Citrus Sinensis ID: 005708

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-

MHDVVRYVAQQIASKNKFMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIHATTSTSSPTPSLGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDDGGVGLQGASTEKITFPSLFIIQLCHLDSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGYGDQLTPKLLKGVLVNGEYRWTGNLNHTIQQYVYNEKKIREKEPMKSGISSETTSSDTEN

ccHHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEcccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccHHHcccccHHcccccccccEEEEEcccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccccEEcccccccccccccccccccccccEEEEccccccccccccHHHcccccEEEEEEcccccccHHHHHHHcccccccccccccccEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEEccEEEEccccHHHHHHHHHHccccccccccccccccccccccccc

ccHHHHHHHHHHHccccEEEEccccccccccccccccEEEEEEccccHHcccccccccccEEEEEcccccccccHHHHHcccccEEEEccccccccccccHHHHHcccEEEccccccccccHHHHHHHcccEEEcccccHHHccHHHHHcccccEEEcccccccccccHHHHHHHHcccEEEEccccccEEccccccccccccHHHHHccccccEEEEEccccccccccccHHHHcEEEEEcccccccccHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHcccEEEEcccccccccccHcHcccccccEEEEEccccccEEEccccccccccccccccEEEEcccHHHHHHccccccccccccccEEEEcccccHcccccHHHHHHcccccEEEEcccHHHHHHHcccccccccccccccccccEEEEccccccHHccccccccccccccEEEEEcccHHHHccccccHHccccHHccccHHHHHHHHHHHHcccccccccccccccEEEEcccccHHHccccHHHHHcHcccEEEEcccHcHHEEEcccccccccccccccccccccccEEEEcccHcHHHccccccccccccccccEEEEEccccccEcccccccccccEEEEEEcccEEccccccHHHHHccccccccccccEEEcccccccccccccc

MHDVVRYVAQQIASKNKFMIKAGvelkdwpsintfedltgislmfndihevpdelecpklqalflqensplaipdrFFQGMkdlkvldlggirgfslpsSLSFLINLRtlslhdcrrfgdlpligeLSLLEIldlsesdvseipvsfgrlghlrlldltdcvhleliPRDVLSSLRKLEELYMShsfchwqfeseedaRSNAKFIELGALSRLtslhidipkgkimpsdmsfqnlTSFSikigdleedplSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEichgqlpagclsnvkrldvgdcgsmlkilpsHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEkltlidlprmtdiwkgdTQFVSLHNLKKVRVQDCDELRQvfptnlgkkaavEEMVpyrkrrdhihihattstssptpslgnlvsITIRGCGQLRQLFTTSMVKSLVRleslevsscptlqeiimdddggvglqgastekitfpsLFIIQLCHLdslacffsagsHATIEFLALAALLIidcpsmktfgygdqltpkllkgvlvngeyrwtgnlnHTIQQYVYNekkirekepmksgissettssdten

MHDVVRYVAQQIASKNKFMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRqvfptnlgkkaaveEMVPYRKRRDHIHihattstssptpslGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDDGGVGLQGASTEKITFPSLFIIQLCHLDSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGYGDQLTPKLLKGVLVNGEYrwtgnlnhtiQQYVYNekkirekepmksgissettssdten

MHDVVRYVAQQIASKNKFMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFgdlpligelslleildlsesdVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIHAttstssptpsLGNLVSITIRGCGQLRQLFTTSMVKslvrleslevssCPTLQEIIMDDDGGVGLQGASTEKITFPSLFIIQLCHLDSLACFFSAGSHATIEFlalaallIIDCPSMKTFGYGDQLTPKLLKGVLVNGEYRWTGNLNHTIQQYVYNEKKIREKEPMKSGISSETTSSDTEN

***VVRYVAQQIASKNKFMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIH***********LGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDDGGVGLQGASTEKITFPSLFIIQLCHLDSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGYGDQLTPKLLKGVLVNGEYRWTGNLNHTIQQYVYNE************************

MHDVVRYVAQQIASKNKFMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVF************ELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIHATTSTSSPTPSLGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIM**************KITFPSLFIIQLCHLDSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGYGDQLTPKLLKGVLVNGEYRWTGNLNHTIQQYVYNEKKIREKEP****************

*HDVVRYVAQQIASKNKFMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIHATTSTSSPTPSLGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDD*********TEKITFPSLFIIQLCHLDSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGYGDQLTPKLLKGVLVNGEYRWTGNLNHTIQQYVYNEKKIREKEPMKSGI***********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		681	2.2.26 [Sep-21-2011]
Q9T048		985	Disease resistance protei	yes	no	0.449	0.310	0.323	4e-23
Q42484		909	Disease resistance protei	no	no	0.587	0.440	0.248	8e-23
O81825		919	Probable disease resistan	no	no	0.321	0.238	0.327	1e-20
Q940K0		889	Probable disease resistan	no	no	0.199	0.152	0.351	6e-15
O64973		889	Disease resistance protei	no	no	0.252	0.193	0.351	1e-14
P60839		884	Probable disease resistan	no	no	0.164	0.126	0.411	3e-12
O64789		925	Probable disease resistan	no	no	0.198	0.145	0.377	6e-12
P60838		894	Probable disease resistan	no	no	0.198	0.151	0.345	1e-11
O82484		892	Putative disease resistan	no	no	0.205	0.156	0.341	2e-11
Q8RXS5		888	Probable disease resistan	no	no	0.230	0.176	0.357	4e-11

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function desciption

 Score =  110 bits (274), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 108/334 (32%), Positives = 155/334 (46%), Gaps = 28/334 (8%)

Query: 1   MHDVVRYVAQQIASKNK----FMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELE 56
           MHDVVR  A  I S ++     ++ +G  L+D         L  +SLM N +  +PD +E
Sbjct: 462 MHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVE 521

Query: 57  --CPKLQALFLQENSPLA-IPDRFFQGMKDLKVLDLGGIRGFSLPS-SLSFLINLRTLSL 112
             C K   L LQ N  L  +P  F Q    L++L+L G R  S PS SL  L +L +L L
Sbjct: 522 EFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFL 581

Query: 113 HDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVL 172
            DC +   LP +  L+ LE+LDL  + + E P     L   R LDL+  +HLE IP  V+
Sbjct: 582 RDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVV 641

Query: 173 SSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIM--PSDM 230
           S L  LE L M+ S   W  +  E  +  A   E+G L RL  L I +     +    + 
Sbjct: 642 SRLSSLETLDMTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNT 700

Query: 231 SFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHSWIKNLLLR 290
             + L  F + +G       S +I     + +K   R + +S  + +S +   I  LL  
Sbjct: 701 WIKRLKKFQLVVG-------SRYI--LRTRHDK---RRLTISH-LNVSQVS--IGWLLAY 745

Query: 291 SEILALAEVNDLENMVSDLAND--GFNELMFLVI 322
           +  LAL     +E M+  L +D  GF  L  L I
Sbjct: 746 TTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTI 779

Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1	Back alignment and function description

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function description

>sp\|Q940K0\|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2	Back alignment and function description

>sp\|O64973\|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2	Back alignment and function description

>sp\|P60839\|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1	Back alignment and function description

>sp\|O64789\|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1	Back alignment and function description

>sp\|P60838\|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1	Back alignment and function description

>sp\|O82484\|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1	Back alignment and function description

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		681
359494129		1144	PREDICTED: disease resistance protein At	0.939	0.559	0.328	1e-78
224111296		1315	cc-nbs-lrr resistance protein [Populus t	0.878	0.454	0.330	9e-78
224111284		1340	cc-nbs-lrr resistance protein [Populus t	0.867	0.441	0.328	4e-71
224143316		1337	cc-nbs-lrr resistance protein [Populus t	0.875	0.445	0.337	2e-70
297735461		1063	unnamed protein product [Vitis vinifera]	0.798	0.511	0.343	2e-69
359488103		1530	PREDICTED: disease resistance protein At	0.806	0.358	0.317	1e-68
147832986		975	hypothetical protein VITISV_010740 [Viti	0.798	0.557	0.342	1e-68
225445915		1063	PREDICTED: disease resistance protein At	0.797	0.510	0.345	4e-68
359488025		1781	PREDICTED: uncharacterized protein LOC10	0.804	0.307	0.322	2e-67
359488095		1347	PREDICTED: probable disease resistance p	0.800	0.404	0.32	9e-67

>gi\|359494129\|ref\|XP_002278428.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  300 bits (769), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 226/687 (32%), Positives = 346/687 (50%), Gaps = 47/687 (6%)

Query: 1    MHDVVRYVAQQIASKNK--FMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELECP 58
            MHD+VR  A  I S  K  FM+KAGV LK+WP   TFE    ISLM N+I  +P  LECP
Sbjct: 467  MHDLVRVFAISITSTEKYAFMVKAGVGLKNWPKKGTFEHYALISLMANNISSLPVGLECP 526

Query: 59   KLQALFLQENSPLAI-PDRFFQGMKDLKVLDLGGIRG---------FSLPSSLSFLINLR 108
            KL  L L  N  L I PD FF GMK LKVLDL  I             LP+SL  L +LR
Sbjct: 527  KLHTLLLGGNRGLKIFPDAFFVGMKTLKVLDLTAISKKLYRYSLHITPLPASLQLLTDLR 586

Query: 109  TLSLHDCRRFGDLPLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIP 168
             L LH  R+ GD+ ++G+L  LEIL    S +SE+P   G L +L+LLDLT C  L+ IP
Sbjct: 587  MLHLHH-RKLGDISILGKLKKLEILSFFASHISELPKEMGELKNLKLLDLTYCRSLKKIP 645

Query: 169  RDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPS 228
             +++S L  LEELYM  SF  W        RS+A   EL +L  LT+LH++I   K +P+
Sbjct: 646  PNLISGLSALEELYMRGSFQQWDVGGTTIERSSASLSELNSLLNLTTLHVEIINAKCIPN 705

Query: 229  DMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALHS----WI 284
               F N   F I IG           +L    F ++       S+ + +  + S     +
Sbjct: 706  SFLFPNQLRFQIYIGS----------KLSFATFTRKLKYDYPTSKALELKGIDSPIPIGV 755

Query: 285  KNLLLRSEILALAEV-NDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTL 343
            K L  R+E L+L  +     N++ +L + GFN L  L +  C E +C++++ +    V  
Sbjct: 756  KMLFERTEDLSLISLLEGSRNILPNLGSRGFNGLTSLSVRNCVEFECIIDTTQGVHPVAF 815

Query: 344  HKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLR 403
              +E + +     +  +  G LP G    ++ L V  CG +  + P+ L+Q  QNL+ ++
Sbjct: 816  PNIETIHLTHLCGMKVLSSGTLPMGSFRKLRVLTVEQCGGLSTLFPADLLQLLQNLEIVQ 875

Query: 404  VGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVR 463
            +  C+ ++ VF+IE + + +E     SSL +L L  LP++  +WKG    +SLHNL+ + 
Sbjct: 876  ITCCQEMQDVFQIEGILVGEEHVLPLSSLRELKLDTLPQLEHLWKGFGAHLSLHNLEVIE 935

Query: 464  VQDCDELRQVFPTNLGKKAAVEEMVPYRK--------RRDHIHIHATTSTSSPTPSLGNL 515
            ++ C+ LR +F  ++ +     E +              D +    +      + +L  L
Sbjct: 936  IERCNRLRNLFQPSIAQSLFKLEYLKIVDCMELQQIIAEDGLEQEVSNVEDKKSLNLPKL 995

Query: 516  VSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDDGGVGLQGASTEKITF 575
              + +  C +L+ LF+ S  +S ++L+ L+VS    L+ II  + G +    A+ +K   
Sbjct: 996  KVLEVEDCKKLKSLFSVSSAQSFLQLKQLKVSGSNELKAIISCECGEI---SAAVDKFVL 1052

Query: 576  PSLFIIQLCHLDSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGY----GDQLTPKLL 631
            P L  ++L  L  L  F     +   E+ +L  +++  CP M TF      G Q  PK L
Sbjct: 1053 PQLSNLELKALPVLESFCKG--NFPFEWPSLEEVVVDTCPRMTTFALAAADGVQNMPK-L 1109

Query: 632  KGVLVNGEYRWTGNLNHTIQQYVYNEK 658
            K + V+G+     +LN  I +++Y  K
Sbjct: 1110 KSLQVDGQMINNHDLNMAI-KHLYKGK 1135

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224111296\|ref\|XP_002332952.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834264\|gb\|EEE72741.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224111284\|ref\|XP_002332949.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834261\|gb\|EEE72738.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224143316\|ref\|XP_002336027.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222838884\|gb\|EEE77235.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297735461\|emb\|CBI17901.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488103\|ref\|XP_002263579.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147832986\|emb\|CAN77367.1\| hypothetical protein VITISV_010740 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225445915\|ref\|XP_002263288.1\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488025\|ref\|XP_003633688.1\| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488095\|ref\|XP_002270726.2\| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		681
TAIR\|locus:2136447		985	AT4G27190 [Arabidopsis thalian	0.649	0.448	0.269	1.5e-20
TAIR\|locus:2131689		919	AT4G27220 [Arabidopsis thalian	0.674	0.499	0.255	3.7e-20
TAIR\|locus:2005517		909	RPS2 "RESISTANT TO P. SYRINGAE	0.164	0.123	0.364	1.1e-18
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.261	0.200	0.329	1.3e-15
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.164	0.124	0.415	3.7e-14
TAIR\|locus:2034765		884	AT1G12290 [Arabidopsis thalian	0.164	0.126	0.403	3.8e-14
TAIR\|locus:2031366		898	AT1G63350 "AT1G63350" [Arabido	0.164	0.124	0.364	4.7e-13
TAIR\|locus:2034770		894	SUMM2 "AT1G12280" [Arabidopsis	0.164	0.125	0.403	1.5e-12
TAIR\|locus:2008510		967	AT1G61190 "AT1G61190" [Arabido	0.164	0.115	0.372	2.6e-12
TAIR\|locus:2197739		762	AT1G61300 [Arabidopsis thalian	0.259	0.232	0.333	3.6e-12

TAIR\|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 277 (102.6 bits), Expect = 1.5e-20, P = 1.5e-20
 Identities = 133/494 (26%), Positives = 209/494 (42%)

Query:     1 MHDVVRYVAQQIASKNK----FMIKAGVELKDWPSINTFEDLTGISLMFNDIHEVPDELE 56
             MHDVVR  A  I S ++     ++ +G  L+D         L  +SLM N +  +PD +E
Sbjct:   462 MHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVE 521

Query:    57 --CPKLQALFLQENSPLA-IPDRFFQGMKDLKVLDLGGIRGFSLPS-SLSFLINLRTLSL 112
               C K   L LQ N  L  +P  F Q    L++L+L G R  S PS SL  L +L +L L
Sbjct:   522 EFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFL 581

Query:   113 HDCRRFXXXXXXXXXXXXXXXXXXXXXVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVL 172
              DC +                      + E P     L   R LDL+  +HLE IP  V+
Sbjct:   582 RDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVV 641

Query:   173 SSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGKIMPSDMS- 231
             S L  LE L M+ S   W  + E   +  A   E+G L RL  L I +     + +  + 
Sbjct:   642 SRLSSLETLDMTSSHYRWSVQGETQ-KGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNT 700

Query:   232 -FQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMRISALH-SWIKNLLL 289
               + L  F + +G       S +I     + +KR    + +S  + +S +   W   LL 
Sbjct:   701 WIKRLKKFQLVVG-------SRYI--LRTRHDKR---RLTISH-LNVSQVSIGW---LLA 744

Query:   290 RSEILALAEVNDLENMVSDLAND--GFNELMFL----VIVRCNEMKCLV--NSLERTRRV 341
              +  LAL     +E M+  L +D  GF  L  L    VI+  N    +V  N+ +++  +
Sbjct:   745 YTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDI 804

Query:   342 T--LHKLEWLAIFLNQNLVEICHGQLPAGC-LSNVKRLDVGDCGSMLKILPSHLVQSFQN 398
                L  LE L +    +L      Q   G  L  +K +++  C  +  +L      +  N
Sbjct:   805 LDLLPNLEELHL-RRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPN 863

Query:   399 LQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDI--WKGDTQFVSL 456
             L+ + +  C+ L+++ E    +          +L  L L +LP +  I  W G+      
Sbjct:   864 LEEIEISYCDSLQNLHEALLYH-----QPFVPNLRVLKLRNLPNLVSICNW-GEVW---- 913

Query:   457 HNLKKVRVQDCDEL 470
               L++V V  C++L
Sbjct:   914 ECLEQVEVIHCNQL 927

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00027341001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (963 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		681
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	4e-06
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	2e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-05
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	7e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.002
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.003

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

 Score = 49.8 bits (119), Expect = 4e-06
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 3/76 (3%)

Query: 87  LDLGGIRGFSLPSSLSFLINLRTLSLHDCRRFGDLPL-IGELSLLEILDLSESDVS-EIP 144
           LD  G+RGF +P+ +S L +L++++L      G++P  +G ++ LE+LDLS +  +  IP
Sbjct: 425 LDNQGLRGF-IPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIP 483

Query: 145 VSFGRLGHLRLLDLTD 160
            S G+L  LR+L+L  
Sbjct: 484 ESLGQLTSLRILNLNG 499

Length = 623

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		681
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.96
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.92
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.91
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.89
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.89
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.88
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.88
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.85
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.7
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.69
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.55
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.53
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.51
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.48
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.46
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.46
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.4
KOG4341		483	consensus F-box protein containing LRR [General fu	99.4
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.22
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.21
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.2
KOG4341		483	consensus F-box protein containing LRR [General fu	99.16
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.12
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.09
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.05
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.97
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.95
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.94
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.91
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.8
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.66
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.53
PLN03150		623	hypothetical protein; Provisional	98.47
PLN03150		623	hypothetical protein; Provisional	98.46
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.43
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.42
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.36
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.35
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.31
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.27
PRK15386		426	type III secretion protein GogB; Provisional	98.27
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.26
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.23
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.18
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.09
PRK15386		426	type III secretion protein GogB; Provisional	98.06
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.05
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.92
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.91
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.88
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.85
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.85
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.85
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.73
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.73
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.67
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.67
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.97
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.97
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.66
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.64
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.56
KOG3864		221	consensus Uncharacterized conserved protein [Funct	96.4
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.38
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.37
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.9
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.9
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.14
KOG3864		221	consensus Uncharacterized conserved protein [Funct	94.87
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.71
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.28
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	90.92
smart00370		26	LRR Leucine-rich repeats, outliers.	90.92
KOG0473		326	consensus Leucine-rich repeat protein [Function un	90.82
KOG0473		326	consensus Leucine-rich repeat protein [Function un	89.82
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.72
smart00370		26	LRR Leucine-rich repeats, outliers.	89.72
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	86.21

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=3.6e-35  Score=344.79  Aligned_cols=514  Identities=19%  Similarity=0.187  Sum_probs=318.2

Q ss_pred             CCCccEEEccCCCCccC-CCCC-CCCCCcEEEccCCCCC-CCChHHHhCCCCccEEEecCCCC-CCCCccccCCCCCcEE
Q 005708           35 FEDLTGISLMFNDIHEV-PDEL-ECPKLQALFLQENSPL-AIPDRFFQGMKDLKVLDLGGIRG-FSLPSSLSFLINLRTL  110 (681)
Q Consensus        35 l~~lr~L~l~~~~~~~l-~~~~-~~~~Lr~L~l~~~~~~-~l~~~~~~~l~~Lr~L~L~~~~~-~~lp~~i~~l~~L~~L  110 (681)
                      ..+++.|+++++.+... +... .+++|++|++++|.+. .+|.++|..+++||+|++++|.+ +.+|.  +.+++|++|
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L  145 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETL  145 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEE
Confidence            35788899988887643 3333 7889999999998887 78888877889999999998888 45554  567888899


Q ss_pred             EccCCCCCCCCc-ccCCCCCccEEEcccCCCc-ccchhhcCCccCcEEeccCCCCCCccChhhhcCCCCCcEEEcccCcc
Q 005708          111 SLHDCRRFGDLP-LIGELSLLEILDLSESDVS-EIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHSFC  188 (681)
Q Consensus       111 ~L~~~~~~~~l~-~l~~L~~L~~L~l~~~~i~-~lp~~i~~l~~L~~L~L~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~  188 (681)
                      ++++|.....+| .++++++|++|++++|.+. .+|..++++++|++|++++|...+.+|.. ++++++|++|++++|..
T Consensus       146 ~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l  224 (968)
T PLN00113        146 DLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNL  224 (968)
T ss_pred             ECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCcc
Confidence            998888555667 7888888999999888775 67888888888999988887777677776 78888888888888753


Q ss_pred             cccccchhhhhhccchhhhcCCCCCcEEEEeCCCCC-CCCCC-CCCCCccEEEEEecCCcCCCchhHHHHHhhhcccccc
Q 005708          189 HWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGK-IMPSD-MSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCS  266 (681)
Q Consensus       189 ~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~~~~~-~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l  266 (681)
                                 ....+..++.+++|++|++++|.+. .+|.. ..+++|+.|.+..+......+..       .....++
T Consensus       225 -----------~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~-------l~~l~~L  286 (968)
T PLN00113        225 -----------SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS-------IFSLQKL  286 (968)
T ss_pred             -----------CCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchh-------HhhccCc
Confidence                       2246667888888888888888764 44444 67788888888776543221100       1245677


Q ss_pred             ceeeeccccchhhhHHHHHHHHhccceeecccccCcccccccccccccCCCcEEEEEecCCceEeeeccccccccccCcc
Q 005708          267 RAMGLSQDMRISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLERTRRVTLHKL  346 (681)
Q Consensus       267 ~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~L  346 (681)
                      +.+++.++.-...+|.++.. +++|+.|++.++.........+.  .+++|+.|++.+|.-...++.     ....+++|
T Consensus       287 ~~L~Ls~n~l~~~~p~~~~~-l~~L~~L~l~~n~~~~~~~~~~~--~l~~L~~L~L~~n~l~~~~p~-----~l~~~~~L  358 (968)
T PLN00113        287 ISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALT--SLPRLQVLQLWSNKFSGEIPK-----NLGKHNNL  358 (968)
T ss_pred             CEEECcCCeeccCCChhHcC-CCCCcEEECCCCccCCcCChhHh--cCCCCCEEECcCCCCcCcCCh-----HHhCCCCC
Confidence            77777766443345555443 57788888866654333322232  377888888887743323332     34566778


Q ss_pred             ceeeecccccccccccCcCCCCcCCCccEEEEeeCCCCCccccchHHhhcCCCcEEEEeeccCcceeecccccccccccc
Q 005708          347 EWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKILPSHLVQSFQNLQRLRVGRCELLESVFEIERVNIAKEET  426 (681)
Q Consensus       347 ~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~  426 (681)
                      +.|+++++.-...++.   ....+++|+.|++.++. +....+ ..+..+++|+.|++++|.....++.         .+
T Consensus       359 ~~L~Ls~n~l~~~~p~---~~~~~~~L~~L~l~~n~-l~~~~p-~~~~~~~~L~~L~L~~n~l~~~~p~---------~~  424 (968)
T PLN00113        359 TVLDLSTNNLTGEIPE---GLCSSGNLFKLILFSNS-LEGEIP-KSLGACRSLRRVRLQDNSFSGELPS---------EF  424 (968)
T ss_pred             cEEECCCCeeEeeCCh---hHhCcCCCCEEECcCCE-ecccCC-HHHhCCCCCCEEECcCCEeeeECCh---------hH
Confidence            8888877642111110   01234667777777643 332223 2345577777777777654333332         23


Q ss_pred             cccCccCEEeeccCCCcccccCCCCCcccccccceeeeccCCccccccccccccceeeceeecccccceeEEEeccCCCC
Q 005708          427 ELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIHATTSTS  506 (681)
Q Consensus       427 ~~~~~L~~L~l~~~~~L~~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~l~~~~~L~~L~l~~~~l~~l~~~~~~~~~  506 (681)
                      ..+++|+.|.++++.-...++..   +..+++|+.|++++|.-.... |..+ ...+|+.|++++|++... +  +..  
T Consensus       425 ~~l~~L~~L~Ls~N~l~~~~~~~---~~~l~~L~~L~L~~n~~~~~~-p~~~-~~~~L~~L~ls~n~l~~~-~--~~~--  494 (968)
T PLN00113        425 TKLPLVYFLDISNNNLQGRINSR---KWDMPSLQMLSLARNKFFGGL-PDSF-GSKRLENLDLSRNQFSGA-V--PRK--  494 (968)
T ss_pred             hcCCCCCEEECcCCcccCccChh---hccCCCCcEEECcCceeeeec-Cccc-ccccceEEECcCCccCCc-c--Chh--
Confidence            45666666776665432222211   234566666666666543333 3332 235566666666655432 1  111  


Q ss_pred             CCCCCCCCccEEEEecCCCcceecchhhHhhhccccEeEEcccccccceeccccccccccCCCCcceeccccceeecccC
Q 005708          507 SPTPSLGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDDGGVGLQGASTEKITFPSLFIIQLCHL  586 (681)
Q Consensus       507 ~~~~~~~~L~~L~i~~c~~l~~l~~~~~~~~l~~L~~L~i~~C~~L~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~c  586 (681)
                        +..+++|+.|++++|.....++.  .+.++++|++|++++|.-...+             |.....+++|++|++++|
T Consensus       495 --~~~l~~L~~L~Ls~N~l~~~~p~--~~~~l~~L~~L~Ls~N~l~~~~-------------p~~~~~l~~L~~L~Ls~N  557 (968)
T PLN00113        495 --LGSLSELMQLKLSENKLSGEIPD--ELSSCKKLVSLDLSHNQLSGQI-------------PASFSEMPVLSQLDLSQN  557 (968)
T ss_pred             --hhhhhccCEEECcCCcceeeCCh--HHcCccCCCEEECCCCcccccC-------------ChhHhCcccCCEEECCCC
Confidence              33556666666666643333322  2455666666666666522221             112233566666666666


Q ss_pred             CcccccccCCcccccccccccEEEeccCCCceeecC
Q 005708          587 DSLACFFSAGSHATIEFLALAALLIIDCPSMKTFGY  622 (681)
Q Consensus       587 ~~L~~~~~~~~~~~~~~~sL~~L~i~~C~~L~~~~~  622 (681)
                      +-...+|. .+.   .+++|+.|++.+|+-...+|.
T Consensus       558 ~l~~~~p~-~l~---~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        558 QLSGEIPK-NLG---NVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             cccccCCh-hHh---cCcccCEEeccCCcceeeCCC
Confidence            54444542 222   356666666666665554543

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		681
3zyo_A		411	Crystal Structure Of The N-Terminal Leucine Rich Re		3e-04
3zyn_A		321	Crystal Structure Of The N-Terminal Leucine Rich Re		4e-04

>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411

Back alignment and structure

Iteration: 1

Score = 43.9 bits (102), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 48/161 (29%), Positives = 67/161 (41%), Gaps = 11/161 (6%) Query: 30 PSINTFEDLTGISLMFNDIHEVPDEL--ECPKLQALFLQENSPLAIPDRFFQGMKDLKVL 87 PS+NT E L N + VP + KL+ L+L+ N +IP F + L+ L Sbjct: 83 PSLNTLE------LFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRL 136 Query: 88 DLGGIRGFSLPSSLSF--LINLRTLSLHDCRRFXXXXXXXXXXXXXXXXXXXXXVSEIPV 145 DLG ++ S +F L+NLR L+L C P Sbjct: 137 DLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPG 196 Query: 146 SFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYMSHS 186 SF L LR L L + I R+ L+ LEEL +SH+ Sbjct: 197 SFQGLTSLRKLWLMH-AQVATIERNAFDDLKSLEELNLSHN 236

PyMOL of 3zyo

>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		681
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-20
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-20
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-19
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-15
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-04
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-18
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-16
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	8e-15
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-15
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-17
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-16
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-14
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	8e-17
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	9e-16
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	4e-15
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	8e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-16
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-12
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-16
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-16
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	9e-10
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-15
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-15
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-15
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-14
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-13
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	7e-12
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-14
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-14
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-14
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-14
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-12
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-12
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-13
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-12
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-09
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	6e-12
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-10
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	9e-12
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-11
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	5e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	9e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-07
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-09
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	8e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-11
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-10
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-10
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-10
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-10
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-07
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	8e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	7e-10
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	9e-10
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-09
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	3e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-06
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	9e-07
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	9e-07
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	8e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	1e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	1e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	2e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	5e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	2e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	7e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	8e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	8e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	1e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	9e-04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	8e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-04

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

 Score = 92.9 bits (231), Expect = 6e-20
 Identities = 69/435 (15%), Positives = 141/435 (32%), Gaps = 59/435 (13%)

Query: 42  SLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSLP-SS 100
                    +P  L    +++L L  N    I     +   +L+VL L   R  ++   +
Sbjct: 11  DGRSRSFTSIPSGL-TAAMKSLDLSFNKITYIGHGDLRACANLQVLILKSSRINTIEGDA 69

Query: 101 LSFLINLRTLSLHDCRRFGDLP--LIGELSLLEILDLSESDVSEIPVS--FGRLGHLRLL 156
              L +L  L L D      L     G LS L+ L+L  +    + V+  F  L +L+ L
Sbjct: 70  FYSLGSLEHLDLSDNH-LSSLSSSWFGPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTL 128

Query: 157 DLTDCVHLELIPRDVLSSLRKLEELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSL 216
            + +      I R   + L  L EL +          +           +  +L  +  +
Sbjct: 129 RIGNVETFSEIRRIDFAGLTSLNELEIKAL----SLRN----------YQSQSLKSIRDI 174

Query: 217 HIDIPKGKIMPSDMSFQNLTSFSIKIGDLEEDPLSDFIELFLEKFNKRCSRAMGLSQDMR 276
           H            +           + ++  D LS    L L   N    +   L  D  
Sbjct: 175 HH---------LTLHLSESAF----LLEIFADILSSVRYLELRDTNLARFQFSPLPVDEV 221

Query: 277 ISALHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRCNEMKCLVNSLE 336
            S +        + ++  +  E+  L   + +L+   F++     +   N      + + 
Sbjct: 222 SSPMKKLAFRGSVLTD-ESFNELLKLLRYILELSEVEFDDCTLNGLGDFN--PSESDVVS 278

Query: 337 RTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGC---LSNVKRLDVGDCGSMLKILPSHLV 393
              +V    +  L   + Q  +        +     L  VKR+ V +    + ++P    
Sbjct: 279 ELGKVETVTIRRL--HIPQFYL----FYDLSTVYSLLEKVKRITVENSK--VFLVPCSFS 330

Query: 394 QSFQNLQRLRVGRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLP--RMTDIWKGDT 451
           Q  ++L+ L +    ++E            + +    +   L  + L    +  + K   
Sbjct: 331 QHLKSLEFLDLSENLMVEEYL---------KNSACKGAWPSLQTLVLSQNHLRSMQKTGE 381

Query: 452 QFVSLHNLKKVRVQD 466
             ++L NL  + +  
Sbjct: 382 ILLTLKNLTSLDISR 396

PyMOL of 2z81

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		681
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.98
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.96
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.95
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.94
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.94
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.94
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.94
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.94
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.94
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.93
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.93
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.92
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.9
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.88
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.88
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.88
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.86
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.86
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.86
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.86
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.86
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.86
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.85
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.85
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.84
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.84
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.84
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.84
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.84
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.83
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.83
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.82
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.81
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.81
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.81
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.81
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.81
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.8
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.8
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.79
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.78
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.78
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.78
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.77
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.77
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.77
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.76
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.75
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.75
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.74
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.74
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.74
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.73
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.73
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.73
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.72
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.71
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.71
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.71
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.7
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.7
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.69
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.69
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.66
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.65
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.65
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.65
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.64
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.64
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.64
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.64
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.64
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.63
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.62
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.62
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.61
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.61
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.59
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.59
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.59
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.58
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.57
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.56
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.55
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.55
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.55
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.54
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.53
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.53
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.5
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.48
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.48
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.47
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.45
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.45
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.45
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.43
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.42
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.42
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.41
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.4
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.39
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.38
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.32
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.32
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.27
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.26
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.26
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.25
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.21
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.18
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.17
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.95
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.87
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.86
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.86
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.77
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.76
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.69
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.67
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.58
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.5
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.46
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.4
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.09
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.0
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.97
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.96
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.82
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.74
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.7
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.67
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.62
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.48
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.99
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.63
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.79

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

Probab=100.00  E-value=4.9e-37  Score=342.44  Aligned_cols=520  Identities=19%  Similarity=0.166  Sum_probs=306.2

Q ss_pred             eCCcccCCCCCCCCCCccEEEccCCCCccCCCC-C-CCCCCcEEEccCCCCCCCChHHHhCCCCccEEEecCCCCCCC-C
Q 005708           22 AGVELKDWPSINTFEDLTGISLMFNDIHEVPDE-L-ECPKLQALFLQENSPLAIPDRFFQGMKDLKVLDLGGIRGFSL-P   98 (681)
Q Consensus        22 ~~~~~~~~~~~~~l~~lr~L~l~~~~~~~l~~~-~-~~~~Lr~L~l~~~~~~~l~~~~~~~l~~Lr~L~L~~~~~~~l-p   98 (681)
                      .+.++..+|. .-.+++++|++++|.+..++.. + .+++|++|++++|.+..+++..|+++++||+|++++|.+..+ |
T Consensus        19 ~~~~l~~ip~-~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~i~~~~~~~l~~L~~L~Ls~n~l~~~~p   97 (606)
T 3vq2_A           19 MDQKLSKVPD-DIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSP   97 (606)
T ss_dssp             TTSCCSSCCT-TSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCCEECTTTTTTCTTCCEEECTTCCCCCCCT
T ss_pred             cCCCcccCCC-CCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCcccccCHHHhhchhhcCEeECCCCcccccCh
Confidence            3455677775 2237889999999988877663 3 888999999999988888776788899999999999988666 7


Q ss_pred             ccccCCCCCcEEEccCCCCCCCCc--ccCCCCCccEEEcccCCCc--ccchhhcCCccCcEEeccCCCCCCccChhhhcC
Q 005708           99 SSLSFLINLRTLSLHDCRRFGDLP--LIGELSLLEILDLSESDVS--EIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSS  174 (681)
Q Consensus        99 ~~i~~l~~L~~L~L~~~~~~~~l~--~l~~L~~L~~L~l~~~~i~--~lp~~i~~l~~L~~L~L~~~~~~~~~~~~~l~~  174 (681)
                      .+|+++++|++|++++|. +..++  .++++++|++|++++|.+.  .+|..++++++|++|++++|.. ..+++..++.
T Consensus        98 ~~~~~l~~L~~L~L~~n~-l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~l-~~~~~~~~~~  175 (606)
T 3vq2_A           98 GSFSGLTSLENLVAVETK-LASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYI-QTITVNDLQF  175 (606)
T ss_dssp             TSSTTCTTCCEEECTTSC-CCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSCC-CEECTTTTHH
T ss_pred             hhcCCcccCCEEEccCCc-cccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCcc-eecChhhhhh
Confidence            788899999999999888 55554  7888999999999998887  4788899999999999988654 4454433555


Q ss_pred             CCCCc----EEEcccCcccccccchhhhhhccchhhhcCCCCCcEEEEeCCCCC--CCCCC-CCCCCccEEEEEecCCcC
Q 005708          175 LRKLE----ELYMSHSFCHWQFESEEDARSNAKFIELGALSRLTSLHIDIPKGK--IMPSD-MSFQNLTSFSIKIGDLEE  247 (681)
Q Consensus       175 l~~L~----~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~--~~~~~-~~l~~L~~L~l~~~~~~~  247 (681)
                      +.+|+    .|++++|.+.            ..+.......+|+.|++++|...  ..+.. ..++.++.+.+.......
T Consensus       176 l~~L~~~l~~L~l~~n~l~------------~~~~~~~~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~~~~~~~  243 (606)
T 3vq2_A          176 LRENPQVNLSLDMSLNPID------------FIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKD  243 (606)
T ss_dssp             HHHCTTCCCEEECTTCCCC------------EECTTTTTTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEEEECCTT
T ss_pred             hhccccccceeeccCCCcc------------eeCcccccCceeeeeeccCCccchhHHHHHhcccccccccccccccccc
Confidence            55554    7888887542            23333334447888888888653  22222 566777777766543322


Q ss_pred             CCch-hHHHHHhhhccccccceeeeccccchhh-hHHHHHHHHhccceeecccccCcccccccccccccCCCcEEEEEec
Q 005708          248 DPLS-DFIELFLEKFNKRCSRAMGLSQDMRISA-LHSWIKNLLLRSEILALAEVNDLENMVSDLANDGFNELMFLVIVRC  325 (681)
Q Consensus       248 ~~~~-~~~~~~~~~~~~~~l~~l~l~~~~~~~~-~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~~L~~L~l~~~  325 (681)
                      .... .+....+.......++.+.+.....+.. +|.  ...+++|+.|++.++.. ... +.+.  .+++|++|++.+|
T Consensus       244 ~~~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~~~~~~--~~~l~~L~~L~l~~~~~-~~l-~~l~--~~~~L~~L~l~~n  317 (606)
T 3vq2_A          244 ERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVK--FHCLANVSAMSLAGVSI-KYL-EDVP--KHFKWQSLSIIRC  317 (606)
T ss_dssp             SCCCSCCCGGGGTTGGGSEEEEEEECCCTTCCGGGGS--CGGGTTCSEEEEESCCC-CCC-CCCC--TTCCCSEEEEESC
T ss_pred             CCcccccChHHhhhhhhccHhheeccccccccccccc--cccCCCCCEEEecCccc-hhh-hhcc--ccccCCEEEcccc
Confidence            1110 0001111122222333444422222221 121  22355666666655543 111 2222  2566777777666


Q ss_pred             CCceEeeeccccccccccCccceeeecccccccccccCcCCCCcCCCccEEEEeeCCCCCccc-cchHHhhcCCCcEEEE
Q 005708          326 NEMKCLVNSLERTRRVTLHKLEWLAIFLNQNLVEICHGQLPAGCLSNVKRLDVGDCGSMLKIL-PSHLVQSFQNLQRLRV  404 (681)
Q Consensus       326 ~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~-~~~~~~~l~~L~~L~l  404 (681)
                      . +..++      .. .+++|++|+++++.....+     +...+++|+.|+++++ .++... ....+..+++|++|++
T Consensus       318 ~-l~~lp------~~-~l~~L~~L~l~~n~~~~~~-----~~~~l~~L~~L~ls~n-~l~~~~~~~~~~~~~~~L~~L~L  383 (606)
T 3vq2_A          318 Q-LKQFP------TL-DLPFLKSLTLTMNKGSISF-----KKVALPSLSYLDLSRN-ALSFSGCCSYSDLGTNSLRHLDL  383 (606)
T ss_dssp             C-CSSCC------CC-CCSSCCEEEEESCSSCEEC-----CCCCCTTCCEEECCSS-CEEEEEECCHHHHCCSCCCEEEC
T ss_pred             c-Ccccc------cC-CCCccceeeccCCcCccch-----hhccCCCCCEEECcCC-ccCCCcchhhhhccCCcccEeEC
Confidence            3 24443      12 5666777777666433322     3345666777777664 333331 1233455667777777


Q ss_pred             eeccCcceeecccccccccccccccCccCEEeeccCCCcccccCCCCCcccccccceeeeccCCccccccccccccceee
Q 005708          405 GRCELLESVFEIERVNIAKEETELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAV  484 (681)
Q Consensus       405 ~~c~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~l~~~~~L  484 (681)
                      ++|. +..++.         .+..+++|+.|.+.++......+..  .+..+++|++|++++|. +....|..+..+.+|
T Consensus       384 ~~n~-l~~~~~---------~~~~l~~L~~L~l~~n~l~~~~~~~--~~~~l~~L~~L~l~~n~-l~~~~~~~~~~l~~L  450 (606)
T 3vq2_A          384 SFNG-AIIMSA---------NFMGLEELQHLDFQHSTLKRVTEFS--AFLSLEKLLYLDISYTN-TKIDFDGIFLGLTSL  450 (606)
T ss_dssp             CSCS-EEEECC---------CCTTCTTCCEEECTTSEEESTTTTT--TTTTCTTCCEEECTTSC-CEECCTTTTTTCTTC
T ss_pred             CCCc-cccchh---------hccCCCCCCeeECCCCccCCccChh--hhhccccCCEEECcCCC-CCccchhhhcCCCCC
Confidence            6654 333331         2445666777777665432221111  23456677777777664 333335566666677


Q ss_pred             ceeeccccccee-EEEeccCCCCCCCCCCCCccEEEEecCCCcceecchhhHhhhccccEeEEcccccccceeccccccc
Q 005708          485 EEMVPYRKRRDH-IHIHATTSTSSPTPSLGNLVSITIRGCGQLRQLFTTSMVKSLVRLESLEVSSCPTLQEIIMDDDGGV  563 (681)
Q Consensus       485 ~~L~l~~~~l~~-l~~~~~~~~~~~~~~~~~L~~L~i~~c~~l~~l~~~~~~~~l~~L~~L~i~~C~~L~~~~~~~~~~~  563 (681)
                      +.|++++|.+.. + .  +..    +..+++|++|++++| .++.+++ ..+..+++|++|++++|. ++.+..      
T Consensus       451 ~~L~l~~n~l~~~~-~--~~~----~~~l~~L~~L~Ls~n-~l~~~~~-~~~~~l~~L~~L~Ls~N~-l~~~~~------  514 (606)
T 3vq2_A          451 NTLKMAGNSFKDNT-L--SNV----FANTTNLTFLDLSKC-QLEQISW-GVFDTLHRLQLLNMSHNN-LLFLDS------  514 (606)
T ss_dssp             CEEECTTCEEGGGE-E--CSC----CTTCTTCCEEECTTS-CCCEECT-TTTTTCTTCCEEECCSSC-CSCEEG------
T ss_pred             CEEECCCCcCCCcc-h--HHh----hccCCCCCEEECCCC-cCCccCh-hhhcccccCCEEECCCCc-CCCcCH------
Confidence            777777775543 1 1  222    446667777777666 3444432 234566777777777663 333311      


Q ss_pred             cccCCCCcceeccccceeecccCCcccccccCCcccccccc-cccEEEeccCCC
Q 005708          564 GLQGASTEKITFPSLFIIQLCHLDSLACFFSAGSHATIEFL-ALAALLIIDCPS  616 (681)
Q Consensus       564 ~~~~~~~~~~~l~~L~~L~l~~c~~L~~~~~~~~~~~~~~~-sL~~L~i~~C~~  616 (681)
                            .....+++|++|++++|+ ++.+|.. +.   .+| +|++|++.++|-
T Consensus       515 ------~~~~~l~~L~~L~l~~N~-l~~~p~~-~~---~l~~~L~~l~l~~N~~  557 (606)
T 3vq2_A          515 ------SHYNQLYSLSTLDCSFNR-IETSKGI-LQ---HFPKSLAFFNLTNNSV  557 (606)
T ss_dssp             ------GGTTTCTTCCEEECTTSC-CCCEESC-GG---GSCTTCCEEECCSCCC
T ss_pred             ------HHccCCCcCCEEECCCCc-CcccCHh-Hh---hhcccCcEEEccCCCc
Confidence                  122236667777777653 6666644 22   344 477777766543

PyMOL of 3vq2

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		681
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-10
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	6e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.002
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-04
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	5e-04

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 61.2 bits (147), Expect = 1e-10
 Identities = 33/182 (18%), Positives = 66/182 (36%), Gaps = 28/182 (15%)

Query: 25  ELKDWPSINTFEDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDL 84
           ++ D   +    +L  +SL  N + ++        L  L L  N    +      G+  L
Sbjct: 208 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP--LSGLTKL 265

Query: 85  KVLDLGGIRGFSLPSSLSF---------------------LINLRTLSLHDCRRFGDLPL 123
             L LG  +  ++                           L NL  L+L+      D+  
Sbjct: 266 TELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNN-ISDISP 324

Query: 124 IGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCVHLELIPRDVLSSLRKLEELYM 183
           +  L+ L+ L  + + VS++  S   L ++  L        +L P   L++L ++ +L +
Sbjct: 325 VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP---LANLTRITQLGL 380

Query: 184 SH 185
           + 
Sbjct: 381 ND 382

PyMOL of d2omza2

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		681
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.85
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.85
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.76
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.74
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.73
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.71
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.71
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.7
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.69
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.69
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.69
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.68
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.68
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.67
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.66
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.65
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.65
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.6
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.54
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.48
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.45
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.45
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.42
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.42
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.41
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.4
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.35
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.34
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.23
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.12
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.04
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.94
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.94
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.92
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.83
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.64
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.71
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.66
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.0
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.91
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.54
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.11

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.85  E-value=4.8e-20  Score=190.41  Aligned_cols=80  Identities=16%  Similarity=0.218  Sum_probs=42.7

Q ss_pred             cccCccCEEeeccCCCcccccCCCCCcccccccceeeeccCCccccccccccccceeeceeecccccceeEEEeccCCCC
Q 005708          427 ELFSSLEKLTLIDLPRMTDIWKGDTQFVSLHNLKKVRVQDCDELRQVFPTNLGKKAAVEEMVPYRKRRDHIHIHATTSTS  506 (681)
Q Consensus       427 ~~~~~L~~L~l~~~~~L~~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~l~~~~~L~~L~l~~~~l~~l~~~~~~~~~  506 (681)
                      ..+++++.|.++++ +++.+.    ++..+++|++|++++| +++.+ + .++.+++|+.|++++|+++++    +.   
T Consensus       304 ~~~~~l~~L~ls~n-~l~~l~----~l~~l~~L~~L~L~~n-~l~~l-~-~l~~l~~L~~L~l~~N~l~~l----~~---  368 (384)
T d2omza2         304 SNLKNLTYLTLYFN-NISDIS----PVSSLTKLQRLFFANN-KVSDV-S-SLANLTNINWLSAGHNQISDL----TP---  368 (384)
T ss_dssp             GGCTTCSEEECCSS-CCSCCG----GGGGCTTCCEEECCSS-CCCCC-G-GGGGCTTCCEEECCSSCCCBC----GG---
T ss_pred             chhcccCeEECCCC-CCCCCc----ccccCCCCCEEECCCC-CCCCC-h-hHcCCCCCCEEECCCCcCCCC----hh---
Confidence            34455555555543 223221    1345566666666655 34443 2 355566666666666655554    21   


Q ss_pred             CCCCCCCCccEEEEecC
Q 005708          507 SPTPSLGNLVSITIRGC  523 (681)
Q Consensus       507 ~~~~~~~~L~~L~i~~c  523 (681)
                        +..+++|+.|+|+++
T Consensus       369 --l~~l~~L~~L~L~~N  383 (384)
T d2omza2         369 --LANLTRITQLGLNDQ  383 (384)
T ss_dssp             --GTTCTTCSEEECCCE
T ss_pred             --hccCCCCCEeeCCCC
Confidence              446677777777653

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure