Citrus Sinensis ID: 005707
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 681 | ||||||
| 225445166 | 1135 | PREDICTED: uncharacterized protein LOC10 | 0.922 | 0.553 | 0.561 | 1e-179 | |
| 255546407 | 972 | elongation factor ts, putative [Ricinus | 0.775 | 0.543 | 0.583 | 1e-166 | |
| 224143592 | 976 | predicted protein [Populus trichocarpa] | 0.760 | 0.530 | 0.595 | 1e-159 | |
| 449465685 | 1122 | PREDICTED: uncharacterized protein LOC10 | 0.883 | 0.536 | 0.467 | 1e-130 | |
| 356495216 | 1133 | PREDICTED: uncharacterized protein LOC10 | 0.767 | 0.461 | 0.515 | 1e-129 | |
| 356531295 | 1135 | PREDICTED: uncharacterized protein LOC10 | 0.885 | 0.531 | 0.467 | 1e-129 | |
| 449525214 | 1106 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.869 | 0.535 | 0.463 | 1e-126 | |
| 297738788 | 917 | unnamed protein product [Vitis vinifera] | 0.707 | 0.525 | 0.437 | 1e-108 | |
| 357500731 | 1054 | Elongation factor Ts [Medicago truncatul | 0.537 | 0.347 | 0.557 | 1e-108 | |
| 110741951 | 631 | hypothetical protein [Arabidopsis thalia | 0.541 | 0.584 | 0.544 | 1e-104 |
| >gi|225445166|ref|XP_002280712.1| PREDICTED: uncharacterized protein LOC100262932 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 634 bits (1636), Expect = e-179, Method: Compositional matrix adjust.
Identities = 381/679 (56%), Positives = 482/679 (70%), Gaps = 51/679 (7%)
Query: 1 MTPVIPCSISSISSIPVTAFTIKKNNCLTRYNSTRKSTKQTISSQRFLLPLPSSVRFFSQ 60
MTPVIP SIS+IS I TAFT KNNCLTR KSTKQT+S QRFLLPL +SVR F Q
Sbjct: 1 MTPVIPSSISNISLISGTAFTSNKNNCLTRCYLLGKSTKQTLSPQRFLLPLSTSVRLFPQ 60
Query: 61 FQSGSALQHKSALHIISATGINVAVEESDSPAADDDSAGASDIPSD-VETSESSSIKSEA 119
++SG L KS HI+SATG +VAVE+SDSPA +D S+GA ++PSD E SE SIKS+
Sbjct: 61 YRSGCTLHRKSRTHILSATGTDVAVEQSDSPATED-SSGAPEVPSDSAEASEEPSIKSDG 119
Query: 120 SPTLAESRRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSR 179
T ++ +R+R RKSEMPPVKNE+L+PGATFTGKV+SIQPFGAFIDFGAFTDGLVHVSR
Sbjct: 120 GVTSSQPKRAR-PRKSEMPPVKNEELVPGATFTGKVKSIQPFGAFIDFGAFTDGLVHVSR 178
Query: 180 LSDNFVKDVGSIVSVGQEVKVRLIEANAETGRISLTMRESDDISKLQQQKDATASGDKVR 239
LSD++VKDVG+IVS+GQEVKVRL+EAN ETGRISLTMR+SDD +K QQQKDA +S DK R
Sbjct: 179 LSDSYVKDVGNIVSIGQEVKVRLVEANTETGRISLTMRDSDDPTKPQQQKDAASSSDKPR 238
Query: 240 TTRRSTSKPGQKRDEM-KTTKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESDD 298
+RR+T + Q+RDE+ KT+KFVKGQDLEGTVKNL R+GAFISLPEGEEGFLPTSEE+D+
Sbjct: 239 PSRRNTQRSNQRRDEVKKTSKFVKGQDLEGTVKNLNRAGAFISLPEGEEGFLPTSEEADE 298
Query: 299 GFANMMGGSSLQVGQEVSVRVLRISRGQVTLTMKKEDDVGS-NLQLTQGVIHAATNPFVL 357
GF N+MGGSSLQVGQEVSVRVLRISRGQVTLTMKKE+D +L+L +GV+H ATNPFVL
Sbjct: 299 GFGNLMGGSSLQVGQEVSVRVLRISRGQVTLTMKKEEDAEKLDLKLGEGVVHTATNPFVL 358
Query: 358 AFRSNKDISSFLDERDKSATAAKKSEKP-TPIEIGGEVSQMEAGSSIPKVQDQPTSSDDG 416
AFR NK+I++FLDER+K+ A+ P T EI G+V+Q E + I +VQDQP SSD+
Sbjct: 359 AFRKNKEIATFLDEREKTVEPAEIPAIPKTSEEIEGKVNQAETVTDILEVQDQPASSDEK 418
Query: 417 MASVPSAVGETVEDHEAPSKE--------KGELADIANRNDDPQNVMSGSSETLDGALQT 468
SVPSAV E VE E PS+E L ++A+ ++D ++V+S S ++ D A+QT
Sbjct: 419 SVSVPSAVDEKVEGDETPSEELDVGASAVDDALNEMASNSEDSESVISNSLQSGD-AVQT 477
Query: 469 IEK-----------ETEETTLNQTIEETPST---------DVSGELAEQALSTDGPKAGE 508
IE+ E +T +Q IEE +T D S +A+Q LS++ E
Sbjct: 478 IEEKAVVSSEVLASERSISTASQIIEEASATHEVGSDAKSDPSTAIADQILSSESLVGKE 537
Query: 509 FTESQTEDTIAKDEVQILTP----ATEEKETKDTTEALAPEGSVSTEKQIIGEAASTNL- 563
ESQ++DTIAK EVQI TP EE++ T E S + + + S N
Sbjct: 538 VEESQSDDTIAKVEVQIETPPIVEPVEEEKVDPTPEKNGSVTSSNGQTDVPSSQESMNTD 597
Query: 564 ----------SGEIAE-QVSVSDSPKDEEVVQNQTDDVIAKDEEQIQTPTTESEIPSAGS 612
SGE+ E Q+ S+S E+VV+NQ +D+++K+E QIQTP E+EIPSA
Sbjct: 598 GSEDGGKPAPSGELVESQILSSESQDSEKVVENQANDILSKEEVQIQTPAAENEIPSATP 657
Query: 613 LKEKESGPIPDKNGSITSS 631
+++++ + KN +I++S
Sbjct: 658 VEDEKVETVTAKNNNISNS 676
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255546407|ref|XP_002514263.1| elongation factor ts, putative [Ricinus communis] gi|223546719|gb|EEF48217.1| elongation factor ts, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224143592|ref|XP_002325009.1| predicted protein [Populus trichocarpa] gi|222866443|gb|EEF03574.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449465685|ref|XP_004150558.1| PREDICTED: uncharacterized protein LOC101216355 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356495216|ref|XP_003516475.1| PREDICTED: uncharacterized protein LOC100797166 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531295|ref|XP_003534213.1| PREDICTED: uncharacterized protein LOC100804285 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449525214|ref|XP_004169613.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216355 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297738788|emb|CBI28033.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357500731|ref|XP_003620654.1| Elongation factor Ts [Medicago truncatula] gi|355495669|gb|AES76872.1| Elongation factor Ts [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|110741951|dbj|BAE98916.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 681 | ||||||
| TAIR|locus:2119946 | 953 | emb2726 "embryo defective 2726 | 0.744 | 0.532 | 0.424 | 6e-99 | |
| UNIPROTKB|Q5LKS3 | 765 | Q5LKS3 "S1 RNA binding domain | 0.143 | 0.128 | 0.434 | 1.1e-12 | |
| TIGR_CMR|SPO_A0306 | 765 | SPO_A0306 "S1 RNA binding doma | 0.143 | 0.128 | 0.434 | 1.1e-12 | |
| UNIPROTKB|Q71X59 | 117 | LMOf2365_2340 "S1 RNA binding | 0.132 | 0.769 | 0.377 | 1.1e-12 | |
| TIGR_CMR|CPS_4965 | 796 | CPS_4965 "putative transcripti | 0.168 | 0.144 | 0.376 | 1.5e-12 | |
| TIGR_CMR|CBU_0528 | 551 | CBU_0528 "ribosomal protein S1 | 0.139 | 0.172 | 0.326 | 6.8e-12 | |
| UNIPROTKB|Q724J5 | 142 | LMOf2365_0229 "RNA-binding pro | 0.185 | 0.887 | 0.315 | 4.5e-11 | |
| UNIPROTKB|Q8E8N3 | 784 | tex "Transcriptional accessory | 0.187 | 0.163 | 0.340 | 4.9e-11 | |
| TIGR_CMR|SO_4629 | 784 | SO_4629 "conserved hypothetica | 0.187 | 0.163 | 0.340 | 4.9e-11 | |
| UNIPROTKB|Q60A39 | 735 | MCA1032 "S1 RNA binding domain | 0.170 | 0.157 | 0.358 | 7.3e-11 |
| TAIR|locus:2119946 emb2726 "embryo defective 2726" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 947 (338.4 bits), Expect = 6.0e-99, Sum P(2) = 6.0e-99
Identities = 231/544 (42%), Positives = 314/544 (57%)
Query: 1 MTPVIPCXXXXXXXXPVTAFTIKKNNCLTRYNSTRKSTKQTISS-QRFLLPLPSSVRFFS 59
M + P P +FT+KK++C + + +RK+ KQ +SS QR +LPL +S+R F
Sbjct: 1 MATITPSSISNAWLIPGASFTVKKSDCSIKCSFSRKAGKQILSSTQRLVLPLSTSLRLFP 60
Query: 60 QFQSGSALQ-HKSALHIISATGINVAVEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 118
L H+ A + T + AVEE
Sbjct: 61 THGRQFVLHPHRRA----TGTDVVAAVEEQDSTPVVAEDKETVASEKSDAPA-------- 108
Query: 119 XXPTLAESRRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVS 178
PT +R RKSEMP VKNE+L+PGATFTGKVR+IQPFGAF+DFGAFTDGLVHVS
Sbjct: 109 --PTSQSRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVS 166
Query: 179 RLSDNFVKDVGSIVSVGQEVKVRLIEANAETGRISLTMRESDDISKLQQQ-KDATASGDK 237
+LSDNFVKDV S+V++GQEVKVRL+EA+ E+ RISLTMRE+DD K Q D SG K
Sbjct: 167 QLSDNFVKDVSSVVTIGQEVKVRLVEADIESKRISLTMRENDDPPKRQSGGSDKPRSGGK 226
Query: 238 VRTTRRSTSKPGQKRDEMKTTKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESD 297
R + GQ++ E +KF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+EE+D
Sbjct: 227 ----RDGSKGGGQRKGEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEAD 282
Query: 298 DGFANMM-GGSSLQVGQEVSVRVLRISRGQVTLTMKKEDDVGSNLQLTQGVIHAATNPFV 356
DG +MM GGSSLQ GQEV VRVLRI+RG+VTLTMK+EDD + TQGV+H ATNPF+
Sbjct: 283 DGIGSMMMGGSSLQAGQEVKVRVLRIARGRVTLTMKEEDDGKFDETTTQGVVHTATNPFM 342
Query: 357 LAFRSNKDISSFLDERDKSATAAKKSEKPTPIEIGGEVS----QMEAGSSIP-KVQDQPT 411
LAFR N++I++FLD+R++ A +K TP+E E S ++E +P +V +
Sbjct: 343 LAFRKNEEIAAFLDKREEEA---EKPPVETPVEPEAEASVTSAEVEESVCVPAEVTSEEV 399
Query: 412 SSDDGMASVPSAVGETVEDHEAPSKEKGE--LADIANRND--DPQNVMSGSSETLDGALQ 467
S + V V T + ++P KE+ LA A + P E ++ ++
Sbjct: 400 PSSETPKVVEEEVIATKAEDDSPEKEEQTETLAAAAEAEEVVPPIPETKSEEEIVENSIP 459
Query: 468 TIEKETEETTLNQTI--EETPSTDVSGELAEQALSTDGPKAGEFTESQTEDTIAKDEVQI 525
T+E + + + EE V E + T P E + ++ +T + ++
Sbjct: 460 P-NSATDEVSSPEALASEEVEKEQVVAETPVDEVKTPAPVVTEASSEESGNTATAESIKG 518
Query: 526 LTPA 529
++PA
Sbjct: 519 ISPA 522
|
|
| UNIPROTKB|Q5LKS3 Q5LKS3 "S1 RNA binding domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0306 SPO_A0306 "S1 RNA binding domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q71X59 LMOf2365_2340 "S1 RNA binding domain protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4965 CPS_4965 "putative transcription accessory protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0528 CBU_0528 "ribosomal protein S1" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q724J5 LMOf2365_0229 "RNA-binding protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E8N3 tex "Transcriptional accessory protein Tex" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4629 SO_4629 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60A39 MCA1032 "S1 RNA binding domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00016702001 | SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (553 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 681 | |||
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-28 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 4e-24 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 1e-19 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 1e-19 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-19 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 6e-19 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 7e-19 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 9e-19 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-18 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 9e-18 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-17 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 1e-17 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 3e-17 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 4e-17 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 6e-17 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 8e-17 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 9e-17 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 5e-16 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 9e-16 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 9e-16 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 2e-15 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 3e-15 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 5e-15 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 6e-15 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 1e-14 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-14 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 1e-13 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 3e-13 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 8e-13 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 1e-12 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 5e-12 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 5e-12 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 2e-11 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 4e-11 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 6e-11 | |
| PRK08563 | 187 | PRK08563, PRK08563, DNA-directed RNA polymerase su | 6e-11 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 8e-11 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 1e-10 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 2e-10 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 3e-10 | |
| cd04460 | 99 | cd04460, S1_RpoE, S1_RpoE: RpoE, S1-like RNA-bindi | 3e-09 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 3e-08 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 4e-08 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 6e-08 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 7e-08 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 8e-08 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 1e-07 | |
| TIGR02063 | 709 | TIGR02063, RNase_R, ribonuclease R | 1e-07 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-07 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 2e-07 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 2e-07 | |
| COG0557 | 706 | COG0557, VacB, Exoribonuclease R [Transcription] | 2e-07 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 2e-07 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 3e-07 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 4e-07 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 5e-07 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-06 | |
| PLN00207 | 891 | PLN00207, PLN00207, polyribonucleotide nucleotidyl | 2e-06 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 2e-06 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-06 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 3e-06 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 3e-06 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 7e-06 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 7e-06 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 1e-05 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 1e-05 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 1e-05 | |
| cd04473 | 77 | cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain | 1e-05 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 2e-05 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 2e-05 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 3e-05 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 3e-05 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 5e-05 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 5e-05 | |
| COG2996 | 287 | COG2996, COG2996, Predicted RNA-bindining protein | 8e-05 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 8e-05 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 1e-04 | |
| cd05687 | 70 | cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec | 1e-04 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 2e-04 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 3e-04 | |
| COG1095 | 183 | COG1095, RPB7, DNA-directed RNA polymerase, subuni | 3e-04 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 6e-04 | |
| TIGR02696 | 719 | TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy | 6e-04 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 0.001 | |
| TIGR00448 | 179 | TIGR00448, rpoE, DNA-directed RNA polymerase (rpoE | 0.001 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 0.002 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 0.002 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 0.002 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 0.003 | |
| TIGR00358 | 654 | TIGR00358, 3_prime_RNase, VacB and RNase II family | 0.003 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 0.004 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 0.004 |
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 119 bits (300), Expect = 3e-28
Identities = 65/209 (31%), Positives = 95/209 (45%), Gaps = 34/209 (16%)
Query: 127 RRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRLSDNFVK 186
R +SE L G G V++I +GAF+D G DGL+H+S +S V
Sbjct: 172 RAVLEEERSEQREELLNKLEVGEVVEGVVKNITDYGAFVDIGGV-DGLLHISEISWKRVD 230
Query: 187 DVGSIVSVGQEVKVRLIEANAETGRISLTMRESDDISKLQQQKDATASGDKVRTTRRSTS 246
+V VG EVKV++I + E GR+SL++++
Sbjct: 231 HPSEVVKVGDEVKVKVISLDEERGRVSLSLKQ-------------------------LEE 265
Query: 247 KPGQKRDEMKTTKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESDDGFANMMGG 306
P E K+ G +EG V NLT GAF+ + EG EG + SE S
Sbjct: 266 DPW----EGIEKKYPVGDKVEGKVTNLTDYGAFVEIEEGVEGLVHVSEISWTKKNVP--S 319
Query: 307 SSLQVGQEVSVRVLRI--SRGQVTLTMKK 333
++VGQEV V+VL I R +++L +K+
Sbjct: 320 EVVKVGQEVEVKVLDIDPERRRISLGLKQ 348
|
Length = 541 |
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >gnl|CDD|236289 PRK08563, PRK08563, DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239907 cd04460, S1_RpoE, S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233703 TIGR02063, RNase_R, ribonuclease R | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223631 COG0557, VacB, Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215104 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239919 cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225543 COG2996, COG2996, Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240192 cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224020 COG1095, RPB7, DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|129540 TIGR00448, rpoE, DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232937 TIGR00358, 3_prime_RNase, VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 681 | |||
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 99.97 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.97 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 99.97 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.96 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.69 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 99.69 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 99.62 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.56 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.52 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.5 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.45 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.44 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.43 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.4 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.39 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.38 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.36 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.36 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.35 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.35 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.34 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.34 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.34 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.34 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.32 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.32 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.31 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.31 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.3 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.29 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.29 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.29 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.28 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.27 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.26 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 99.25 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.23 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.23 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.23 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.21 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 99.2 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 99.2 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 99.2 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 99.2 | |
| PRK08059 | 123 | general stress protein 13; Validated | 99.19 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.19 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.18 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.17 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 99.17 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.17 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.16 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.15 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 99.15 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.15 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 99.15 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.14 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 99.13 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 99.13 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.12 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.12 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 99.11 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.11 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 99.11 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.11 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 99.11 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 99.11 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 99.1 | |
| PRK08059 | 123 | general stress protein 13; Validated | 99.1 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.1 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 99.09 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.09 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 99.07 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 99.07 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 99.06 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 99.03 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 99.02 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 98.99 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.98 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.97 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.97 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.96 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.95 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.95 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.93 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.93 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.91 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.9 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.88 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.88 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.88 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.87 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.86 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.85 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.84 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.84 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.84 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.82 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.81 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.81 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.79 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.79 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.76 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.76 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.75 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.66 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.66 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.63 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 98.63 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.62 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.61 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 98.61 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.61 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.6 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.57 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.54 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.53 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.52 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.5 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.47 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 98.45 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.43 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.4 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 98.38 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.31 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 98.2 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 98.2 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.16 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 98.14 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 98.1 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 98.06 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 98.05 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 98.05 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 98.05 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 98.04 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 98.01 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.99 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.91 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.87 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.83 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 97.78 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 97.74 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 97.65 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 97.52 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 97.48 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 97.36 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.33 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 97.32 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 97.32 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 97.23 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 97.18 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.18 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 97.15 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 97.11 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 97.1 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 97.04 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.99 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 96.94 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 96.85 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 96.5 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 96.47 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.43 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 96.43 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 96.3 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 96.3 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 96.21 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.14 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 96.01 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 95.96 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 95.8 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.72 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 95.7 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 95.58 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 95.17 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 94.93 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 94.89 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 94.66 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 93.57 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 93.4 | |
| COG1530 | 487 | CafA Ribonucleases G and E [Translation, ribosomal | 91.41 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 91.14 | |
| COG1530 | 487 | CafA Ribonucleases G and E [Translation, ribosomal | 90.56 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 89.16 | |
| PRK12442 | 87 | translation initiation factor IF-1; Reviewed | 88.9 | |
| TIGR00008 | 68 | infA translation initiation factor IF-1. This fami | 88.49 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 86.95 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 86.9 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 84.45 | |
| PF00313 | 66 | CSD: 'Cold-shock' DNA-binding domain; InterPro: IP | 83.88 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 83.27 | |
| cd05700 | 65 | S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a t | 81.88 | |
| cd04458 | 65 | CSP_CDS Cold-Shock Protein (CSP) contains an S1-li | 81.17 |
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-47 Score=420.91 Aligned_cols=274 Identities=26% Similarity=0.359 Sum_probs=244.7
Q ss_pred ceeEEeccCCceeEEeCcccCcccccccchhhcccceeEEEEEecCCCCCCCCcceecCCCCCcccccccccccCCChhh
Q 005707 44 SQRFLLPLPSSVRFFSQFQSGSALQHKSALHIISATGINVAVEESDSPAADDDSAGASDIPSDVETSESSSIKSEASPTL 123 (681)
Q Consensus 44 ~~~l~~dl~glrGfIP~sq~~~~~~~~~~~~~lvG~~i~VkVievD~~~~~~~~lvlSer~s~v~~ae~ss~~sea~~da 123 (681)
..|+++|++|+|||+|+|+++.. +-.++..|+|+++.++|+++|++++ ++++|+| +.-++
T Consensus 118 KGG~~Vdi~gvr~FlP~S~v~~r--~v~d~~~~~Gk~~~~kiie~d~~~n---~vv~SrR---------------~~~e~ 177 (541)
T COG0539 118 KGGLTVDIEGVRAFLPGSLVDVR--PVRDLDPLIGKELEFKILELDKKRN---NVVLSRR---------------AVLEE 177 (541)
T ss_pred cCcEEEEECCEEEeccHHHhccc--ccccccccCCceEEEEEEEEccccC---cEEEEhH---------------HHhhH
Confidence 47899999999999999999976 2234667899999999999999999 9999998 11111
Q ss_pred HHhhhchhhhhcCCCCCCcCCCCCCcEEEEEEEEEecCeeEEEECCCeEEEEeccccCCccccCcccccccCCEEEEEEE
Q 005707 124 AESRRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRLSDNFVKDVGSIVSVGQEVKVRLI 203 (681)
Q Consensus 124 ek~~~kr~~rk~e~~~lt~~~LkvGdIVeGkV~sV~d~GaFVdLgggV~GLVPiSELS~~~v~d~~e~fkVGd~VkVkVl 203 (681)
++ .+.+.. .+..|++|+++.|+|+++++||+||+|+| ++||||+++|+|.++.+|.+.|++||.|+|+|+
T Consensus 178 ~~----~~~r~e-----~~~~l~~G~vV~G~V~~It~~GafVdigG-vdGLlHiseiS~~rv~~P~~vvkvGd~VkvkVi 247 (541)
T COG0539 178 ER----SEQREE-----LLNKLEVGEVVEGVVKNITDYGAFVDIGG-VDGLLHISEISWKRVDHPSEVVKVGDEVKVKVI 247 (541)
T ss_pred HH----HHHHHH-----HHhcCCCCceEEEEEEEeecCcEEEEecC-eeeEEehhhccccccCCHHHhcccCCEEEEEEE
Confidence 11 111112 26789999999999999999999999999 999999999999999999999999999999999
Q ss_pred EEeccCCceEEEEeccchhhHhhhhccccccCCccccccccCCCCCCccccccccCCccCcEEEEEEEEEecceEEEEeC
Q 005707 204 EANAETGRISLTMRESDDISKLQQQKDATASGDKVRTTRRSTSKPGQKRDEMKTTKFVKGQDLEGTVKNLTRSGAFISLP 283 (681)
Q Consensus 204 ~VD~ekgrI~LSlK~l~~dp~ek~~~~~p~s~d~~~~k~r~~~k~~~~k~~~~~sklkvGdIV~G~VknVt~~GaFVeIg 283 (681)
++|.+++||.||+|++.++||. ....+|++|+.+.|+|+++++|||||++.
T Consensus 248 ~~D~e~~RVsLSlK~l~~dPw~-----------------------------~i~~~~~~g~~v~G~Vt~i~~~GafVei~ 298 (541)
T COG0539 248 SLDEERGRVSLSLKQLEEDPWE-----------------------------GIEKKYPVGDKVEGKVTNLTDYGAFVEIE 298 (541)
T ss_pred EEccCCCeEEEEehhcccCcHH-----------------------------HHhhhcCCCCEEEEEEEEeecCcEEEEec
Confidence 9999999999999999999994 56788999999999999999999999999
Q ss_pred CCeEEEEeCCCCCcccccccCCCCcccCCCEEEEEEEEEe--CCeEEEEEeccCCCcCCc--------ceeeeEEEEeec
Q 005707 284 EGEEGFLPTSEESDDGFANMMGGSSLQVGQEVSVRVLRIS--RGQVTLTMKKEDDVGSNL--------QLTQGVIHAATN 353 (681)
Q Consensus 284 ~GIeGLLpiSELSd~~ie~~~p~~~fkVGqkVkVrVL~ID--kgKI~LSLK~~~~DP~e~--------~lv~G~V~~~i~ 353 (681)
+|++||+|.||++|.+... |.+.+++||.|.|+||.|| ++||.|+||+...|||.. ..+.|.|. +++
T Consensus 299 ~GvEGlvhvSEisw~~~~~--P~evv~~Gq~V~V~Vl~id~e~rRIsL~iKq~~~~pw~~~~~~~~~g~~v~g~v~-~~t 375 (541)
T COG0539 299 EGVEGLVHVSEISWTKKNV--PSEVVKVGQEVEVKVLDIDPERRRISLGLKQLKENPWEEFADKHPVGDVVEGKVK-SIT 375 (541)
T ss_pred CCccceeechhhcccccCC--HHHhcccCCEEEEEEEeeCchhceEEeeehhhhcChhhhhhhhcCCCCeEEEEEe-eec
Confidence 9999999999999998643 8999999999999999997 699999999999999882 34688888 899
Q ss_pred ccEEEEEEcCCeEEEeeCCccccccc
Q 005707 354 PFVLAFRSNKDISSFLDERDKSATAA 379 (681)
Q Consensus 354 ~fGlfV~l~~gI~GfIp~~els~~~~ 379 (681)
+||+|+.+.+|+.||+|.++++|...
T Consensus 376 ~~g~fv~le~gidG~vh~~d~sw~~~ 401 (541)
T COG0539 376 DFGAFVELEGGIDGLVHLSDLSWDRP 401 (541)
T ss_pred ccceEEccCCCccceEEHHhcCcccc
Confidence 99999999999999999999998644
|
|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >COG1530 CafA Ribonucleases G and E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >COG1530 CafA Ribonucleases G and E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK12442 translation initiation factor IF-1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00008 infA translation initiation factor IF-1 | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05700 S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 681 | ||||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 4e-14 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 5e-14 | ||
| 2k4k_A | 130 | Solution Structure Of Gsp13 From Bacillus Subtilis | 4e-13 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 8e-10 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 3e-04 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 7e-09 | ||
| 4aim_A | 726 | Crystal Structure Of C. Crescentus Pnpase Bound To | 9e-07 | ||
| 4aid_A | 726 | Crystal Structure Of C. Crescentus Pnpase Bound To | 9e-07 | ||
| 4am3_A | 717 | Crystal Structure Of C. Crescentus Pnpase Bound To | 9e-07 | ||
| 1q8k_A | 308 | Solution Structure Of Alpha Subunit Of Human Eif2 L | 5e-05 | ||
| 2eqs_A | 103 | Solution Structure Of The S1 Rna Binding Domain Of | 8e-05 | ||
| 3aev_A | 275 | Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex | 3e-04 | ||
| 1yz6_A | 274 | Crystal Structure Of Intact Alpha Subunit Of Aif2 F | 7e-04 | ||
| 1go3_E | 187 | Structure Of An Archeal Homolog Of The Eukaryotic R | 9e-04 |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
|
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|2K4K|A Chain A, Solution Structure Of Gsp13 From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
| >pdb|4AIM|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 | Back alignment and structure |
| >pdb|4AID|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 | Back alignment and structure |
| >pdb|4AM3|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rna Length = 717 | Back alignment and structure |
| >pdb|1Q8K|A Chain A, Solution Structure Of Alpha Subunit Of Human Eif2 Length = 308 | Back alignment and structure |
| >pdb|2EQS|A Chain A, Solution Structure Of The S1 Rna Binding Domain Of Human Atp-Dependent Rna Helicase Dhx8 Length = 103 | Back alignment and structure |
| >pdb|3AEV|A Chain A, Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex From Pyrococcus Horikoshii Ot3 Length = 275 | Back alignment and structure |
| >pdb|1YZ6|A Chain A, Crystal Structure Of Intact Alpha Subunit Of Aif2 From Pyrococcus Abyssi Length = 274 | Back alignment and structure |
| >pdb|1GO3|E Chain E, Structure Of An Archeal Homolog Of The Eukaryotic Rna Polymerase Ii Rpb4RPB7 COMPLEX Length = 187 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 681 | |||
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 1e-27 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 1e-09 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 9e-26 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 6e-07 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 3e-21 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 9e-10 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 2e-20 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 6e-06 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 6e-19 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-09 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 9e-19 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 2e-09 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 4e-18 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 3e-05 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 5e-18 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 9e-06 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 1e-17 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 1e-04 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 1e-16 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 1e-08 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 4e-16 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 3e-05 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 6e-15 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 3e-06 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 8e-15 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 1e-08 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 1e-14 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 1e-08 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 2e-14 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 2e-06 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 8e-13 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 5e-07 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 1e-12 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 3e-07 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 8e-11 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 1e-05 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 2e-09 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 2e-09 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 5e-08 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 4e-07 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 8e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 1e-05 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 2e-04 |
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
Score = 107 bits (269), Expect = 1e-27
Identities = 37/155 (23%), Positives = 66/155 (42%), Gaps = 31/155 (20%)
Query: 143 EDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRLSDNFVKDVGSIVSVGQEVKVRL 202
G+ +TGKV +Q +GAF+ T GLVH+S ++ FVKD+ +SVG EV+V++
Sbjct: 3 AKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKV 62
Query: 203 IEANAETGRISLTMRESDDISKLQQQKDATASGDKVRTTRRSTSKPGQKRDEMKTTKFVK 262
+ + E G+ISL++R + + ++ K +
Sbjct: 63 LAVDEEKGKISLSIRATQAAPEKKESKP-------------------------------R 91
Query: 263 GQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESD 297
+ + F +L + E ++ S D
Sbjct: 92 KPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKD 126
|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 172 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Length = 187 | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 Length = 172 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Length = 644 | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A Length = 469 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 681 | |||
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.95 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.92 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.76 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.61 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.61 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.59 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.57 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.5 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 99.5 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.49 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.49 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.49 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.48 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.46 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.45 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.45 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.44 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.43 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.42 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.4 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.4 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 99.39 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.34 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 99.26 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 99.21 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.2 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 99.18 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 99.13 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 99.12 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 99.07 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 99.05 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 99.03 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 99.01 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 99.01 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.99 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 98.99 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 98.97 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 98.95 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 98.95 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 98.94 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.89 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 98.88 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 98.88 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.83 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.83 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 98.82 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 98.82 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 98.81 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 98.8 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 98.79 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 98.79 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 98.77 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.77 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 98.77 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 98.71 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.69 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 98.67 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 98.67 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.64 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 98.63 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.6 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.6 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 98.59 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 98.56 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.56 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.51 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.37 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 98.34 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 98.19 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 98.12 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 98.1 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 98.04 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 98.04 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 97.96 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 97.86 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 97.8 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 97.78 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.75 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 97.71 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 97.71 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 97.66 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 97.58 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 97.54 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 97.5 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.46 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 97.39 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 97.3 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 96.34 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 94.97 | |
| 2rf4_A | 214 | DNA-directed RNA polymerase I subunit RPA4; transf | 91.89 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 87.51 | |
| 3d0f_A | 106 | Penicillin-binding 1 transmembrane protein MRCA; B | 87.41 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 85.87 | |
| 3d0f_A | 106 | Penicillin-binding 1 transmembrane protein MRCA; B | 84.15 | |
| 2rf4_A | 214 | DNA-directed RNA polymerase I subunit RPA4; transf | 83.17 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 82.52 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 81.26 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 80.61 |
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
Probab=99.95 E-value=1.4e-26 Score=240.63 Aligned_cols=199 Identities=16% Similarity=0.167 Sum_probs=168.8
Q ss_pred ceeEEeccCCceeEEeCcccCcccccccchhhcccceeEEEEEecCCCCCCCCcceecCCCCCcccccccccccCCChhh
Q 005707 44 SQRFLLPLPSSVRFFSQFQSGSALQHKSALHIISATGINVAVEESDSPAADDDSAGASDIPSDVETSESSSIKSEASPTL 123 (681)
Q Consensus 44 ~~~l~~dl~glrGfIP~sq~~~~~~~~~~~~~lvG~~i~VkVievD~~~~~~~~lvlSer~s~v~~ae~ss~~sea~~da 123 (681)
..+++++++|..||+|.+++.. -+|+++.|.|. .|++.+ ++++.+
T Consensus 19 ~~G~fv~~~g~egllp~se~~~----------~vGdevev~v~-~d~~~r----~iat~~-------------------- 63 (285)
T 3go5_A 19 DRFYFVQKDGQTYALAKEEGQH----------TVGDTVKGFAY-TDMKQK----LRLTTL-------------------- 63 (285)
T ss_dssp SSEEEEEETTEEEEEEGGGCCC----------CTTSEEEEEEE-ECTTSC----EEEECS--------------------
T ss_pred CCEEEEEcCCeEEEEEHHHCcc----------ccCCEEEEEEE-ECCCCC----EEEecc--------------------
Confidence 4788999999999999999842 39999999998 465544 666543
Q ss_pred HHhhhchhhhhcCCCCCCcCCCCCCcEEEEEEEEEe-cCeeEEEECC-CeEEEEeccccCCccccCcccccccCCEEEEE
Q 005707 124 AESRRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQ-PFGAFIDFGA-FTDGLVHVSRLSDNFVKDVGSIVSVGQEVKVR 201 (681)
Q Consensus 124 ek~~~kr~~rk~e~~~lt~~~LkvGdIVeGkV~sV~-d~GaFVdLgg-gV~GLVPiSELS~~~v~d~~e~fkVGd~VkVk 201 (681)
...+++|+++.|+|++++ ++|+||++|. +.+||||+++++|.+. ..+++||.+.|+
T Consensus 64 ------------------~p~~~~G~~~~g~V~~v~~~~GaFVdiG~~~~d~lvp~sel~~~~~----~~~~~Gd~v~v~ 121 (285)
T 3go5_A 64 ------------------EVTATQDQFGWGRVTEVRKDLGVFVDTGLPDKEIVVSLDILPELKE----LWPKKGDQLYIR 121 (285)
T ss_dssp ------------------CCCSCSSSCEEEEEEEEETTTEEEEECSCTTCCEEEEGGGSCSSGG----GSCCTTCEEEEE
T ss_pred ------------------cccccCCCEEEEEEEEEccCceEEEEECCCCcEEEEEHHHCCcccc----cccCCCCEEEEE
Confidence 124689999999999999 7999999997 6999999999998643 246899999766
Q ss_pred EEEEeccCCceEEEEecc-chhhHhhhhccccccCCccccccccCCCCCCccccccccCCccCcEEEEEEEEEecceEEE
Q 005707 202 LIEANAETGRISLTMRES-DDISKLQQQKDATASGDKVRTTRRSTSKPGQKRDEMKTTKFVKGQDLEGTVKNLTRSGAFI 280 (681)
Q Consensus 202 Vl~VD~ekgrI~LSlK~l-~~dp~ek~~~~~p~s~d~~~~k~r~~~k~~~~k~~~~~sklkvGdIV~G~VknVt~~GaFV 280 (681)
+.+|+ ++||.+|+|+. ..++|. ....+|++|++|.|+|++++++|+||
T Consensus 122 -l~iD~-~~Ri~ls~k~~~~~~~~~-----------------------------~~~~~~~~G~~V~g~V~~i~~~G~fV 170 (285)
T 3go5_A 122 -LEVDK-KDRIWGLLAYQEDFQRLA-----------------------------RPAYNNMQNQNWPAIVYRLKLSGTFV 170 (285)
T ss_dssp -EEECT-TSCEEEEECCHHHHHHHC-----------------------------CCCCSCCTTCEEEEEEEEEETTEEEE
T ss_pred -EEECC-CCcEEEEehhhhhcchhh-----------------------------hhhhhCCCCCEEEEEEEEEeCCcEEE
Confidence 58998 78999999976 456772 34678999999999999999999999
Q ss_pred -EeCCCeEEEEeCCCCCcccccccCCCCcccCCCEEEEEEEEEe--CCeEEEEEeccCCCcCC
Q 005707 281 -SLPEGEEGFLPTSEESDDGFANMMGGSSLQVGQEVSVRVLRIS--RGQVTLTMKKEDDVGSN 340 (681)
Q Consensus 281 -eIg~GIeGLLpiSELSd~~ie~~~p~~~fkVGqkVkVrVL~ID--kgKI~LSLK~~~~DP~e 340 (681)
.+++|++||||.+|+++ .|++||.|+|+|++|+ ++||.||||+....+++
T Consensus 171 ~~i~~g~~Glih~SEl~~----------~l~~Gd~v~~~V~~id~~d~kI~LSlk~~~~~~~~ 223 (285)
T 3go5_A 171 YLPENNMLGFIHPSERYA----------EPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE 223 (285)
T ss_dssp EETTTTEEEEECGGGCSS----------CCCTTCEEEEEEEEEETTTTEEEEECSCCCCCCCC
T ss_pred EEeCCCeEEEEEHHHccc----------cCCCCCEEEEEEEEEECCCCeEEEEeChhhhhccc
Confidence 99999999999999873 4799999999999997 59999999998766655
|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2rf4_A DNA-directed RNA polymerase I subunit RPA4; transferase DNA/RNA, DNA-binding, phosphorylation, POL I, POLI, rpoli, nuclear protein; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3d0f_A Penicillin-binding 1 transmembrane protein MRCA; BIG_1156.2, STR genomics, PSI-2, protein structure initiative; 1.64A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d0f_A Penicillin-binding 1 transmembrane protein MRCA; BIG_1156.2, STR genomics, PSI-2, protein structure initiative; 1.64A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >2rf4_A DNA-directed RNA polymerase I subunit RPA4; transferase DNA/RNA, DNA-binding, phosphorylation, POL I, POLI, rpoli, nuclear protein; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 681 | ||||
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 4e-18 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 6e-10 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 5e-18 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 3e-10 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 6e-14 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 2e-09 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 3e-13 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 2e-06 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 5e-13 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-08 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 5e-13 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 1e-09 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-12 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 2e-07 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-12 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 6e-08 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 4e-12 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 6e-08 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 6e-12 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 1e-07 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 6e-10 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 6e-04 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 1e-09 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 6e-06 | |
| d2ja9a1 | 90 | b.40.4.5 (A:62-151) S1-domain of exosome component | 2e-08 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 3e-08 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 4e-08 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 7e-05 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 5e-08 |
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase species: Escherichia coli [TaxId: 562]
Score = 76.7 bits (189), Expect = 4e-18
Identities = 30/76 (39%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
Query: 144 DLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRLSDNFVKDVGSIVSVGQEVKVRLI 203
++ G +TGKV I FGAF+ G +GLVH+S+++D V+ V + +GQEV V+++
Sbjct: 2 EIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVL 61
Query: 204 EANAETGRISLTMRES 219
E + + GRI L+++E+
Sbjct: 62 EVDRQ-GRIRLSIKEA 76
|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 681 | |||
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.62 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.6 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.58 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.55 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.55 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.55 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.49 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.45 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.43 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.42 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.42 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.4 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.38 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.34 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.33 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.32 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.3 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.27 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 99.05 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 99.0 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.97 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.93 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.93 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.86 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.78 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.73 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.63 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.51 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.45 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.32 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 98.31 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 98.23 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 98.08 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 98.07 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.84 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.83 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.66 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.45 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 97.1 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 97.06 | |
| d1c9oa_ | 66 | Major cold shock protein {Bacillus caldolyticus [T | 88.99 | |
| d1k3ra1 | 71 | Hypothetical protein MTH1 (MT0001), insert domain | 88.3 | |
| d1jjga_ | 102 | Viral structural mimic of eIF2alpha {Myxoma virus, | 88.07 | |
| d1luza_ | 85 | Viral structural mimic of eIF2alpha {Vaccinia viru | 87.85 | |
| d1k3ra1 | 71 | Hypothetical protein MTH1 (MT0001), insert domain | 87.1 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 85.11 | |
| d1jjga_ | 102 | Viral structural mimic of eIF2alpha {Myxoma virus, | 83.05 | |
| d1g6pa_ | 66 | Major cold shock protein {Thermotoga maritima [Tax | 83.05 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 80.56 | |
| d3d31a1 | 119 | Sulfate/molybdate ABC transporter, ATP-binding pro | 80.34 | |
| d1h95a_ | 79 | Y-box protein 1 cold shock domain (YB1-CSD) {Human | 80.1 |
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase species: Escherichia coli [TaxId: 562]
Probab=99.62 E-value=2e-16 Score=132.04 Aligned_cols=76 Identities=39% Similarity=0.731 Sum_probs=71.8
Q ss_pred CCCCCCcEEEEEEEEEecCeeEEEECCCeEEEEeccccCCccccCcccccccCCEEEEEEEEEeccCCceEEEEecc
Q 005707 143 EDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRLSDNFVKDVGSIVSVGQEVKVRLIEANAETGRISLTMRES 219 (681)
Q Consensus 143 ~~LkvGdIVeGkV~sV~d~GaFVdLgggV~GLVPiSELS~~~v~d~~e~fkVGd~VkVkVl~VD~ekgrI~LSlK~l 219 (681)
+++++|+++.|+|+++.+||+||+|+++++||||.++++|+++.++.+.|++||.|+|+|+++|+ ++||.||+|++
T Consensus 1 ad~kvG~iv~G~V~~v~~~G~fV~l~~~~~Glv~~sels~~~~~~~~~~~~~G~~v~v~Vi~id~-~~ri~LS~k~a 76 (76)
T d1sroa_ 1 AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDR-QGRIRLSIKEA 76 (76)
T ss_dssp CCCCTTSEEEEEEEEEETTEEEEECSSSCCCBCCTTSSCSSCCSCHHHHCCTTCEEEEEEEECCT-TCCCEEEECCC
T ss_pred CCCCCCCEEEEEEEEEeCcEEEEEeCCCCEEEEEhHHhCccccCCHHHccCCCCEEEEEEEEECC-CCCEEEEEEcC
Confidence 37899999999999999999999999889999999999999999999999999999999999996 57899999963
|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1k3ra1 b.40.4.10 (A:93-163) Hypothetical protein MTH1 (MT0001), insert domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]} | Back information, alignment and structure |
|---|
| >d1luza_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d1k3ra1 b.40.4.10 (A:93-163) Hypothetical protein MTH1 (MT0001), insert domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]} | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a1 b.40.6.3 (A:230-348) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|