPEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVAnqaketdasdkrtlargysslspmedknevLWRRTDGADELELSVVENAADSEAAEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKLSSDNSKGDSIASDVCNCCLTFLNSRSLSLLCLSisllmtck

MSSDERRPLRSSNQEDLESAPDSPSNRTSTPSAAGGIKDLFKQLDRRFSDRRITFKDPPLSHSRSSSFDHHNYVDARDSLTESAPPEWallligcllglasglcVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIalvaagaasgiasgfnaaVAGCFFAIETVLRPLRAENSPPFTTAMiilasvisstvstvllgtqsAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPalgglgagiialRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIgaavgavfggsaaEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVANQAKETDASDKRTLARGYSSLSPMEDKNEVLWRRTDGADELELSVVENaadseaaeemlleelkllQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKLSSDNSKGDSIASDVCNCCLTFlnsrslsllclsisllMTCK

*************************************************************************************PEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVA*******************************W*************************MLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKL********SIASDVCNCCLTFLNSRSLSLLCLSISLLMT**

*****************************************************************************DSLTESAPPEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQ**SLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVANQAKETDASD*******************VLWRRTDGADELELSVVENAADSEAAEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLS**************DVCNCCLTFLNSRSLSLLCLSISLLMT**

********************************AAGGIKDLFKQLDRRFSDRRITFKD**********FDHHNYVDARDSLTESAPPEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVAN************LARGYSSLSPMEDKNEVLWRRTDGADELELSVVENAADSEAAEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKL*********IASDVCNCCLTFLNSRSLSLLCLSISLLMTCK

**********************************GGIKDLFKQLDRRFSDRRITFKDPPLSHSRSS***HHNYVDARDSLTESAPPEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWVPSVANQAKETDASDKRTLARGYSSLSPMEDKNEVLWRR***ADELELSVVENAADSEAAEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKLSSD******IASDVCNCCLTFLNSRSLSLLCLSISLLMTCK

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		683	2.2.26 [Sep-21-2011]
Q8RXR2		781	Chloride channel protein	yes	no	0.922	0.806	0.721	0.0
Q8GX93		710	Chloride channel protein	no	no	0.778	0.749	0.425	1e-112
Q8XTT4		429	Putative chloride channel	yes	no	0.592	0.944	0.293	2e-29
B5Y1L4		472	H(+)/Cl(-) exchange trans	yes	no	0.578	0.836	0.278	4e-25
A8ALD3		473	H(+)/Cl(-) exchange trans	yes	no	0.465	0.672	0.316	3e-24
B5BL83		473	H(+)/Cl(-) exchange trans	yes	no	0.431	0.623	0.323	5e-24
Q5PD50		473	H(+)/Cl(-) exchange trans	yes	no	0.431	0.623	0.323	5e-24
B4TK31		473	H(+)/Cl(-) exchange trans	yes	no	0.431	0.623	0.323	4e-23
B5FJ02		473	H(+)/Cl(-) exchange trans	yes	no	0.431	0.623	0.323	4e-23
B5F8R6		473	H(+)/Cl(-) exchange trans	yes	no	0.431	0.623	0.323	4e-23

>sp\|Q8RXR2\|CLCF_ARATH Chloride channel protein CLC-f OS=Arabidopsis thaliana GN=CLC-F PE=2 SV=2	Back alignment and function desciption

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/679 (72%), Positives = 556/679 (81%), Gaps = 49/679 (7%)

Query: 3   SDERRPLRSSNQEDL-----ESAPDSPSNRTSTPSAAGGIKDLFKQLDRRFS--DRRITF 55
           +++R  LRS++ +++     E   D  S   +  S AGG++DLFK +DRRFS   RR++F
Sbjct: 10  NEDRHLLRSTDGDEVGIGGGEGDLDVESQSPAIRSGAGGVRDLFKHIDRRFSLSGRRLSF 69

Query: 56  KDPPLSHSRSSSFDHH---------------------NYVDARDS--------LTESAPP 86
           K   + + R     H+                     + VD R+         L +SAPP
Sbjct: 70  KR--MENIRVDRERHNPSSSSAFSAAGEEDGGGISNLHSVDDRNDEYGFDEEVLGDSAPP 127

Query: 87  EWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLI 146
           EWALLLIGCL+G+A+G+CVA FNKGVH+IHEWAWAGTPNEGAAWLRLQRLADTWHRILLI
Sbjct: 128 EWALLLIGCLIGVAAGICVAGFNKGVHVIHEWAWAGTPNEGAAWLRLQRLADTWHRILLI 187

Query: 147 PVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPE 206
           PVTGGVIVGMMHGLLEIL+QI+QS+S  RQG D +AG++P IKAIQAAVTLGTGCSLGPE
Sbjct: 188 PVTGGVIVGMMHGLLEILDQIRQSNSSQRQGLDFLAGIYPVIKAIQAAVTLGTGCSLGPE 247

Query: 207 GPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLR 266
           GPSVDIGKSCANGF+LMMENNRER+IAL AAGAASGIASGFNAAVAGCFFAIETVLRPLR
Sbjct: 248 GPSVDIGKSCANGFALMMENNRERRIALTAAGAASGIASGFNAAVAGCFFAIETVLRPLR 307

Query: 267 AENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVS 326
           AENSPPFTTAMIILASVISSTVS  LLGTQSAFTVPSYDLKSAAELPLYLILGMLCG VS
Sbjct: 308 AENSPPFTTAMIILASVISSTVSNALLGTQSAFTVPSYDLKSAAELPLYLILGMLCGAVS 367

Query: 327 VVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHT 386
           VVF+RLV WFTKSFDFIK+KFGLP +VCPALGGLGAGIIAL+YPGILYWGFTNVEEILHT
Sbjct: 368 VVFSRLVTWFTKSFDFIKDKFGLPAIVCPALGGLGAGIIALKYPGILYWGFTNVEEILHT 427

Query: 387 GKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINS 446
           GK+ASAPGIWLL QLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIIN 
Sbjct: 428 GKSASAPGIWLLAQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINR 487

Query: 447 AIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAIWV 506
           AIPGN AVA+PQAYALVGMAATLAS+CSVPLTSVLLLFELT+DYRILLPLMGAVGLAIWV
Sbjct: 488 AIPGNAAVAQPQAYALVGMAATLASMCSVPLTSVLLLFELTKDYRILLPLMGAVGLAIWV 547

Query: 507 PSVANQAKETDASDKRTLARGYSSLSPMEDKNEVLWRRTDGADELELSVVENA-ADSEAA 565
           PSVANQ KE+D+S+ R+  RGYSSLSP E K E +WR TD AD LEL+V+EN   +S   
Sbjct: 548 PSVANQGKESDSSEGRSTGRGYSSLSPSERKTEGVWRHTDNADSLELTVIENPDHNSFLD 607

Query: 566 EEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDF 625
           EE +LE+LK++          R MSK++VKV+   TL+EA   +K+  QNC++VV+ +DF
Sbjct: 608 EETILEDLKVM----------RVMSKNYVKVSSGTTLREARNILKESHQNCIMVVDDDDF 657

Query: 626 LEGILTYGDIKRCLSKLSS 644
           L GILT+GDI+R LS  +S
Sbjct: 658 LAGILTHGDIRRYLSNNAS 676

Voltage-gated chloride channel.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8GX93\|CLCE_ARATH Chloride channel protein CLC-e OS=Arabidopsis thaliana GN=CLC-E PE=2 SV=2	Back alignment and function description

>sp\|Q8XTT4\|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2	Back alignment and function description

>sp\|B5Y1L4\|CLCA_KLEP3 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae (strain 342) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|A8ALD3\|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B5BL83\|CLCA_SALPK H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain AKU_12601) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|Q5PD50\|CLCA_SALPA H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B4TK31\|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B5FJ02\|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1	Back alignment and function description

>sp\|B5F8R6\|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		683
147835092		747	hypothetical protein VITISV_004413 [Viti	0.932	0.852	0.783	0.0
296090045		747	unnamed protein product [Vitis vinifera]	0.932	0.852	0.781	0.0
8778501		784	F20N2.5 [Arabidopsis thaliana]	0.950	0.827	0.700	0.0
13620170		780	hypothetical protein [Capsella rubella]	0.964	0.844	0.701	0.0
18405453		781	chloride channel protein CLC-f [Arabidop	0.922	0.806	0.721	0.0
297853268		781	CLC-F [Arabidopsis lyrata subsp. lyrata]	0.922	0.806	0.72	0.0
255576623		776	voltage-gated clc-type chloride channel,	0.907	0.798	0.780	0.0
449461120		795	PREDICTED: chloride channel protein CLC-	0.961	0.826	0.692	0.0
13620228		750	hypothetical protein [Solanum lycopersic	0.963	0.877	0.694	0.0
350539551		750	uncharacterized protein LOC606305 [Solan	0.963	0.877	0.692	0.0

>gi\|147835092\|emb\|CAN65681.1\| hypothetical protein VITISV_004413 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/659 (78%), Positives = 568/659 (86%), Gaps = 22/659 (3%)

Query: 32  SAAGGIKDLFKQ-LDRRFSDRRITFK------DPPLSHSRSSSFDHHNYVDARDSLTESA 84
           S + GIKDL K  LDR FS RR++FK      +  L +   SSFDH    D  D+L +SA
Sbjct: 31  SKSKGIKDLLKHHLDRGFSGRRLSFKRLESNRERDLHNHHHSSFDH---ADLGDALGDSA 87

Query: 85  PPEWALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRIL 144
           PPEWALLLIGCLLGLA+GLCVA FN+GVH+IHEWAWAGTPNEGAAWLRLQRLADTWHRIL
Sbjct: 88  PPEWALLLIGCLLGLATGLCVAAFNRGVHVIHEWAWAGTPNEGAAWLRLQRLADTWHRIL 147

Query: 145 LIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLG 204
           LIPVTGGV+VGMMHGLLEIL+QIKQSSS  RQGFDL+A V PTIKAIQAAVTLGTGCSLG
Sbjct: 148 LIPVTGGVVVGMMHGLLEILDQIKQSSSSQRQGFDLLAAVSPTIKAIQAAVTLGTGCSLG 207

Query: 205 PEGPSVDIGKSCANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRP 264
           PEGPSVDIGKSCANGFS+MMENNRERKIALVAAGAA+GIASGFNAAVAGCFFAIETVLRP
Sbjct: 208 PEGPSVDIGKSCANGFSVMMENNRERKIALVAAGAAAGIASGFNAAVAGCFFAIETVLRP 267

Query: 265 LRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGV 324
           LRAENSPPFTTAMIILASVISSTVS VLLG + AFTVP Y+LKSAAELPLYLILGMLCGV
Sbjct: 268 LRAENSPPFTTAMIILASVISSTVSNVLLGEKPAFTVPVYELKSAAELPLYLILGMLCGV 327

Query: 325 VSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEIL 384
           VSV FTRLVAW++KSF+ IKEKFGLP VVCPALGGLGAGIIAL+YPGILYWGFTNVEEIL
Sbjct: 328 VSVAFTRLVAWYSKSFELIKEKFGLPAVVCPALGGLGAGIIALKYPGILYWGFTNVEEIL 387

Query: 385 HTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEII 444
           HTGK+ASAPGI LL QLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAE+I
Sbjct: 388 HTGKSASAPGIGLLAQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAELI 447

Query: 445 NSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLAI 504
           NSAIPGN AVA+PQAYALVGMAATLASVCSVPLTSVLLLFELT+DYRILLPLMGAVGLAI
Sbjct: 448 NSAIPGNAAVAQPQAYALVGMAATLASVCSVPLTSVLLLFELTKDYRILLPLMGAVGLAI 507

Query: 505 WVPSVANQAKETDASDKRTLARGYSSLSPMEDKNEVLWRRTDGADELELSVVENAADSEA 564
           WVPSVANQAKET+ASD R+ +RGYS +SP+EDKNE +WR+T   D LELSV+ N++D+EA
Sbjct: 508 WVPSVANQAKETEASDTRSPSRGYSFVSPVEDKNEGIWRQTGDGDSLELSVIGNSSDNEA 567

Query: 565 -AEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGE 623
             +++LLE+LK          VS+AMSK+FVKV+ T+TLKEA + M D QQNCVLVV+ E
Sbjct: 568 INDDVLLEDLK----------VSQAMSKNFVKVSSTMTLKEATKCMHDRQQNCVLVVDAE 617

Query: 624 DFLEGILTYGDIKRCLSKLSSDNSKGDSIASDVCNCCLTFLNSRSLSLLCLSISLLMTC 682
           DFLEGILTYGDIKR LSK S +  KGDS   DV    ++ + +R +S       LL TC
Sbjct: 618 DFLEGILTYGDIKRYLSKKSKEAPKGDSSLPDVNASLVSSVCTRGMSYRGRXRGLL-TC 675

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296090045\|emb\|CBI39864.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|8778501\|gb\|AAF79509.1\|AC002328_17 F20N2.5 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|13620170\|emb\|CAC36391.1\| hypothetical protein [Capsella rubella]	Back alignment and taxonomy information

>gi|18405453|ref|NP_564698.1| chloride channel protein CLC-f [Arabidopsis thaliana] gi|41688504|sp|Q8RXR2.2|CLCF_ARATH RecName: Full=Chloride channel protein CLC-f; Short=AtCLC-f; AltName: Full=CBS domain-containing protein CBSCLC1 gi|14039802|gb|AAK53391.1|AF366368_1 CLC-f chloride channel protein [Arabidopsis thaliana] gi|13619402|emb|CAC36386.1| hypothetical protein [Arabidopsis thaliana] gi|332195154|gb|AEE33275.1| chloride channel protein CLC-f [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297853268\|ref\|XP_002894515.1\| CLC-F [Arabidopsis lyrata subsp. lyrata] gi\|297340357\|gb\|EFH70774.1\| CLC-F [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|255576623\|ref\|XP_002529201.1\| voltage-gated clc-type chloride channel, putative [Ricinus communis] gi\|223531319\|gb\|EEF33157.1\| voltage-gated clc-type chloride channel, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449461120\|ref\|XP_004148291.1\| PREDICTED: chloride channel protein CLC-f-like [Cucumis sativus] gi\|449506605\|ref\|XP_004162795.1\| PREDICTED: chloride channel protein CLC-f-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|13620228\|emb\|CAC36403.1\| hypothetical protein [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|350539551\|ref\|NP_001234185.1\| uncharacterized protein LOC606305 [Solanum lycopersicum] gi\|13620222\|emb\|CAC36398.1\| hypothetical protein [Solanum lycopersicum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		683
TAIR\|locus:2020542		781	CLC-F "chloride channel F" [Ar	0.837	0.732	0.662	6.8e-208
TIGR_CMR\|GSU_2363		614	GSU_2363 "chloride channel fam	0.279	0.311	0.347	2.9e-18
TIGR_CMR\|SPO_1208		581	SPO_1208 "voltage-gated chlori	0.551	0.648	0.24	6.6e-18
UNIPROTKB\|Q9KM62		468	clcA "H(+)/Cl(-) exchange tran	0.453	0.662	0.256	2.3e-14
TIGR_CMR\|VC_A0526		468	VC_A0526 "conserved hypothetic	0.453	0.662	0.256	2.3e-14
UNIPROTKB\|P37019		473	clcA "ClcA" [Escherichia coli	0.467	0.674	0.235	3.8e-09
RGD\|708381		747	Clcn4 "chloride channel, volta	0.162	0.148	0.278	1.1e-07
UNIPROTKB\|Q56A19		754	Clcn4 "Putative chloride chann	0.162	0.147	0.278	1.2e-07
ZFIN\|ZDB-GENE-061013-353		768	zgc:153764 "zgc:153764" [Danio	0.162	0.144	0.303	1.3e-07
ZFIN\|ZDB-GENE-030131-1699		874	clcn3 "chloride channel 3" [Da	0.194	0.152	0.275	2e-07

TAIR\|locus:2020542 CLC-F "chloride channel F" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1936 (686.6 bits), Expect = 6.8e-208, Sum P(2) = 6.8e-208
 Identities = 386/583 (66%), Positives = 430/583 (73%)

Query:    62 HSRSSSFDHHNYVDARDSLTESAPPEWXXXXXXXXXXXXXXXXVAFFNKGVHIIHEWAWA 121
             HS     D + + +  + L +SAPPEW                VA FNKGVH+IHEWAWA
Sbjct:   105 HSVDDRNDEYGFDE--EVLGDSAPPEWALLLIGCLIGVAAGICVAGFNKGVHVIHEWAWA 162

Query:   122 GTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILNQIKQSSSLDRQGFDLV 181
             GTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEIL+QI+QS+S  RQG D +
Sbjct:   163 GTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILDQIRQSNSSQRQGLDFL 222

Query:   182 AGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIXXXXXXXXX 241
             AG++P IKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGF+LMMENNRER+I         
Sbjct:   223 AGIYPVIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFALMMENNRERRIALTAAGAAS 282

Query:   242 XXXXXXXXXVAGCFFAIETVLRPLRAENSPPFTTAMXXXXXXXXXXXXXXXXXXXXAFTV 301
                      VAGCFFAIETVLRPLRAENSPPFTTAM                    AFTV
Sbjct:   283 GIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSNALLGTQSAFTV 342

Query:   302 PSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPXXXXXX 361
             PSYDLKSAAELPLYLILGMLCG VSVVF+RLV WFTKSFDFIK+KFGLP +VCP      
Sbjct:   343 PSYDLKSAAELPLYLILGMLCGAVSVVFSRLVTWFTKSFDFIKDKFGLPAIVCPALGGLG 402

Query:   362 XXXXXXRYPGILYWGFTNVEEILHTGKTASAPGIWLLTQLAAAKVVATALCKGSGLVGGL 421
                   +YPGILYWGFTNVEEILHTGK+ASAPGIWLL QLAAAKVVATALCKGSGLVGGL
Sbjct:   403 AGIIALKYPGILYWGFTNVEEILHTGKSASAPGIWLLAQLAAAKVVATALCKGSGLVGGL 462

Query:   422 YAPSLMIXXXXXXXXXXXXXEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLTSVL 481
             YAPSLMI             EIIN AIPGN AVA+PQAYALVGMAATLAS+CSVPLTSVL
Sbjct:   463 YAPSLMIGAAVGAVFGGSAAEIINRAIPGNAAVAQPQAYALVGMAATLASMCSVPLTSVL 522

Query:   482 LLFELTRDYRILLPLMGAVGLAIWVPSVANQAKETDASDKRTLARGYSSLSPMEDKNEVL 541
             LLFELT+DYRILLPLMGAVGLAIWVPSVANQ KE+D+S+ R+  RGYSSLSP E K E +
Sbjct:   523 LLFELTKDYRILLPLMGAVGLAIWVPSVANQGKESDSSEGRSTGRGYSSLSPSERKTEGV 582

Query:   542 WRRTDGADELELSVVENXXXXXXXXXXXXXXXXXXQFSIPPCQVSRAMSKDFVKVALTVT 601
             WR TD AD LEL+V+EN                     +   +V R MSK++VKV+   T
Sbjct:   583 WRHTDNADSLELTVIENPDHNSFLDEETI---------LEDLKVMRVMSKNYVKVSSGTT 633

Query:   602 LKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRCLSKLSS 644
             L+EA   +K+  QNC++VV+ +DFL GILT+GDI+R LS  +S
Sbjct:   634 LREARNILKESHQNCIMVVDDDDFLAGILTHGDIRRYLSNNAS 676

GO:0005216 "ion channel activity" evidence=IEA

GO:0005247 "voltage-gated chloride channel activity" evidence=IEA;ISS

GO:0006821 "chloride transport" evidence=IEA;ISS

GO:0016020 "membrane" evidence=IEA;ISS

GO:0055085 "transmembrane transport" evidence=IEA

GO:0009507 "chloroplast" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

TIGR_CMR\|GSU_2363 GSU_2363 "chloride channel family protein, putative" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_1208 SPO_1208 "voltage-gated chloride channel family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KM62 clcA "H(+)/Cl(-) exchange transporter ClcA" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_A0526 VC_A0526 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|P37019 clcA "ClcA" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

RGD\|708381 Clcn4 "chloride channel, voltage-sensitive 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q56A19 Clcn4 "Putative chloride channel 4-2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061013-353 zgc:153764 "zgc:153764" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-1699 clcn3 "chloride channel 3" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8RXR2	CLCF_ARATH	No assigned EC number	0.7216	0.9224	0.8066	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00003335001	SubName- Full=Chromosome undetermined scaffold_142, whole genome shotgun sequence; (747 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00019950001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (670 aa)	•	•	0.569

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		683
cd00400		383	cd00400, Voltage_gated_ClC, CLC voltage-gated chlo	1e-103
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	1e-76
COG0038		443	COG0038, EriC, Chloride channel protein EriC [Inor	6e-61
cd01031		402	cd01031, EriC, ClC chloride channel EriC	2e-55
PRK01862		574	PRK01862, PRK01862, putative voltage-gated ClC-typ	3e-53
PRK05277		438	PRK05277, PRK05277, chloride channel protein; Prov	2e-44
cd01033		388	cd01033, ClC_like, Putative ClC chloride channel	3e-35
cd01034		390	cd01034, EriC_like, ClC chloride channel family	6e-32
cd03684		445	cd03684, ClC_3_like, ClC-3-like chloride channel p	4e-27
PRK01610		418	PRK01610, PRK01610, putative voltage-gated ClC-typ	4e-25
cd03683		426	cd03683, ClC_1_like, ClC-1-like chloride channel p	1e-24
cd01036		416	cd01036, ClC_euk, Chloride channel, ClC	9e-24
cd04592		133	cd04592, CBS_pair_EriC_assoc_euk, This cd contains	6e-20
cd03685		466	cd03685, ClC_6_like, ClC-6-like chloride channel p	1e-15
cd03682		378	cd03682, ClC_sycA_like, ClC sycA-like chloride cha	1e-13
pfam00571		57	pfam00571, CBS, CBS domain	2e-08
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	3e-07
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	3e-06
cd04626		111	cd04626, CBS_pair_13, The CBS domain, named after	8e-06
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	2e-05
cd04607		113	cd04607, CBS_pair_NTP_transferase_assoc, This cd c	2e-05
COG0517		117	COG0517, COG0517, FOG: CBS domain [General functio	3e-05
cd04604		114	cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain	8e-05
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	1e-04
cd04613		114	cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con	2e-04
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after	2e-04
PRK03655		414	PRK03655, PRK03655, putative ion channel protein;	4e-04
cd01031		402	cd01031, EriC, ClC chloride channel EriC	0.001

>gnl\|CDD\|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel	Back alignment and domain information

 Score =  320 bits (823), Expect = e-103
 Identities = 163/408 (39%), Positives = 227/408 (55%), Gaps = 28/408 (6%)

Query: 98  GLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMM 157
           G+ SGL    F   + ++    + G P E AA             ILL+PV GG++VG++
Sbjct: 1   GVLSGLGAVLFRLLIELLQNLLFGGLPGELAAGSLS------PLYILLVPVIGGLLVGLL 54

Query: 158 HGLL--EILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKS 215
             LL     + I +       G   +      +K + +A+TLG+G S+G EGP V IG +
Sbjct: 55  VRLLGPARGHGIPEVIEAIALGGGRLPLRVALVKFLASALTLGSGGSVGREGPIVQIGAA 114

Query: 216 CANGFSLMMENNRERKIALVAAGAASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTT 275
             +     +  +R  +  LVA GAA+GIA+ FNA +AG  FAIE +L           + 
Sbjct: 115 IGSWLGRRLRLSRNDRRILVACGAAAGIAAAFNAPLAGALFAIEVLLGEYSVA-----SL 169

Query: 276 AMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLILGMLCGVVSVVFTRLVAW 335
             ++LASV ++ VS +L G + AF VP YD  S  ELPLYL+LG+L G+V V+F RL+  
Sbjct: 170 IPVLLASVAAALVSRLLFGAEPAFGVPLYDPLSLLELPLYLLLGLLAGLVGVLFVRLLYK 229

Query: 336 FTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGI 395
             + F     +  +PP + PALGGL  G++ L  P +L  G+  +   L     A    +
Sbjct: 230 IERLF----RRLPIPPWLRPALGGLLLGLLGLFLPQVLGSGYGAILLAL-----AGELSL 280

Query: 396 WLLTQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVA 455
            LL  L   K++ATAL  GSG  GG++APSL IGAA+GA FG     ++ +  PG   VA
Sbjct: 281 LLLLLLLLLKLLATALTLGSGFPGGVFAPSLFIGAALGAAFG----LLLPALFPG--LVA 334

Query: 456 EPQAYALVGMAATLASVCSVPLTSVLLLFELTRDYRILLPLMGAVGLA 503
            P AYALVGMAA LA+V   PLT++LL+ ELT DY +LLPLM AV +A
Sbjct: 335 SPGAYALVGMAALLAAVLRAPLTAILLVLELTGDYSLLLPLMLAVVIA 382

The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function. Length = 383

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238504 cd01031, EriC, ClC chloride channel EriC	Back alignment and domain information

>gnl\|CDD\|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>gnl\|CDD\|235385 PRK05277, PRK05277, chloride channel protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238505 cd01033, ClC_like, Putative ClC chloride channel	Back alignment and domain information

>gnl\|CDD\|238506 cd01034, EriC_like, ClC chloride channel family	Back alignment and domain information

>gnl\|CDD\|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|234963 PRK01610, PRK01610, putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>gnl\|CDD\|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|238507 cd01036, ClC_euk, Chloride channel, ClC	Back alignment and domain information

>gnl\|CDD\|239965 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>gnl\|CDD\|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239654 cd03682, ClC_sycA_like, ClC sycA-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239998 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>gnl\|CDD\|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|235148 PRK03655, PRK03655, putative ion channel protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238504 cd01031, EriC, ClC chloride channel EriC	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		683
PRK01862		574	putative voltage-gated ClC-type chloride channel C	100.0
PRK01610		418	putative voltage-gated ClC-type chloride channel C	100.0
KOG0475		696	consensus Cl- channel CLC-3 and related proteins (	100.0
KOG0474		762	consensus Cl- channel CLC-7 and related proteins (	100.0
cd03684		445	ClC_3_like ClC-3-like chloride channel proteins. T	100.0
cd01033		388	ClC_like Putative ClC chloride channel. Clc protei	100.0
KOG0476		931	consensus Cl- channel CLC-2 and related proteins (	100.0
cd01031		402	EriC ClC chloride channel EriC. This domain is fou	100.0
cd03685		466	ClC_6_like ClC-6-like chloride channel proteins. T	100.0
PRK05277		438	chloride channel protein; Provisional	100.0
cd03683		426	ClC_1_like ClC-1-like chloride channel proteins. T	100.0
cd01034		390	EriC_like ClC chloride channel family. These prote	100.0
COG0038		443	EriC Chloride channel protein EriC [Inorganic ion	100.0
cd01036		416	ClC_euk Chloride channel, ClC. These domains are f	100.0
PF00654		355	Voltage_CLC: Voltage gated chloride channel Mutati	100.0
cd00400		383	Voltage_gated_ClC CLC voltage-gated chloride chann	100.0
PRK03655		414	putative ion channel protein; Provisional	100.0
cd03682		378	ClC_sycA_like ClC sycA-like chloride channel prote	100.0
PRK01862		574	putative voltage-gated ClC-type chloride channel C	99.74
cd00400		383	Voltage_gated_ClC CLC voltage-gated chloride chann	99.66
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.63
cd01031		402	EriC ClC chloride channel EriC. This domain is fou	99.63
PRK05277		438	chloride channel protein; Provisional	99.62
cd01034		390	EriC_like ClC chloride channel family. These prote	99.57
cd01033		388	ClC_like Putative ClC chloride channel. Clc protei	99.54
cd03682		378	ClC_sycA_like ClC sycA-like chloride channel prote	99.53
cd03685		466	ClC_6_like ClC-6-like chloride channel proteins. T	99.48
PRK01610		418	putative voltage-gated ClC-type chloride channel C	99.47
COG0038		443	EriC Chloride channel protein EriC [Inorganic ion	99.4
cd03683		426	ClC_1_like ClC-1-like chloride channel proteins. T	99.39
cd01036		416	ClC_euk Chloride channel, ClC. These domains are f	99.38
cd03684		445	ClC_3_like ClC-3-like chloride channel proteins. T	99.35
PRK03655		414	putative ion channel protein; Provisional	99.26
PF00654		355	Voltage_CLC: Voltage gated chloride channel Mutati	99.07
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.81
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	98.64
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	98.5
COG2524		294	Predicted transcriptional regulator, contains C-te	98.44
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	98.27
KOG0474		762	consensus Cl- channel CLC-7 and related proteins (	98.17
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	98.15
COG3448		382	CBS-domain-containing membrane protein [Signal tra	98.12
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	98.05
COG2524		294	Predicted transcriptional regulator, contains C-te	98.04
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	98.02
COG3620		187	Predicted transcriptional regulator with C-termina	97.96
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	97.96
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	97.92
COG4109		432	Predicted transcriptional regulator containing CBS	97.9
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	97.9
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	97.89
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	97.88
COG3620		187	Predicted transcriptional regulator with C-termina	97.87
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	97.87
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	97.86
KOG0476		931	consensus Cl- channel CLC-2 and related proteins (	97.85
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	97.85
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	97.83
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	97.83
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	97.82
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	97.82
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	97.81
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	97.79
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	97.78
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	97.76
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	97.76
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	97.75
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	97.74
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	97.74
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	97.73
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	97.73
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	97.72
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	97.72
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	97.7
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	97.7
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	97.69
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	97.69
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	97.69
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	97.69
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	97.69
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	97.69
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	97.69
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	97.68
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	97.68
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	97.66
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	97.65
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	97.65
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	97.65
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	97.64
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	97.63
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	97.63
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	97.63
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	97.63
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	97.62
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	97.61
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	97.61
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	97.61
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	97.6
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	97.6
PRK14869		546	putative manganese-dependent inorganic pyrophospha	97.6
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	97.59
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	97.58
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	97.58
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	97.58
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	97.58
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	97.58
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	97.57
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	97.57
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	97.57
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	97.56
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	97.56
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	97.55
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	97.55
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	97.55
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	97.54
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	97.53
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	97.53
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	97.52
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	97.52
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	97.52
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	97.51
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	97.5
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	97.49
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	97.49
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	97.49
PLN02274		505	inosine-5'-monophosphate dehydrogenase	97.48
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	97.48
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	97.47
COG0517		117	FOG: CBS domain [General function prediction only]	97.47
PRK14869		546	putative manganese-dependent inorganic pyrophospha	97.47
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	97.46
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	97.46
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.46
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	97.45
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	97.44
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	97.44
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	97.43
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	97.43
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	97.41
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	97.39
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	97.39
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	97.37
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	97.36
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	97.36
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	97.35
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	97.34
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	97.34
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	97.33
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	97.31
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	97.29
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	97.29
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	97.29
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	97.28
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	97.28
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	97.27
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	97.25
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	97.25
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	97.25
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	97.22
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	97.21
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	97.19
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	97.17
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	97.17
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	97.16
COG4109		432	Predicted transcriptional regulator containing CBS	97.15
COG2905		610	Predicted signal-transduction protein containing c	97.14
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	97.13
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	97.12
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	97.12
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	97.11
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	97.11
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	97.09
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	97.09
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	97.04
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	97.04
COG2905		610	Predicted signal-transduction protein containing c	97.04
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	97.03
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	97.03
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	97.02
PLN02274		505	inosine-5'-monophosphate dehydrogenase	97.01
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	97.01
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	97.01
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	97.0
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	97.0
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	96.96
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	96.96
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	96.96
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	96.94
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	96.9
KOG0475		696	consensus Cl- channel CLC-3 and related proteins (	96.89
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	96.88
COG0517		117	FOG: CBS domain [General function prediction only]	96.87
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	96.84
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	96.82
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	96.79
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	96.77
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	96.76
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	96.74
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	96.73
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	96.73
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	96.7
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	96.68
PRK11573		413	hypothetical protein; Provisional	96.62
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	96.61
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	96.59
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	96.54
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	96.48
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	96.38
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	96.35
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	96.3
COG1253		429	TlyC Hemolysins and related proteins containing CB	96.17
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	95.93
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	95.8
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	95.53
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	95.49
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	94.58
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	93.73
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	93.53
KOG1764		381	consensus 5'-AMP-activated protein kinase, gamma s	93.0
COG1253		429	TlyC Hemolysins and related proteins containing CB	92.77
PRK11573		413	hypothetical protein; Provisional	92.55
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	91.32
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	90.32
KOG1764		381	consensus 5'-AMP-activated protein kinase, gamma s	90.05
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	90.03
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	83.59
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	82.5
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	80.29

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.3e-70  Score=630.39  Aligned_cols=489  Identities=27%  Similarity=0.444  Sum_probs=403.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcchhhHHHHhhhhhhHHHHHHHHHHHHHHHHHHHH---------
Q 005685           89 ALLLIGCLLGLASGLCVAFFNKGVHIIHEWAWAGTPNEGAAWLRLQRLADTWHRILLIPVTGGVIVGMMHG---------  159 (683)
Q Consensus        89 ~l~~~~~liG~~~Gl~~~~f~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lip~~gglivgl~~g---------  159 (683)
                      .+++.++++|+++|+++++|+.++++.++++|...+..    ... ....+|++.+++|++||+++|++..         
T Consensus        23 ~~~~~~~~vG~~~Gl~~~~f~~~~~~~~~~~~~~~~~~----~~~-~~~~~~~~~~~~p~~ggli~~~~~~~~~~~~~~~   97 (574)
T PRK01862         23 TMLIWSAIVGIGGAFATTAFREGIELIQHLISGHSGSF----VEM-AKSLPWYVRVWLPAAGGFLAGCVLLLANRGARKG   97 (574)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchH----HHH-hhcccHHHHHHHHHHHHHHHHHHHHHhccccccC
Confidence            36789999999999999999999999999988643211    111 1124566678899999999998742         


Q ss_pred             -HHHHHHhhhcCCcccccCcccccchhhHHHHHHHHHHhhccCccCCchhHHHHHHHHHHHHHhhhcCCHHHHHHHHHhh
Q 005685          160 -LLEILNQIKQSSSLDRQGFDLVAGVFPTIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFSLMMENNRERKIALVAAG  238 (683)
Q Consensus       160 -~~~v~~~i~~~~~~~~~g~~~~~~~~~~~k~i~~~~tlgsG~s~G~EGP~v~iGa~ig~~l~~~~~~~~~~r~~l~~~G  238 (683)
                       .+++++.++...       ..++.+..+.|++++++++++|+|+|||||+||+|+++|++++|+++.+++++|.+++||
T Consensus        98 g~~~~~~~~~~~~-------~~~~~~~~~~k~~~~~l~i~~G~s~G~EgP~v~~ga~~~~~~~~~~~~~~~~~r~l~~~G  170 (574)
T PRK01862         98 GKTDYMEAVALGD-------GVVPVRQSLWRSASSLLTIGSGGSIGREGPMVQLAALAASLVGRFAHFDPPRLRLLVACG  170 (574)
T ss_pred             CcHHHHHHHHcCC-------CCCChHHHHHHHHHHHHHHHcCCCcCCcchHHHHHHHHHHHHHHHhCCCHHHHHHHHHHH
Confidence             233444443211       112334556799999999999999999999999999999999999998888888899999


Q ss_pred             hhhhhhhhcccccchhhhheecccccccccCCCchhHHHHHHHHHHHHHHHHhhcCCcccccccccCccccchHHHHHHH
Q 005685          239 AASGIASGFNAAVAGCFFAIETVLRPLRAENSPPFTTAMIILASVISSTVSTVLLGTQSAFTVPSYDLKSAAELPLYLIL  318 (683)
Q Consensus       239 aaAGiaa~F~aPi~G~lFa~E~~~~~~~~~~~~~~~~~~~~~asv~a~~v~~~l~g~~~~f~~~~~~~~~~~~l~~~ill  318 (683)
                      +|||+||+||||++|++|++|+++++++.+.     .++++++|++|+++++.++|+++.|.++.++.++..++++++++
T Consensus       171 ~aAglaa~F~aPl~g~lFa~E~~~~~~~~~~-----~~~~~~as~~a~~v~~~~~g~~~~~~~~~~~~~~~~~~~~~~~l  245 (574)
T PRK01862        171 AAAGITSAYNAPIAGAFFVAEIVLGSIAMES-----FGPLVVASVVANIVMREFAGYQPPYEMPVFPAVTGWEVLLFVAL  245 (574)
T ss_pred             HHHHHHHHhCCchHHHHHHHHHHhhhccHHH-----HHHHHHHHHHHHHHHHHHcCCCceeeCCCcCcCCHHHHHHHHHH
Confidence            9999999999999999999999988776654     45689999999999999999999999887776778999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCchhHHHhhhHHHHHHHHhhcccccccChHHHHHHHhcCCCCCCchHHHH
Q 005685          319 GMLCGVVSVVFTRLVAWFTKSFDFIKEKFGLPPVVCPALGGLGAGIIALRYPGILYWGFTNVEEILHTGKTASAPGIWLL  398 (683)
Q Consensus       319 Gil~Gl~g~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~iggl~~g~i~~~~P~~lg~G~~~i~~~l~~~~~~~~~~~~~L  398 (683)
                      |++||++|.+|++++.+++++++++    +.+++++++++|+++|++++++|+.+|+||+.+++++++.     ..+..+
T Consensus       246 Gv~~G~~~~~f~~~~~~~~~~~~~~----~~~~~~~~~~~gl~~g~l~~~~p~~~g~G~~~i~~~~~~~-----~~~~~l  316 (574)
T PRK01862        246 GVLCGAAAPQFLRLLDASKNQFKRL----PVPLPVRLALGGLLVGVISVWVPEVWGNGYSVVNTILHAP-----WTWQAL  316 (574)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcc----CCchhHHHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHcCC-----chHHHH
Confidence            9999999999999999988877543    3455678899999999999999999999999998888543     234456


Q ss_pred             HHHHHHHHHHHHHhhccCCccccchhHhHHHHHHHHHHHHHHHHHHhhhCCCCccccchHHHHHHHHHHHHHHhhcchHH
Q 005685          399 TQLAAAKVVATALCKGSGLVGGLYAPSLMIGAAVGAVFGGSAAEIINSAIPGNVAVAEPQAYALVGMAATLASVCSVPLT  478 (683)
Q Consensus       399 ~~~~~~K~~~t~lt~g~G~~gG~f~Psl~iGA~~G~~~g~~~~~~~~~~~p~~~~~~~~~~~alvG~aA~~a~~~~~Plt  478 (683)
                      +.++++|+++|++|+|+|+|||.|+|++++||++|+++|..+..+    +|..  ..+|..|+++||+|++++++|+|+|
T Consensus       317 ~~~~~~K~~~t~~t~g~G~~GG~f~P~l~iGa~~G~~~g~~~~~~----~~~~--~~~~~~~a~vGmaa~~aa~~~aPlt  390 (574)
T PRK01862        317 VAVLVAKLIATAATAGSGAVGGVFTPTLFVGAVVGSLFGLAMHAL----WPGH--TSAPFAYAMVGMGAFLAGATQAPLM  390 (574)
T ss_pred             HHHHHHHHHHHHHHHccCCCccchhhHHHHHHHHHHHHHHHHHHh----CCCc--ccchHHHHHHHHHHHHHHHHccHHH
Confidence            678889999999999999999999999999999999999877643    3332  2357889999999999999999999


Q ss_pred             HHHHHHHHhCCchhHHHHHHHHHHHHHHHHHhhhccccchhhhhhhhcCCCCCCCccchhhhHhhccCCccchhhhhhhc
Q 005685          479 SVLLLFELTRDYRILLPLMGAVGLAIWVPSVANQAKETDASDKRTLARGYSSLSPMEDKNEVLWRRTDGADELELSVVEN  558 (683)
Q Consensus       479 ~ivi~~Eltg~~~~l~P~~~a~~~a~~v~~~~~~~~~~~~~~~~~~~~~yp~~~~~~~~~~~~~~~~~~~~~~~L~~~~~  558 (683)
                      ++++++|+|+++++++|+|+++++|+++++.+++   +++|+.+++.++.+.                            
T Consensus       391 ~i~l~~Elt~~~~~~~P~~ia~~~a~~v~~~~~~---~~iy~~~~~~~~~~~----------------------------  439 (574)
T PRK01862        391 AILMIFEMTLSYQVVLPLMVSCVVAYFTARALGT---TSMYEITLRRHQDEA----------------------------  439 (574)
T ss_pred             HHHHHHHHhCCHhHHHHHHHHHHHHHHHHHHhCC---CChHHHHHHhccccc----------------------------
Confidence            9999999999999999999999999999998764   467887766654321                            


Q ss_pred             cccchhHHHHHHHHHHhhhcCCcccccccccccCceeecCCCCHHHHHHHHHhCCCCEEEEEecCCeEEEEEeHHHHHHH
Q 005685          559 AADSEAAEEMLLEELKLLQFSIPPCQVSRAMSKDFVKVALTVTLKEAIESMKDGQQNCVLVVNGEDFLEGILTYGDIKRC  638 (683)
Q Consensus       559 ~~~~~~~~~~~L~~l~~~~~~~~~~~V~diM~~~~~~v~~~~tl~ea~~~l~~~~~~~lPVVd~~~~lvGiVt~~dl~~~  638 (683)
                             +.+.+++++          ++|+|++++.+++++++++|+.+.|.+++.+.+||+|++++++|+|+.+|+++.
T Consensus       440 -------~~~~L~~~~----------V~dim~~~~~~v~~~~tl~ea~~~l~~~~~~~~~VvD~~g~lvGiVt~~dL~~~  502 (574)
T PRK01862        440 -------ERERLRTTQ----------MRELIQPAQTVVPPTASVADMTRVFLEYPVKYLYVVDDDGRFRGAVALKDITSD  502 (574)
T ss_pred             -------hhhHHhhCc----------HHHHhcCCCceeCCCCCHHHHHHHHHhCCCceEEEEcCCCeEEEEEEHHHHHHH
Confidence                   123456666          999999999999999999999999999999999999999999999999999986


Q ss_pred             HhhccC--CCCcCCCCccccc
Q 005685          639 LSKLSS--DNSKGDSIASDVC  657 (683)
Q Consensus       639 ~~~~~~--~~~v~~~~~~~i~  657 (683)
                      ..++..  +.++.|.|.++..
T Consensus       503 l~~~~~~~~~~v~dim~~~~~  523 (574)
T PRK01862        503 LLDKRDTTDKTAADYAHTPFP  523 (574)
T ss_pred             hhcccccccchHHHhccCCCe
Confidence            433222  2345556654433

>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03684 ClC_3_like ClC-3-like chloride channel proteins	Back alignment and domain information

>cd01033 ClC_like Putative ClC chloride channel	Back alignment and domain information

>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01031 EriC ClC chloride channel EriC	Back alignment and domain information

>cd03685 ClC_6_like ClC-6-like chloride channel proteins	Back alignment and domain information

>PRK05277 chloride channel protein; Provisional	Back alignment and domain information

>cd03683 ClC_1_like ClC-1-like chloride channel proteins	Back alignment and domain information

>cd01034 EriC_like ClC chloride channel family	Back alignment and domain information

>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01036 ClC_euk Chloride channel, ClC	Back alignment and domain information

>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease	Back alignment and domain information

>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel	Back alignment and domain information

>PRK03655 putative ion channel protein; Provisional	Back alignment and domain information

>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>cd01031 EriC ClC chloride channel EriC	Back alignment and domain information

>PRK05277 chloride channel protein; Provisional	Back alignment and domain information

>cd01034 EriC_like ClC chloride channel family	Back alignment and domain information

>cd01033 ClC_like Putative ClC chloride channel	Back alignment and domain information

>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins	Back alignment and domain information

>cd03685 ClC_6_like ClC-6-like chloride channel proteins	Back alignment and domain information

>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03683 ClC_1_like ClC-1-like chloride channel proteins	Back alignment and domain information

>cd01036 ClC_euk Chloride channel, ClC	Back alignment and domain information

>cd03684 ClC_3_like ClC-3-like chloride channel proteins	Back alignment and domain information

>PRK03655 putative ion channel protein; Provisional	Back alignment and domain information

>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		683
1kpl_A		473	Crystal Structure Of The Clc Chloride Channel From		4e-09
3nd0_A		466	X-Ray Crystal Structure Of A Slow Cyanobacterial Cl		8e-09
2htl_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		7e-07
2ht2_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		7e-07
2ht4_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		8e-07
3ejy_A		473	Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTE		8e-07
1kpk_A		473	Crystal Structure Of The Clc Chloride Channel From		8e-07
2hlf_A		444	Structure Of The Escherichis Coli Clc Chloride Chan		8e-07
2htk_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		8e-07
2exy_A		473	Crystal Structure Of The E148q Mutant Of Ecclc, Fab		8e-07
2fec_A		465	Structure Of The E203q Mutant Of The Cl-H+ EXCHANGE		8e-07
1ots_A		465	Structure Of The Escherichia Coli Clc Chloride Chan		8e-07
1otu_A		465	Structure Of The Escherichia Coli Clc Chloride Chan		8e-07
2ht3_A		473	Structure Of The Escherichia Coli Clc Chloride Chan		8e-07
1ott_A		465	Structure Of The Escherichia Coli Clc Chloride Chan		8e-07
3ejz_A		473	Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, C		8e-07
4ene_A		446	Structure Of The N- And C-Terminal Trimmed Clc-Ec1		8e-07
4ftp_A		465	Structure Of The E202y Mutant Of The Cl-H+ ANTIPORT		9e-07
3det_A		473	Structure Of The E418a, Y445a Doubly Ungated Mutant		9e-07
2r9h_A		444	Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Com		9e-07
2ez0_A		473	Crystal Structure Of The S107aE148QY445A MUTANT OF		9e-07
3nmo_A		465	Crystal Structure Of An Engineered Monomeric Clc-Ec		2e-06

>pdb|1KPL|A Chain A, Crystal Structure Of The Clc Chloride Channel From S. Typhimurium Length = 473