Citrus Sinensis ID: 005747

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68
MAEIILDIVAEVVKCLAPPAYRQIGNLRDKRKVDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFDEESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHLTLNPAESKV
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccEEEEEEcccHHHHHHccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccccEEEcHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccccccEEEccccccccccHHcccccccEEEccccccccccHHHHccccccEEccccccccccccHHHHcccccccEEEcccccccccHHHHHccccccccccccccEEEEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccEEEEEccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccEcccccccccccHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHccHHHHHcccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHcccccccccccEEEEEEccHHHHHHHcccccccEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccHHHHHHcHHccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHccccEEEEcccccEEEEEEEcccccccccccccccccEEEEEEccccccHHHHHHcccEEEEEccccccHcccHHHcccHHHEEEcccccHHHHHcccHHHHHcHHcHEEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccHHccccEEEEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccEEEEEccccccccccccc
MAEIILDIVAEVVKClappayrqignlrdkrkvdeAERKGEEIEENVENWLARANNViedadeftndeatankhcfkglcpnlktrCQLSKEAVRLMEAIVKVREagrfdnisysiipednllmpnkdyEAFESRMSILNEITDAlkngdvntlgiygiggigKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLglkfdeesesGRARRLHDRLKKEKRILVILDNIwgnldlkaagiphgddhrGCKVLLTARSldtlstkmdsqknfsVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATAlrdnnslfdWKDALEQlrrpsstnlmnvqpTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMgmgyfkkkglfSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSlpsslgllsnlqtlslyncklldITVIRDLKKLEVLCLrgsdikrlpvevgELTLLRLldlrdcreleiippnvlsklshleelymgprsfdkWEVEVEGVKNASLHELKHLISLELQiqdvntlprglfleKLERYKILIGGVWGWEYADIWCREFKIDldskirlkDGLILKLQGIEDlwlsdleerdVNYFVNEldkvgpsqlkhlyirgshltlnpaeskv
MAEIILDIVAEVVkclappayrqignlrdkrkvDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVreagrfdnisysiipednllmPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVfsevsesqdirkIQREIADklglkfdeesesgrarrlhdrlkkekRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLdtlstkmdsqknfsVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATalrdnnslFDWKDALEQlrrpsstnlmnvqpTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIAsteqnvfsaTEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLClrgsdikrlpvevgeLTLLRLLDLRDCRELEiippnvlsklshLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLyirgshltlnpaeskv
MAEIILDIVAEVVKCLAPPAYRQIGNLRDKRKVDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLgiygiggigKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFDEESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDllmygmgmgyfkkkglfSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNllslpsslgllsnlqtlslYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGeltllrlldlrdcreleIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHLTLNPAESKV
***IILDIVAEVVKCLAPPAYRQIGNL*******************VENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEV***************************************EKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLS*******NFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLR*****NLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHL*********
MAEIILDIVAEVVKCLAPPAYRQIGNLRDKRKVDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIV*********************************RMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGL***************DRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRP*********PTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHLTLNP*****
MAEIILDIVAEVVKCLAPPAYRQIGNLRDKRKVDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFD*********RLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHLTLNPAESKV
MAEIILDIVAEVVKCLAPPAYRQIGNLRDKRKVDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYS*IPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFDEESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHLT*N******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEIILDIVAEVVKCLAPPAYRQIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFDEESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKKKGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNASLHELKHLISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGSHLTLNPAESKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query679 2.2.26 [Sep-21-2011]
Q9T048 985 Disease resistance protei yes no 0.752 0.518 0.288 2e-51
Q940K0 889 Probable disease resistan no no 0.740 0.565 0.297 2e-42
O22727 967 Probable disease resistan no no 0.721 0.506 0.281 4e-42
O64789 925 Probable disease resistan no no 0.764 0.561 0.279 1e-40
Q8L3R3 885 Disease resistance protei no no 0.703 0.540 0.273 2e-39
O64973 889 Disease resistance protei no no 0.729 0.556 0.262 2e-38
Q8RXS5 888 Probable disease resistan no no 0.762 0.583 0.265 2e-38
Q42484 909 Disease resistance protei no no 0.612 0.457 0.278 5e-38
O81825 919 Probable disease resistan no no 0.599 0.442 0.292 7e-38
P60838 894 Probable disease resistan no no 0.698 0.530 0.283 1e-36
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score =  204 bits (519), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 180/625 (28%), Positives = 304/625 (48%), Gaps = 114/625 (18%)

Query: 83  LKTRCQLSKEAVRLMEAIVKVREAG--RFDNISYSIIPEDNLLMPNKDYEAFESRMSILN 140
           +  R ++S++ V++++ +  + + G    D +S    PE    +P           ++L 
Sbjct: 94  MSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLA 153

Query: 141 EITDALKNGDVNTLGIYGIGGIGKTTLAKEVARRAEND---KLFDQVVFSEVSESQDIRK 197
           +I D L +     +G++G+GG+GKTTL + +  +   +   + F  V+F  VS+  D R+
Sbjct: 154 KIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPRE 213

Query: 198 IQREIADKLGLKFD-EESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDH 256
           +Q++IA++L +    EESE   ARR++  L KE++ L+ILD++W  +DL   GIP  +++
Sbjct: 214 VQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEEN 273

Query: 257 RGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVA 316
           +G KV+LT+R L+   + M +  +  V  L EE+AW LF K AGD V  + ++++A+ V+
Sbjct: 274 KGSKVILTSRFLEVCRS-MKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVS 332

Query: 317 KECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLA 376
           +EC GLP+AI+TV TA+R   ++  W   L +L + S   + +++   ++ +KLSYD L 
Sbjct: 333 QECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSK-SVPWIKSIEEKIFQPLKLSYDFLE 391

Query: 377 GEELKNIFLLIG-YTAIASID--DLLMYGMGMGYFKKKG--------------------- 412
            ++ K  FLL   +    SI+  +++ Y M  G+ ++ G                     
Sbjct: 392 -DKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCL 450

Query: 413 --------LFSMHDVVRDVAISIASTEQN-----VFSATEEQ-VR-------VINVSYMN 451
                      MHDVVRD AI I S+ Q+     V S T  Q +R       +  VS MN
Sbjct: 451 LEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMN 510

Query: 452 --LLSLPS-----------------------SLGLLSNLQTLSLYN-----------C-- 473
             L SLP                         +G L    TL + N           C  
Sbjct: 511 NKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSL 570

Query: 474 ---------------KLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDC 518
                          KL+ +  +  L KLE+L L G+ I   P  + EL   R LDL   
Sbjct: 571 LRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRT 630

Query: 519 RELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVK-NASLHELKHLISLELQIQDVN 577
             LE IP  V+S+LS LE L M    + +W V+ E  K  A++ E+  L  L++    ++
Sbjct: 631 LHLESIPARVVSRLSSLETLDMTSSHY-RWSVQGETQKGQATVEEIGCLQRLQVLSIRLH 689

Query: 578 TLP-----RGLFLEKLERYKILIGG 597
           + P     R  ++++L+++++++G 
Sbjct: 690 SSPFLLNKRNTWIKRLKKFQLVVGS 714
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query679
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.974 0.494 0.410 1e-151
359488027 1520 PREDICTED: disease resistance protein At 0.974 0.435 0.418 1e-149
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.970 0.389 0.403 1e-143
147787802 1517 hypothetical protein VITISV_005047 [Viti 0.970 0.434 0.412 1e-143
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.933 0.554 0.433 1e-142
296087869 1711 unnamed protein product [Vitis vinifera] 0.958 0.380 0.422 1e-141
302143649 1436 unnamed protein product [Vitis vinifera] 0.958 0.453 0.419 1e-139
359488103 1530 PREDICTED: disease resistance protein At 0.970 0.430 0.387 1e-136
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.961 0.496 0.397 1e-136
147777048 1460 hypothetical protein VITISV_009359 [Viti 0.969 0.450 0.387 1e-135
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 317/773 (41%), Positives = 450/773 (58%), Gaps = 111/773 (14%)

Query: 1   MAEIILDIVAEVVKCLAPPAYRQIGNL----------------------RDKRKVDEAER 38
           M EI++ + A+V + L  P  RQ+G+L                      R +  VDEA R
Sbjct: 1   MVEIVVSVAAKVSEYLVAPVGRQLGHLFNYRTNVEDLSQQVAKLRDARARQQHSVDEAIR 60

Query: 39  KGEEIEENVENWLARANNVIEDADEFTNDEATANKHCFKGLCPNLKTRCQLSKEAVRLME 98
           KG +IE++V  W  RA+  I+ A +F  +E  A K CF GLCPNLK+R QLSKEA +   
Sbjct: 61  KGHKIEDDVCKWFTRADGFIQVACKFLEEEKEAQKTCFNGLCPNLKSRYQLSKEARKKAG 120

Query: 99  AIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYG 158
             V++   G+F+ +SY     +    P K  +  ESRM  LNE+  AL++ D+NT+GI+G
Sbjct: 121 VAVEIHGDGQFERVSYRPPLLEIGSAPPKASKVLESRMLTLNEVMKALRDADINTIGIWG 180

Query: 159 IGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFDEESESGR 218
           +GG+GK TL K+VA +A  +KLFD+VV + V ++ D R+IQ EIAD LG+KF+EESE GR
Sbjct: 181 MGGVGKNTLVKQVAEQAAQEKLFDKVVMTSVFQTPDFRRIQGEIADMLGMKFEEESEQGR 240

Query: 219 ARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQ 278
           A RLH ++ +EK IL+ILD+IW  L+L+  GIP  D+H+GCK++LT+R+   LS +M +Q
Sbjct: 241 AARLHRKINEEKTILIILDDIWAELELEKIGIPSPDNHKGCKLVLTSRNKHVLSNEMSTQ 300

Query: 279 KNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNS 338
           K+F V  L+ +EAW LFK M GD +E  +L  +A DVAKEC GLP+AIVTVA AL++ N 
Sbjct: 301 KDFGVEHLQGDEAWILFKNMVGDSIENPDLLLIATDVAKECTGLPIAIVTVAKALKNKNV 360

Query: 339 LFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIG-YTAIASIDD 397
              WKDAL+QL+  +STN+  +    Y  +KLSY  L G+E+K++FLL G ++    I D
Sbjct: 361 SI-WKDALKQLKTQTSTNITGMGTKVYSTLKLSYKHLEGDEVKSLFLLCGLFSNYIDIRD 419

Query: 398 LLMYGMGMGYF-----------------------------KKKGLFSMHDVVRDVAISIA 428
           LL YGMG+  F                             +   +F MHDVV++VAI IA
Sbjct: 420 LLKYGMGLRLFQGTNTLEEAKNRIETLVDNLKASNLLLETRYNAVFRMHDVVQNVAIEIA 479

Query: 429 STEQNVFSATE------------------------------------------------- 439
           S E +VF+                                                    
Sbjct: 480 SKEHHVFTFQTGVRMEEWPNMDELQKFTMIYLDCCDIRELPEGLNHNSSLKIPNTFFEGM 539

Query: 440 EQVRVINVSYMNLLSLPSSLGLLSNLQTLSLYNCKLLDITVIRDLKKLEVLCLRGSDIKR 499
           +Q++V++ + M+L SLPSSL  L+NL+TL L  CKL DIT+I +LKKLE+L L  SDI++
Sbjct: 540 KQLKVLDFTNMHLPSLPSSLHCLANLRTLCLDACKLGDITIIAELKKLEILSLMDSDIEQ 599

Query: 500 LPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPRSFDKWEVEVEGVKNAS 559
           LP E+ +LT LRLLDL+   +L++IPP+V+S LS LE+L M   S+ +W  EVEG  NA 
Sbjct: 600 LPRELSQLTHLRLLDLKGSSKLKVIPPDVISSLSQLEDLCM-ENSYTQW--EVEGKSNAY 656

Query: 560 LHELKH---LISLELQIQDVNTLPRGLFLEKLERYKILIGGVWGWEYADIWCREFKID-L 615
           L ELKH   L +L++QI D    P+ +  + L +Y+I +G VW WE      +  K++  
Sbjct: 657 LAELKHLSYLTTLDIQIPDAKLFPKDVVFDNLMKYRIFVGDVWSWEENCETNKTLKLNEF 716

Query: 616 DSKIRLKDGLILKLQGIEDLWLSDLEERDVNYFVNELDKVGPSQLKHLYIRGS 668
           D+ + L +G+   L+  EDL L DL  R     +++LD+    +LKHL +  S
Sbjct: 717 DTSLHLVEGISKLLRXTEDLHLHDL--RGTTNILSKLDRQCFLKLKHLNVESS 767

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143649|emb|CBI22402.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147777048|emb|CAN65562.1| hypothetical protein VITISV_009359 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query679
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.443 0.305 0.316 3.1e-41
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.528 0.371 0.297 8.5e-37
TAIR|locus:2008440 899 AT1G61180 [Arabidopsis thalian 0.515 0.389 0.302 3.4e-36
TAIR|locus:2201986 885 RFL1 "AT1G12210" [Arabidopsis 0.487 0.374 0.272 3.2e-33
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.427 0.315 0.293 9.9e-33
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.513 0.392 0.284 1.2e-32
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.508 0.385 0.286 3.1e-31
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.528 0.404 0.266 9.1e-31
TAIR|locus:2197739 762 AT1G61300 [Arabidopsis thalian 0.335 0.299 0.341 3.7e-28
TAIR|locus:2034765 884 AT1G12290 [Arabidopsis thalian 0.540 0.415 0.255 1.6e-27
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 398 (145.2 bits), Expect = 3.1e-41, Sum P(3) = 3.1e-41
 Identities = 98/310 (31%), Positives = 174/310 (56%)

Query:    83 LKTRCQLSKEAVRLMEAIVKVREAG-RF-DNISYSIIPEDNLLMPNKDYEAFESRMSILN 140
             +  R ++S++ V++++ +  + + G  F D +S    PE    +P           ++L 
Sbjct:    94 MSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLA 153

Query:   141 EITDALKNGDVNTLXXXXXXXXXKTTLAKEVARRAEND---KLFDQVVFSEVSESQDIRK 197
             +I D L +     +         KTTL + +  +   +   + F  V+F  VS+  D R+
Sbjct:   154 KIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPRE 213

Query:   198 IQREIADKLGLKFD-EESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDH 256
             +Q++IA++L +    EESE   ARR++  L KE++ L+ILD++W  +DL   GIP  +++
Sbjct:   214 VQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEEN 273

Query:   257 RGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVA 316
             +G KV+LT+R L+   + M +  +  V  L EE+AW LF K AGD V  + ++++A+ V+
Sbjct:   274 KGSKVILTSRFLEVCRS-MKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVS 332

Query:   317 KECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLA 376
             +EC GLP+AI+TV TA+R   ++  W   L +L + S   + +++   ++ +KLSYD L 
Sbjct:   333 QECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSK-SVPWIKSIEEKIFQPLKLSYDFLE 391

Query:   377 GEELKNIFLL 386
              ++ K  FLL
Sbjct:   392 -DKAKFCFLL 400
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query679
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 8e-45
pfam13401124 pfam13401, AAA_22, AAA domain 4e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 5e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-04
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  161 bits (409), Expect = 8e-45
 Identities = 75/243 (30%), Positives = 125/243 (51%), Gaps = 9/243 (3%)

Query: 148 NGDVNTLGIYGIGGIGKTTLAKEVARRAENDKLFDQVVFSEVSESQDIRKIQREIADKLG 207
           + ++  +GI G+GG+GKTTLAK++         FD V +  VS++    ++Q++I  +LG
Sbjct: 16  SDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELG 75

Query: 208 LK---FDEESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLT 264
           L    + E++ES  A ++ + L   KR L++LD++W   D    G+P  D   G +V++T
Sbjct: 76  LDDSDWVEKNESELAVKIKEALL-RKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVT 134

Query: 265 ARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAG--DYVEGNELKEVARDVAKECAGL 322
            RS         + K   V  L+ EE+W LF       +     EL+EVA+++ ++C GL
Sbjct: 135 TRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGL 194

Query: 323 PVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKN 382
           P+A+  +   L   +++ +W+  LEQL         +        + LSYD L    LK 
Sbjct: 195 PLALKVLGGLLAFKSTVQEWEHVLEQLNN--ELAGRDGLNEVLSILSLSYDNLP-MHLKR 251

Query: 383 IFL 385
            FL
Sbjct: 252 CFL 254

Length = 285
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 679
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.81
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.49
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.46
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.45
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.38
PRK04841 903 transcriptional regulator MalT; Provisional 99.37
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.27
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.22
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.22
PF05729166 NACHT: NACHT domain 99.21
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.85
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.84
PRK06893229 DNA replication initiation factor; Validated 98.84
PRK13342413 recombination factor protein RarA; Reviewed 98.83
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.83
PLN03150623 hypothetical protein; Provisional 98.79
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.77
PLN03150623 hypothetical protein; Provisional 98.77
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.73
PTZ001121164 origin recognition complex 1 protein; Provisional 98.73
PRK12402337 replication factor C small subunit 2; Reviewed 98.72
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.71
PRK05564313 DNA polymerase III subunit delta'; Validated 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
COG3899 849 Predicted ATPase [General function prediction only 98.65
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.65
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.65
PF13173128 AAA_14: AAA domain 98.62
PLN03025319 replication factor C subunit; Provisional 98.62
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.62
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
PRK00440319 rfc replication factor C small subunit; Reviewed 98.6
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.6
PRK04195482 replication factor C large subunit; Provisional 98.59
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.58
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.58
PTZ00202550 tuzin; Provisional 98.57
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.56
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.55
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.54
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.54
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.54
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.52
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.51
COG3903414 Predicted ATPase [General function prediction only 98.5
cd01128249 rho_factor Transcription termination factor rho is 98.5
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.45
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 98.45
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.44
PRK07940394 DNA polymerase III subunit delta'; Validated 98.43
PRK07471365 DNA polymerase III subunit delta'; Validated 98.43
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.42
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.42
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.42
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.42
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 98.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
PRK09112351 DNA polymerase III subunit delta'; Validated 98.41
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.39
PRK08727233 hypothetical protein; Validated 98.39
PRK09376416 rho transcription termination factor Rho; Provisio 98.38
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 98.38
PRK08084235 DNA replication initiation factor; Provisional 98.38
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.38
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.38
PRK13341 725 recombination factor protein RarA/unknown domain f 98.37
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.36
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.34
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.33
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 98.31
PRK09087226 hypothetical protein; Validated 98.29
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 98.29
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 98.26
KOG2028554 consensus ATPase related to the helicase subunit o 98.25
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 98.24
PRK03992389 proteasome-activating nucleotidase; Provisional 98.22
TIGR00767415 rho transcription termination factor Rho. Members 98.2
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.19
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.17
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK05642234 DNA replication initiation factor; Validated 98.16
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 98.14
PHA02544316 44 clamp loader, small subunit; Provisional 98.14
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.11
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.11
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.11
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 98.09
PF14516331 AAA_35: AAA-like domain 98.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.08
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.08
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.07
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.07
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.05
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 98.04
PRK15386 426 type III secretion protein GogB; Provisional 98.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.02
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.01
PRK07399314 DNA polymerase III subunit delta'; Validated 98.01
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 98.0
PRK14087450 dnaA chromosomal replication initiation protein; P 98.0
PRK15386 426 type III secretion protein GogB; Provisional 97.99
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.97
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.95
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.94
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.94
CHL00095821 clpC Clp protease ATP binding subunit 97.92
CHL00181287 cbbX CbbX; Provisional 97.91
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 97.91
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.88
PRK06620214 hypothetical protein; Validated 97.87
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.86
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.85
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.85
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.84
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.83
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.82
PRK05707328 DNA polymerase III subunit delta'; Validated 97.81
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.8
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.8
smart00382148 AAA ATPases associated with a variety of cellular 97.75
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.74
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.74
PRK14088440 dnaA chromosomal replication initiation protein; P 97.74
PRK10536262 hypothetical protein; Provisional 97.73
PRK00149450 dnaA chromosomal replication initiation protein; R 97.72
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.71
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.7
CHL00176638 ftsH cell division protein; Validated 97.69
PRK08769319 DNA polymerase III subunit delta'; Validated 97.68
PRK14086617 dnaA chromosomal replication initiation protein; P 97.64
PRK08058329 DNA polymerase III subunit delta'; Validated 97.64
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.63
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.59
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.56
CHL00195489 ycf46 Ycf46; Provisional 97.56
PRK10865 857 protein disaggregation chaperone; Provisional 97.55
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.54
PF00004132 AAA: ATPase family associated with various cellula 97.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
PRK06871325 DNA polymerase III subunit delta'; Validated 97.5
KOG0731774 consensus AAA+-type ATPase containing the peptidas 97.49
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 97.48
COG0593408 DnaA ATPase involved in DNA replication initiation 97.47
PRK12422445 chromosomal replication initiation protein; Provis 97.47
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.44
PRK08181269 transposase; Validated 97.43
PRK06090319 DNA polymerase III subunit delta'; Validated 97.41
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 97.39
PRK08118167 topology modulation protein; Reviewed 97.39
PHA00729226 NTP-binding motif containing protein 97.38
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.37
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 97.33
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.31
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.29
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.28
PRK07993334 DNA polymerase III subunit delta'; Validated 97.28
PRK08116268 hypothetical protein; Validated 97.28
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.26
PRK12608380 transcription termination factor Rho; Provisional 97.25
PRK06964342 DNA polymerase III subunit delta'; Validated 97.23
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.16
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.14
PRK04132846 replication factor C small subunit; Provisional 97.13
PRK07261171 topology modulation protein; Provisional 97.13
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.13
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 97.09
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.09
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.08
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.08
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.07
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.07
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.07
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.05
PRK12377248 putative replication protein; Provisional 97.0
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.99
PRK08939306 primosomal protein DnaI; Reviewed 96.98
KOG0734752 consensus AAA+-type ATPase containing the peptidas 96.95
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.91
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.9
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.88
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 96.85
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.84
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.82
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.82
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.79
PRK10865857 protein disaggregation chaperone; Provisional 96.79
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.77
PTZ00494664 tuzin-like protein; Provisional 96.77
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.76
KOG1969877 consensus DNA replication checkpoint protein CHL12 96.75
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.74
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.73
PRK07952244 DNA replication protein DnaC; Validated 96.72
CHL00095821 clpC Clp protease ATP binding subunit 96.72
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.68
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.68
PRK06526254 transposase; Provisional 96.66
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.66
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 96.65
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.65
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 96.61
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.6
PRK09354349 recA recombinase A; Provisional 96.6
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.6
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.59
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.57
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 96.56
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.54
PRK06696223 uridine kinase; Validated 96.53
PRK09183259 transposase/IS protein; Provisional 96.52
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.51
PRK08699325 DNA polymerase III subunit delta'; Validated 96.51
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.5
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.49
PRK07132299 DNA polymerase III subunit delta'; Validated 96.48
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.47
KOG2228408 consensus Origin recognition complex, subunit 4 [R 96.46
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.45
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.44
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.4
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.38
PRK05541176 adenylylsulfate kinase; Provisional 96.38
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.38
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.37
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.36
TIGR02236310 recomb_radA DNA repair and recombination protein R 96.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.35
PRK06921266 hypothetical protein; Provisional 96.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.31
PTZ00035337 Rad51 protein; Provisional 96.29
PLN03186342 DNA repair protein RAD51 homolog; Provisional 96.27
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 96.27
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.24
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.23
KOG0736953 consensus Peroxisome assembly factor 2 containing 96.16
PRK15455644 PrkA family serine protein kinase; Provisional 96.15
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.15
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.14
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.13
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 96.12
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.12
PRK04301317 radA DNA repair and recombination protein RadA; Va 96.12
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.1
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.09
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.06
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.05
cd01394218 radB RadB. The archaeal protein radB shares simila 96.05
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.05
PRK06547172 hypothetical protein; Provisional 96.04
PF00154322 RecA: recA bacterial DNA recombination protein; In 96.04
PRK04296190 thymidine kinase; Provisional 96.03
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 96.03
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.01
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 96.0
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 95.97
cd03115173 SRP The signal recognition particle (SRP) mediates 95.94
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 95.93
PRK00771437 signal recognition particle protein Srp54; Provisi 95.89
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.87
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.86
PRK14974336 cell division protein FtsY; Provisional 95.84
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.84
PRK07667193 uridine kinase; Provisional 95.83
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.83
PRK06835329 DNA replication protein DnaC; Validated 95.82
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.79
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 95.77
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.77
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.75
PRK06067234 flagellar accessory protein FlaH; Validated 95.74
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.73
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.73
PRK04328249 hypothetical protein; Provisional 95.71
PRK05439311 pantothenate kinase; Provisional 95.71
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.7
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 95.67
TIGR00064272 ftsY signal recognition particle-docking protein F 95.66
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 95.65
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.65
PRK13531498 regulatory ATPase RavA; Provisional 95.64
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.59
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 95.58
PHA02244383 ATPase-like protein 95.58
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 95.58
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.57
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.56
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.54
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.52
PRK05480209 uridine/cytidine kinase; Provisional 95.52
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.49
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 95.49
PRK05917290 DNA polymerase III subunit delta'; Validated 95.48
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.47
cd02117212 NifH_like This family contains the NifH (iron prot 95.47
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.47
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.46
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.45
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.44
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.44
PRK13765637 ATP-dependent protease Lon; Provisional 95.41
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 95.4
PRK08233182 hypothetical protein; Provisional 95.39
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 95.38
PRK11823446 DNA repair protein RadA; Provisional 95.35
PTZ00301210 uridine kinase; Provisional 95.35
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 95.34
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 95.32
PRK13236296 nitrogenase reductase; Reviewed 95.31
PRK13230279 nitrogenase reductase-like protein; Reviewed 95.29
PRK09519 790 recA DNA recombination protein RecA; Reviewed 95.27
TIGR00959428 ffh signal recognition particle protein. This mode 95.26
PRK06762166 hypothetical protein; Provisional 95.24
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 95.24
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.24
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.22
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.21
PRK15429686 formate hydrogenlyase transcriptional activator Fh 95.17
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.17
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 95.16
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.15
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.15
PRK08972444 fliI flagellum-specific ATP synthase; Validated 95.14
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.14
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.13
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.1
PRK10867433 signal recognition particle protein; Provisional 95.1
PRK06851367 hypothetical protein; Provisional 95.06
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 95.04
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.04
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.01
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.01
PRK13232273 nifH nitrogenase reductase; Reviewed 95.01
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 94.99
PRK03839180 putative kinase; Provisional 94.98
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.97
PF07726131 AAA_3: ATPase family associated with various cellu 94.97
PF1324576 AAA_19: Part of AAA domain 94.96
PRK08149428 ATP synthase SpaL; Validated 94.94
PRK13235274 nifH nitrogenase reductase; Reviewed 94.93
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 94.93
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.91
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 94.88
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.88
PRK11608326 pspF phage shock protein operon transcriptional ac 94.86
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.84
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 94.84
PRK08927442 fliI flagellum-specific ATP synthase; Validated 94.82
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.82
PRK06002450 fliI flagellum-specific ATP synthase; Validated 94.82
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 94.81
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 94.8
COG0488530 Uup ATPase components of ABC transporters with dup 94.79
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 94.78
PRK04040188 adenylate kinase; Provisional 94.76
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.76
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 94.74
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.73
PRK00625173 shikimate kinase; Provisional 94.71
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 94.71
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 94.7
COG4618580 ArpD ABC-type protease/lipase transport system, AT 94.7
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 94.66
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.63
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.63
PRK13768253 GTPase; Provisional 94.63
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.63
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.61
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.6
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 94.59
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.58
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 94.57
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 94.57
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.56
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 94.56
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 94.55
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.55
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 94.55
PRK09099441 type III secretion system ATPase; Provisional 94.55
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.55
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 94.53
PRK09280463 F0F1 ATP synthase subunit beta; Validated 94.53
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 94.53
PRK00131175 aroK shikimate kinase; Reviewed 94.52
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 94.51
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.51
COG0003322 ArsA Predicted ATPase involved in chromosome parti 94.51
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 94.5
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 94.49
KOG4341483 consensus F-box protein containing LRR [General fu 94.48
PRK01184184 hypothetical protein; Provisional 94.47
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 94.47
PRK07276290 DNA polymerase III subunit delta'; Validated 94.47
PRK06217183 hypothetical protein; Validated 94.43
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 94.43
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.43
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 94.41
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 94.39
PRK05922434 type III secretion system ATPase; Validated 94.37
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 94.37
COG4088261 Predicted nucleotide kinase [Nucleotide transport 94.36
PRK00889175 adenylylsulfate kinase; Provisional 94.36
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 94.36
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 94.35
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.34
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 94.32
PRK09435332 membrane ATPase/protein kinase; Provisional 94.32
PTZ00185574 ATPase alpha subunit; Provisional 94.31
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 94.29
COG0714329 MoxR-like ATPases [General function prediction onl 94.28
COG4240300 Predicted kinase [General function prediction only 94.28
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.28
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 94.26
PRK13234295 nifH nitrogenase reductase; Reviewed 94.26
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.25
PRK07594433 type III secretion system ATPase SsaN; Validated 94.23
cd01878204 HflX HflX subfamily. A distinct conserved domain w 94.23
PRK06936439 type III secretion system ATPase; Provisional 94.22
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 94.21
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 94.2
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.18
PLN02165334 adenylate isopentenyltransferase 94.17
PRK10416318 signal recognition particle-docking protein FtsY; 94.17
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 94.16
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.16
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 94.15
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.14
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 94.14
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 94.14
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 94.13
PRK12678672 transcription termination factor Rho; Provisional 94.12
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 94.11
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.09
PF13479213 AAA_24: AAA domain 94.09
PRK14531183 adenylate kinase; Provisional 94.08
PRK13947171 shikimate kinase; Provisional 94.06
PRK00409782 recombination and DNA strand exchange inhibitor pr 94.05
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 94.04
PRK00300205 gmk guanylate kinase; Provisional 94.04
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 94.02
PRK05688451 fliI flagellum-specific ATP synthase; Validated 94.02
PTZ00088229 adenylate kinase 1; Provisional 94.02
PRK13407334 bchI magnesium chelatase subunit I; Provisional 94.0
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.0
KOG4341483 consensus F-box protein containing LRR [General fu 93.99
PRK13949169 shikimate kinase; Provisional 93.98
PRK05022509 anaerobic nitric oxide reductase transcription reg 93.97
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 93.95
CHL00206 2281 ycf2 Ycf2; Provisional 93.95
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 93.94
KOG2170344 consensus ATPase of the AAA+ superfamily [General 93.92
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=5.5e-74  Score=642.50  Aligned_cols=511  Identities=29%  Similarity=0.478  Sum_probs=405.8

Q ss_pred             hhhhHHHHHHHcCCcchHHHHHHHHHHHHHHHHHHHHhhhHHhh-----------------ccccccCCC-CChhHHHHH
Q 005747           28 RDKRKVDEAERKGEEIEENVENWLARANNVIEDADEFTNDEATA-----------------NKHCFKGLC-PNLKTRCQL   89 (679)
Q Consensus        28 ~i~~~l~~a~~~~~~~~~~v~~Wl~~l~~~~yd~ed~ld~~~~~-----------------~~~~~~~~~-~~~~~r~~~   89 (679)
                      .++.++++|+.++.. ...+..|...+++++|++||.++.+...                 +.-|+.+.| ..+..-+.+
T Consensus        39 ~l~~~l~d~~a~~~~-~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~  117 (889)
T KOG4658|consen   39 ALQSALEDLDAKRDD-LERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKY  117 (889)
T ss_pred             HHHHHHHHHHhhcch-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhH
Confidence            899999999988753 6888999999999999999998754211                 112333333 233444667


Q ss_pred             HHHHHHHHHHHHHHHHcCCCCccccccCC-CccccCCCCCcccccchHHHHHHHHHHhcCCCccEEEEEcCCCCcHHHHH
Q 005747           90 SKEAVRLMEAIVKVREAGRFDNISYSIIP-EDNLLMPNKDYEAFESRMSILNEITDALKNGDVNTLGIYGIGGIGKTTLA  168 (679)
Q Consensus        90 ~~~i~~~~~~~~~i~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~gr~~~~~~l~~~L~~~~~~vi~I~G~gGiGKTtLa  168 (679)
                      ++++-++.+.++.+..++.|..+.....| ......|...... +|.+..++++.+.|.+++..+++|+||||+||||||
T Consensus       118 ~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~  196 (889)
T KOG4658|consen  118 GKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD-VGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLA  196 (889)
T ss_pred             HHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc-ccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHH
Confidence            77777777777777666566555432111 2222333333334 899999999999999888899999999999999999


Q ss_pred             HHHHHHhc-cCCCCCeEEEEEcCCCcCHHHHHHHHHHHhCCCCCccc---hhHHHHHHHHHHHcCCceEEEEecCCCccc
Q 005747          169 KEVARRAE-NDKLFDQVVFSEVSESQDIRKIQREIADKLGLKFDEES---ESGRARRLHDRLKKEKRILVILDNIWGNLD  244 (679)
Q Consensus       169 ~~v~~~~~-~~~~F~~~~wv~v~~~~~~~~l~~~i~~~l~~~~~~~~---~~~~~~~l~~~l~~~k~~LlVlDdv~~~~~  244 (679)
                      ++++|+.. ++++||.++||.||+.++..+++++|++.++.......   ....+..+.+.|. +|||+|||||||+..+
T Consensus       197 ~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~-~krfllvLDDIW~~~d  275 (889)
T KOG4658|consen  197 RQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLE-GKRFLLVLDDIWEEVD  275 (889)
T ss_pred             HHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhc-cCceEEEEeccccccc
Confidence            99999988 89999999999999999999999999999987443322   2455666666666 7999999999999999


Q ss_pred             hhhcCCCCCCCCCCcEEEEeecCcchhcccCCCcceEEecCCChHHHHHHHHHHhCCC--CCCccHHHHHHHHHHHcCCC
Q 005747          245 LKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKMAGDY--VEGNELKEVARDVAKECAGL  322 (679)
Q Consensus       245 ~~~l~~~~~~~~~gs~iivTtR~~~v~~~~~~~~~~~~l~~L~~~e~~~Lf~~~~~~~--~~~~~~~~~~~~I~~~~~gl  322 (679)
                      |+.++.++|...+||+|++|||+++|+...+++...++++.|+.+|||.||.+.++..  ...+.++++|++++++|+|+
T Consensus       276 w~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GL  355 (889)
T KOG4658|consen  276 WDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGL  355 (889)
T ss_pred             HHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCCh
Confidence            9999999999999999999999999987768889999999999999999999999854  33355899999999999999


Q ss_pred             hHHHHHHHHHhhcCCChhHHHHHHHHhcCCCCCCcCCchhhHHHHHHhhhcCCChhHHHHHHHHhccccc---CChhHHH
Q 005747          323 PVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAI---ASIDDLL  399 (679)
Q Consensus       323 Plai~~~~~~L~~~~~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl~~s~fp~---~~~~~li  399 (679)
                      |||++++|+.|+.+++..+|+++.+.+......+..++.+.+++++++||+.||++ +|.||+|||+||+   |+++.|+
T Consensus       356 PLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li  434 (889)
T KOG4658|consen  356 PLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLI  434 (889)
T ss_pred             HHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHH
Confidence            99999999999998899999999999988766666677899999999999999965 9999999999996   9999999


Q ss_pred             Hhhhccccccc---------------------------C-----CcEEeehhHHHHHHHHhh-----cccceeeec----
Q 005747          400 MYGMGMGYFKK---------------------------K-----GLFSMHDVVRDVAISIAS-----TEQNVFSAT----  438 (679)
Q Consensus       400 ~~w~~~g~~~~---------------------------~-----~~~~mHdlv~~~~~~~~~-----~~~~~~~~~----  438 (679)
                      .+|+||||+..                           .     .+|.|||+||++|.++++     .++.+....    
T Consensus       435 ~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~  514 (889)
T KOG4658|consen  435 EYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLS  514 (889)
T ss_pred             HHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCcc
Confidence            99999998854                           1     689999999999999999     555444322    


Q ss_pred             ---C--------------------------CceEEEEeeccc--CCCCCcc-ccCCCCCCEEEcCCCC-CCC-chhhcCC
Q 005747          439 ---E--------------------------EQVRVINVSYMN--LLSLPSS-LGLLSNLQTLSLYNCK-LLD-ITVIRDL  484 (679)
Q Consensus       439 ---~--------------------------~~L~~L~l~~n~--l~~lp~~-~~~l~~L~~L~L~~n~-l~~-~~~~~~l  484 (679)
                         .                          +.|++|-+.+|.  +..++.. |..++.|++|||++|. +.. |..+++|
T Consensus       515 ~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~L  594 (889)
T KOG4658|consen  515 EIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGEL  594 (889)
T ss_pred             ccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhh
Confidence               0                          446666666654  4444433 5567777777777765 344 5667777


Q ss_pred             CCCcEEEcccccccccchhhhcCcCCCEEeccCCcCccccChhhhcCCcccceeecCCC
Q 005747          485 KKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLSKLSHLEELYMGPR  543 (679)
Q Consensus       485 ~~L~~L~L~~n~i~~lp~~i~~l~~L~~L~l~~n~~~~~lp~~~~~~l~~L~~L~l~~n  543 (679)
                      -+||||+|+++.|+.+|.++++|+.|.+|++..+.....+| ++...|++|++|.+...
T Consensus       595 i~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s  652 (889)
T KOG4658|consen  595 VHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIP-GILLELQSLRVLRLPRS  652 (889)
T ss_pred             hhhhcccccCCCccccchHHHHHHhhheecccccccccccc-chhhhcccccEEEeecc
Confidence            77777777777777777777777777777777766555553 33556777777777654

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query679
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 2e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 6e-05
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (44%), Gaps = 18/147 (12%)
Query: 226 LKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSV-- 283
           L+K  R L+ILD++W +  LKA           C++LLT R      + M  +    V  
Sbjct: 232 LRKHPRSLLILDDVWDSWVLKAFD-------SQCQILLTTRDKSVTDSVMGPKYVVPVES 284
Query: 284 SFLKEE--EAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFD 341
           S  KE+  E  SLF  M     +  +L E A  + KEC G P+ +  +   LRD  +   
Sbjct: 285 SLGKEKGLEILSLFVNM-----KKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPN--R 337
Query: 342 WKDALEQLRRPSSTNLMNVQPTAYKAI 368
           W+  L+QL+      +       Y+A+
Sbjct: 338 WEYYLKQLQNKQFKRIRKSSSYDYEAL 364

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query679
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-47
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-44
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-32
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 5e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 5e-04
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  178 bits (453), Expect = 5e-47
 Identities = 106/705 (15%), Positives = 210/705 (29%), Gaps = 213/705 (30%)

Query: 29  DKRKVDEAER---KGEEIEE-----NVEN------WLARANNVIEDADEFTNDEATANKH 74
           D + V +  +     EEI+      +  +      W   +    E   +F  +    N  
Sbjct: 34  DCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQE-EMVQKFVEEVLRIN-- 90

Query: 75  CFKGLCPNLKTRCQLSKEAVRLMEAIVKVREAGRFDNISYSIIPEDNLLMPNKDYEAFES 134
            +K L   +KT     ++   +    ++ R+    DN    +  + N+           S
Sbjct: 91  -YKFLMSPIKTEQ---RQPSMMTRMYIEQRDRLYNDN---QVFAKYNV-----------S 132

Query: 135 RMSILNEITDALKNGDVNT-LGIYGIGGIGKTTLAKEVARRAENDKLFDQVVF----SEV 189
           R+    ++  AL        + I G+ G GKT +A +V    +     D  +F       
Sbjct: 133 RLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNC 192

Query: 190 SESQDIRKIQREIADKLGLKFDEESESGRARRLH-----DRL------KKEKRILVILDN 238
           +  + + ++ +++  ++   +   S+     +L        L      K  +  L++L N
Sbjct: 193 NSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN 252

Query: 239 IWGNLDLKAAGIPHGDDHRGCKVLLTAR------SLDTLSTKMDSQKNFSVSFLKEEEAW 292
           +       A  +        CK+LLT R       L   +T   S  + S++    +E  
Sbjct: 253 VQNAKAWNAFNL-------SCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLT-PDEVK 304

Query: 293 SLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFD-WKD-ALEQLR 350
           SL  K         +L              P  +  +A ++RD  + +D WK    ++L 
Sbjct: 305 SLLLKYLD--CRPQDLPREV------LTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLT 356

Query: 351 RPSSTNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLIGYTAIASIDDLLMYGMGMGYFKK 410
                            I+ S + L   E +                          F +
Sbjct: 357 T---------------IIESSLNVLEPAEYRK------------------------MFDR 377

Query: 411 KGLFSMHDVVRDVAISIASTEQNVFSATEEQVRVINVSYMNLLSLPSSLGLLSNLQTLSL 470
             +F          I                              P+          LSL
Sbjct: 378 LSVFP-----PSAHI------------------------------PT--------ILLSL 394

Query: 471 YNCKLLDITVIRDLKKLEVLCLRGSDIKRLPVEVGELTLLRLLDLRDCRELEIIPPNVLS 530
               ++   V+  + KL    L     K   + +  + L   + L +   L         
Sbjct: 395 IWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYAL--------- 445

Query: 531 KLSH--LEELYMGPRSFDKWEVEVEGVKNASLHELK-HLISLELQIQDVNTLPRGLFLEK 587
              H  + + Y  P++FD  ++    +       +  HL ++E   + +      +FL+ 
Sbjct: 446 ---HRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIE-HPERMTLFRM-VFLD- 499

Query: 588 LERYKILIGGVWGWEYADIWCREFKIDLDSKIRLKDGLILKLQGIEDLWLSDLE------ 641
                      + +             L+ KIR           I +  L  L+      
Sbjct: 500 -----------FRF-------------LEQKIRHDSTAWNASGSILNT-LQQLKFYKPYI 534

Query: 642 -------ERDVNYFVNELDKVGPSQLKHLYIRGSHLTLNPAESKV 679
                  ER VN  ++ L K+  + +   Y     + L   +  +
Sbjct: 535 CDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAEDEAI 579
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Length = 350 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query679
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.86
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.83
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.8
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.78
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.78
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.75
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.57
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.57
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2fna_A357 Conserved hypothetical protein; structural genomic 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.45
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.31
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.3
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.29
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.28
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.22
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.17
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.1
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.05
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 98.98
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.96
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.94
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.91
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.81
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.81
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.75
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.73
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.63
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.57
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.49
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.48
3bos_A242 Putative DNA replication factor; P-loop containing 98.48
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.48
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.44
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.43
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.4
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3pvs_A447 Replication-associated recombination protein A; ma 98.39
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.37
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.37
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.36
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.34
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.33
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.33
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.3
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.29
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.27
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.26
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.24
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.2
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.16
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.15
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.14
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.07
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.06
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.03
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.99
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.99
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.92
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.88
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.84
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.83
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.78
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.75
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.75
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.75
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.7
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.69
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.62
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.57
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.54
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.53
3co5_A143 Putative two-component system transcriptional RES 97.42
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.36
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.35
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.33
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.31
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.21
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.15
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.1
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.08
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.06
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.03
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.99
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.91
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.91
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.84
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.82
3io5_A333 Recombination and repair protein; storage dimer, i 96.79
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.78
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.71
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.68
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.67
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.66
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.62
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.61
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.59
2z43_A324 DNA repair and recombination protein RADA; archaea 96.55
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.53
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.5
2qgz_A308 Helicase loader, putative primosome component; str 96.48
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.47
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.39
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.29
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.27
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.23
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.22
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.22
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.02
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.93
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.89
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.87
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.72
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.7
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.69
3ice_A422 Transcription termination factor RHO; transcriptio 95.51
3fwy_A314 Light-independent protochlorophyllide reductase I 95.47
2r44_A331 Uncharacterized protein; putative ATPase, structur 95.4
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.39
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.32
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.32
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.28
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.25
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.24
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.17
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.16
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.15
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.07
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.04
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.03
2xxa_A433 Signal recognition particle protein; protein trans 95.02
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.97
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 94.88
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 94.87
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.85
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.85
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.84
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.84
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 94.82
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.81
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.81
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.79
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 94.79
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 94.73
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.7
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.7
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.69
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.66
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.64
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.6
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.58
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.57
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.52
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.49
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.44
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.43
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.42
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.4
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.4
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.39
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.38
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.37
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.36
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.34
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.33
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.33
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.32
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.32
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.27
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.25
1via_A175 Shikimate kinase; structural genomics, transferase 94.24
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.24
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.22
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.22
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.21
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.15
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.14
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.13
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.12
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.1
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.08
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.06
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.05
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.05
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.02
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.02
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.99
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.94
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.89
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.88
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.85
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.85
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.81
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.78
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.77
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.77
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.72
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.69
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.66
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.66
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.64
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.64
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.6
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 93.6
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.55
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.53
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.52
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.52
3end_A307 Light-independent protochlorophyllide reductase ir 93.48
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.48
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.46
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.44
3l0o_A427 Transcription termination factor RHO; helicase, RH 93.44
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.41
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.38
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 93.38
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.36
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.34
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.33
1tue_A212 Replication protein E1; helicase, replication, E1E 93.33
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 93.32
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.31
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.3
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.27
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.21
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.2
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.18
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.17
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.17
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.14
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.1
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.05
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.99
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.99
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.92
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 92.91
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 92.88
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 92.86
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 92.82
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 92.78
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.76
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.74
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 92.73
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 92.69
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 92.68
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.68
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.67
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 92.67
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.63
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.62
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 92.61
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.61
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.6
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.58
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.54
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 92.53
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.51
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 92.46
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 92.45
2r6a_A454 DNAB helicase, replicative helicase; replication, 92.44
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.43
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 92.36
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.32
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 92.29
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 92.29
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.22
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 92.21
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 92.14
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.1
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.09
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.07
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.97
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 91.96
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 91.94
1ji0_A240 ABC transporter; ATP binding protein, structural g 91.94
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 91.94
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 91.93
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 91.93
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 91.91
1g6h_A257 High-affinity branched-chain amino acid transport 91.88
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 91.87
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 91.85
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.84
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.82
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 91.82
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 91.81
2og2_A359 Putative signal recognition particle receptor; nuc 91.8
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.79
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 91.78
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 91.78
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 91.75
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 91.75
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 91.72
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 91.69
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 91.66
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 91.62
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 91.6
2ghi_A260 Transport protein; multidrug resistance protein, M 91.56
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 91.51
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 91.48
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 91.43
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 91.43
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.42
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 91.41
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.41
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 91.34
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 91.3
2wji_A165 Ferrous iron transport protein B homolog; membrane 91.29
2ged_A193 SR-beta, signal recognition particle receptor beta 91.29
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 91.26
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 91.25
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 91.24
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 91.22
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 91.22
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.18
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 91.09
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.08
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 91.03
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 90.98
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 90.9
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 90.85
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 90.85
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 90.83
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 90.79
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 90.79
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.67
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 90.63
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 90.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 90.56
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 90.54
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 90.53
3cwq_A209 Para family chromosome partitioning protein; alpha 90.5
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 90.48
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 90.48
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 90.46
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 90.45
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 90.43
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 90.38
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 90.37
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 90.33
3vr4_A600 V-type sodium ATPase catalytic subunit A; V-ATPase 90.31
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 90.27
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 90.25
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 90.22
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 90.2
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.13
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=9e-42  Score=376.47  Aligned_cols=282  Identities=13%  Similarity=0.126  Sum_probs=218.5

Q ss_pred             cchHHHHHHHHHHhcCC---CccEEEEEcCCCCcHHHHHHHHHH--HhccCCCCCeEEEEEcCCCc--CHHHHHHHHHHH
Q 005747          133 ESRMSILNEITDALKNG---DVNTLGIYGIGGIGKTTLAKEVAR--RAENDKLFDQVVFSEVSESQ--DIRKIQREIADK  205 (679)
Q Consensus       133 ~gr~~~~~~l~~~L~~~---~~~vi~I~G~gGiGKTtLa~~v~~--~~~~~~~F~~~~wv~v~~~~--~~~~l~~~i~~~  205 (679)
                      +||++++++|.++|..+   +.++|+|+||||+||||||+++|+  +...+.+|++++||++++.+  +..+++..|+++
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~  210 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM  210 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence            49999999999999743   689999999999999999999998  56777889999999999985  899999999999


Q ss_pred             hCCCCC--c------cchhHHHHHHHHHHHcCCceEEEEecCCCccchhhcCCCCCCCCCCcEEEEeecCcchhcccCC-
Q 005747          206 LGLKFD--E------ESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMD-  276 (679)
Q Consensus       206 l~~~~~--~------~~~~~~~~~l~~~l~~~k~~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTtR~~~v~~~~~~-  276 (679)
                      ++....  .      .+.......+.+.+..+|||||||||||+..++ .+.     ..+||+||||||++.++.. ++ 
T Consensus       211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~-----~~~gs~ilvTTR~~~v~~~-~~~  283 (549)
T 2a5y_B          211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWA-----QELRLRCLVTTRDVEISNA-ASQ  283 (549)
T ss_dssp             HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHH-----HHTTCEEEEEESBGGGGGG-CCS
T ss_pred             HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-ccc-----ccCCCEEEEEcCCHHHHHH-cCC
Confidence            986522  1      111223556666666334999999999998754 111     1279999999999998753 43 


Q ss_pred             CcceEEecCCChHHHHHHHHHHhCCCCCCccHHHHHHHHHHHcCCChHHHHHHHHHhhcCCChhHHHHHHHHhcCCCCCC
Q 005747          277 SQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTN  356 (679)
Q Consensus       277 ~~~~~~l~~L~~~e~~~Lf~~~~~~~~~~~~~~~~~~~I~~~~~glPlai~~~~~~L~~~~~~~~w~~~l~~l~~~~~~~  356 (679)
                      ....|++++|++++||+||.+.++.....+.+++++++|+++|+|+|||++++|+.|+. +. .+|...+.......   
T Consensus       284 ~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~-~~-w~~~~~l~~~l~~~---  358 (549)
T 2a5y_B          284 TCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KT-FEKMAQLNNKLESR---  358 (549)
T ss_dssp             CEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SS-HHHHHHHHHHHHHH---
T ss_pred             CCeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhcc-ch-HHHHHHhHHHhhcc---
Confidence            44689999999999999999999865545778899999999999999999999999986 32 33333332211000   


Q ss_pred             cCCchhhHHHHHHhhhcCCChhHHHHHHH-----------Hhccccc-CChhHHHHhhhcc--ccccc------------
Q 005747          357 LMNVQPTAYKAIKLSYDKLAGEELKNIFL-----------LIGYTAI-ASIDDLLMYGMGM--GYFKK------------  410 (679)
Q Consensus       357 ~~~~~~~~~~~l~~sy~~L~~~~lk~cfl-----------~~s~fp~-~~~~~li~~w~~~--g~~~~------------  410 (679)
                         ....+.+++.+||+.||++ +|.||+           |||+||+ ...+  ++.|+++  ||+..            
T Consensus       359 ---~~~~i~~~l~~Sy~~L~~~-lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~  432 (549)
T 2a5y_B          359 ---GLVGVECITPYSYKSLAMA-LQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVAD  432 (549)
T ss_dssp             ---CSSTTCCCSSSSSSSHHHH-HHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHH
T ss_pred             ---cHHHHHHHHhcccccccHH-HHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHH
Confidence               0234678899999999988 999999           9999996 4444  7899999  77632            


Q ss_pred             ------------------CCcEEeehhHHHHHHHHhhccc
Q 005747          411 ------------------KGLFSMHDVVRDVAISIASTEQ  432 (679)
Q Consensus       411 ------------------~~~~~mHdlv~~~~~~~~~~~~  432 (679)
                                        ..+|+|||++|++|++++..++
T Consensus       433 ~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          433 RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence                              2369999999999999887654
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 679
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-30
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  118 bits (297), Expect = 2e-30
 Identities = 33/266 (12%), Positives = 86/266 (32%), Gaps = 32/266 (12%)

Query: 135 RMSILNEITDALKNG---DVNTLGIYGIGGIGKTTLAKEVARRAEN--DKLFDQVVFSEV 189
           R   ++ +   L      D   L ++G  G GK+ +A +   +++      +D +V+ + 
Sbjct: 25  REYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKD 84

Query: 190 SESQDIRKIQREIADKLGLKFDEESES-----------GRARRLHDRLKKEKRILVILDN 238
           S +             L LK +++  +            +    +  +      L + D+
Sbjct: 85  SGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALID-RPNTLFVFDD 143

Query: 239 IWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLSTKMDSQKNFSVSFLKEEEAWSLFKKM 298
           +     ++             + L+T R ++  +    + +   V+ L+ +E +   +  
Sbjct: 144 VVQEETIRW------AQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAY 197

Query: 299 AGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPSSTNLM 358
                 G + ++V     +  +G P  ++    +     +         +L       + 
Sbjct: 198 GMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE-PKTFEKMAQLNNKLESRGLVGVE 256

Query: 359 NVQPTAYKAIKLSYDKLAGEELKNIF 384
            +          SY  LA   L+   
Sbjct: 257 CI-------TPYSYKSLA-MALQRCV 274
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query679
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.23
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.23
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.18
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.97
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.92
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.9
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.89
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.83
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.79
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.79
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.71
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.66
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.66
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.6
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.49
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.46
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.45
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.45
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.44
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.37
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.37
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.34
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.09
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.01
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.55
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.47
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.0
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.86
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.76
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.69
d1okkd2207 GTPase domain of the signal recognition particle r 96.63
d2qy9a2211 GTPase domain of the signal recognition particle r 96.62
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.56
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.56
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.55
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.52
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.52
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.49
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.49
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.4
d1vmaa2213 GTPase domain of the signal recognition particle r 96.31
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.31
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.31
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.29
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.26
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.2
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.15
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.12
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.11
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.09
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.06
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.95
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.89
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.87
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.86
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.83
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.82
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.8
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 95.79
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.77
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 95.74
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.72
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.68
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.63
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.52
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.41
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.38
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.26
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.26
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.22
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.21
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.2
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 95.16
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.07
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 95.02
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.97
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.97
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.95
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.93
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.79
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.73
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.73
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.64
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.59
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.47
d1xpua3289 Transcription termination factor Rho, ATPase domai 94.45
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.44
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.41
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.4
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.24
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.2
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.17
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.07
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 94.02
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.92
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.74
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.7
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.61
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.56
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.41
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 93.4
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.21
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 93.19
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.07
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.0
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.94
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.85
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.84
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.84
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.77
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.66
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.65
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.56
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.45
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.44
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 92.42
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.42
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.34
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.31
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.26
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.22
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.21
d1svma_362 Papillomavirus large T antigen helicase domain {Si 92.08
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.08
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.0
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.8
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.71
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.69
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.65
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 91.64
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.54
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.46
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.35
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.33
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.32
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.31
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.3
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.2
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.18
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.17
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 91.09
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.99
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 90.92
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.92
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.88
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.87
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.83
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.81
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.78
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.73
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.72
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.66
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.63
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.56
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.51
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.48
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.48
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.47
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.43
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.38
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.34
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.31
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.28
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.24
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.21
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 90.13
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.13
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.13
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 90.09
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.05
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.01
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.95
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 89.94
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.9
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.85
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.84
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.83
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.82
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.76
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.74
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.74
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 89.71
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.59
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.54
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 89.52
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.47
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.33
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.31
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.28
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.25
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.08
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.05
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.97
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.92
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.87
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 88.85
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.77
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.75
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.71
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.65
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.53
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.38
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.27
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.23
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.97
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.94
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.77
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 87.72
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.46
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.23
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.04
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.03
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.79
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.67
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.2
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.14
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.65
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.39
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 85.37
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 84.45
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.88
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 83.77
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 83.45
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 82.98
d1tuea_205 Replication protein E1 helicase domain {Human papi 81.49
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 80.4
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=3e-40  Score=327.99  Aligned_cols=244  Identities=14%  Similarity=0.135  Sum_probs=193.4

Q ss_pred             cccccchHHHHHHHHHHhc---CCCccEEEEEcCCCCcHHHHHHHHHHHhc--cCCCCCeEEEEEcCCCcCHHHHHHHHH
Q 005747          129 YEAFESRMSILNEITDALK---NGDVNTLGIYGIGGIGKTTLAKEVARRAE--NDKLFDQVVFSEVSESQDIRKIQREIA  203 (679)
Q Consensus       129 ~~~~~gr~~~~~~l~~~L~---~~~~~vi~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~wv~v~~~~~~~~l~~~i~  203 (679)
                      ...++||+.++++|+++|.   +.+.++|+|+||||+||||||+++|++..  .+.+|++++||++++.++...+...+.
T Consensus        19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~   98 (277)
T d2a5yb3          19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD   98 (277)
T ss_dssp             CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred             CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHH
Confidence            3456799999999999985   45678999999999999999999999855  567899999999999998877776664


Q ss_pred             HHh---CCCCCc-------cchhHHHHHHHHHHHcCCceEEEEecCCCccchhhcCCCCCCCCCCcEEEEeecCcchhcc
Q 005747          204 DKL---GLKFDE-------ESESGRARRLHDRLKKEKRILVILDNIWGNLDLKAAGIPHGDDHRGCKVLLTARSLDTLST  273 (679)
Q Consensus       204 ~~l---~~~~~~-------~~~~~~~~~l~~~l~~~k~~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iivTtR~~~v~~~  273 (679)
                      ..+   +.....       .........+......++++|+||||||+..+|..+.      ..|||||||||++.++..
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~  172 (277)
T d2a5yb3          99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNA  172 (277)
T ss_dssp             HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGG
T ss_pred             HHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHh
Confidence            433   322111       1111222223334445789999999999998887543      348999999999999764


Q ss_pred             cCCCcceEEecCCChHHHHHHHHHHhCCCCCCccHHHHHHHHHHHcCCChHHHHHHHHHhhcCCChhHHHHHHHHhcCCC
Q 005747          274 KMDSQKNFSVSFLKEEEAWSLFKKMAGDYVEGNELKEVARDVAKECAGLPVAIVTVATALRDNNSLFDWKDALEQLRRPS  353 (679)
Q Consensus       274 ~~~~~~~~~l~~L~~~e~~~Lf~~~~~~~~~~~~~~~~~~~I~~~~~glPlai~~~~~~L~~~~~~~~w~~~l~~l~~~~  353 (679)
                      .....+.|++++|+.+|||+||.+.++.....+..++++++|+++|+|+|||++++|+.|+. ++.++|....+.+....
T Consensus       173 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~-k~~~~~~~~~~~L~~~~  251 (277)
T d2a5yb3         173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMAQLNNKLESRG  251 (277)
T ss_dssp             CCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SSHHHHHHHHHHHHHHC
T ss_pred             cCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhcc-CCHHHHHHHHHHHhcCc
Confidence            44455789999999999999999999876666677899999999999999999999999987 78899999888875432


Q ss_pred             CCCcCCchhhHHHHHHhhhcCCChhHHHHHHHHh
Q 005747          354 STNLMNVQPTAYKAIKLSYDKLAGEELKNIFLLI  387 (679)
Q Consensus       354 ~~~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl~~  387 (679)
                             ...+.+++.+||+.||++ +|.||.++
T Consensus       252 -------~~~v~~il~~sY~~L~~~-lk~c~~~l  277 (277)
T d2a5yb3         252 -------LVGVECITPYSYKSLAMA-LQRCVEVL  277 (277)
T ss_dssp             -------SSTTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred             -------HHHHHHHHHHHHhcccHH-HHHHHHhC
Confidence                   244688899999999998 99999763
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure