Citrus Sinensis ID: 005794


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------
MASYRPFPQPPQSSFPPPPPPNQNPSQPPPPPQQQQQQQRPNPYSQNWGGYSNTGGGAQQHYHQPYSYAQPPPPPPPESSYPPPPPPPPPPPPTQQQTQPSMYYSSNQYNQNSMYPPMQPPLPPPPPSSPPPSSSIPPPPPPGSPPPPPPKDVEGRDTGTSDRDKRASKEVSRHDPGHSKQHRPPVPPPGVKKVNGGSGRVETEEERRIRKKREYEKHRQEEKHRLQMKESQNVVMQKSQMVASGKGGHGSMVGSRMGDRRAAPLLSGERTENRLKKPTTFLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLSVYNPPSVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSMESARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYVATGSDSANPEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYVPLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRANVTAIELKEQGAYSNSKGNSSSSKMGRVDSQEDLERSHNGSRQQDPYQSSGAEDDMYD
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccccccccEEEEEcccccccHHHHHcccHHHHcHHHHHHHHHHHHHccccccccccEEEcccccccccccccccccccccccEEEEccccccccccccccEEEEEEccccEEEEccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHcccccccccccccccccccHHHHHHHccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHccccccccccccccccccccccEEEEEEEccccccccccccEEccccccccEEEccccHHHHHccccccccccccccEcccccHHcccccccccccHHHHHHHccccccccccccccccccccccccccEEEEEEEEcccccccccccccccHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEEccHHHHHHcccccccccEEEEEEEEcEcEcccccccccEEEEEEcccEEEEEccccEEEEEEEEcccccccccccccccccEEEEEEccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc
masyrpfpqppqssfppppppnqnpsqpppppqqqqqqqrpnpysqnwggysntgggaqqhyhqpysyaqpppppppessypppppppppppptqqqtqpsmyyssnqynqnsmyppmqpplpppppsspppsssippppppgsppppppkdvegrdtgtsdrdkraskevsrhdpghskqhrppvpppgvkkvnggsgrvetEEERRIRKKREYEKHRQEEKHRLQMKESQNVVMQKSqmvasgkgghgsmvgsrmgdrraapllsgertenrlkkpttfLCKLkfrnelpepsaqpkLMALKKDKDRFTRYTFSSLeknykpqlhvepdlgipldlldlsvynppsvrppldpedeellrddevvtpvkkdgikrkerptdkgvsWLVKTqyisplsmESARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEacklrpihatnknlqpveilpllpdferyddqfvaatfdgaptadseiYSKMDKSVRDAHESRAIMKSYVatgsdsanpEKFLAYMVPsvnelskdmydenedvsfsWVREyhwdvrgddaddpttylvsfdddearyvplptklnlrkkraiegrsndevehfpipssiAVRRRANVTAIELKeqgaysnskgnsssskmgrvdsqedlershngsrqqdpyqssgaeddmyd
masyrpfpqppqSSFPPPPPPNQNPSQPPPPPQQQQQQQRPNPYSQNWGGYSNTGGGAQQHYHQPYSYAQPPPPPPPESSYPPPPPPPPPPPPTQQQTQPSMYYSSNQYNQNSMYPPMQPPLPPPPPSSPPPSSSIPPPPPPGSPPPPPPKDVEGRDTgtsdrdkraskevsrhdpghskqhrppvpppgvkkvnggsgrveteeerrirkkreyekhrqeekhrlqmkesqnvvMQKSQMVASGKGGHGSMVGSRMGDRRAApllsgertenrlkkpttflcklkfrnelpepsaqpklmalkkdkDRFTRYTFSsleknykpqlhVEPDLGIPLDLLDLSVYNPPSVRppldpedeellrddevvtpvkkdgikrkerptdkgvswlVKTQyisplsmesarQSLTEKQAKelremkggrsilenlndRERQIKEIEASFEACKLRpihatnknlqpvEILPLLPDFERYDDQFVAATfdgaptadseiySKMDKSVRDAHESRAIMKSYvatgsdsanpEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDvrgddaddpTTYLVsfdddearyvplptklnlrkkraiegrsndevehfpipssiavrRRANVTAIelkeqgaysnskgnsssskmgRVDSQEDlershngsrqqdpyqssgaeddmyd
MAsyrpfpqppqssfppppppnqnpsqpppppqqqqqqqrpnpysqnWGGYSNTGGGAqqhyhqpysyaqpppppppessypppppppppppptqqqtqpsmyyssNQYNQNSMYppmqpplpppppsspppsssippppppgsppppppKDVEGRDTGTSDRDKRASKEVSRHDPGHSKQHRppvpppgvkkvnggSGrveteeerrirkkreyekhrQEEKHRLQMKESQNVVMQKSQMVASGKGGHGSMVGSRMGDRRAAPLLSGERTENRLKKPTTFLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEpdlgipldlldlSVYNPPSvrppldpedeellrddevvTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSMESARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYVATGSDSANPEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYVPLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRANVTAIELKEQGAYsnskgnsssskMGRVDSQEDLERSHNGSRQQDPYQSSGAEDDMYD
***************************************************************************************************************************************************************************************************************************************************************************************TFLCKLKF**********************FTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLSVY*****************************************VSWLVKTQYI******************************************IEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGA****************************************FLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYVPLPTKLN****************************************************************************************
****************************************************************************************************************************************************************************************************************************************************************************************FLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLSVYNPPSVRPPLDPEDEELLRD***********************SWLVKTQYIS***************************************KEIEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAP****************************************LAYMV*****************SFSWVREYHWDVRG**ADDPTTYLVSFDDDEARYVPLPTKLN*******************IPSSIAVRR************************************************************
*******************************************YSQNWGGYSNTGGGAQQHYHQPY*********************************PSMYYSSNQYNQNSMYPPMQPPL***************************************************************VPPPGV*****************IRKKRE***********LQMKESQNVVMQKS***************SRMGDRRAAPLLSGERTENRLKKPTTFLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLSVYNPPSVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSMESARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYVATGSDSANPEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYVPLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRANVTAIELKEQ************************************************
****RPFPQPPQSSFPPPPPPNQNPSQPPP*********RPNPYSQNWGGYSNTGGGAQQHYHQPYSYAQPPPPPPPESSYPPPPPPPPPPPPTQ**TQPSMYYSSNQYNQNSMYPPMQPPLPPPPPSS***SSSIPPPPPPGS************************************************************************************************************************************KPTTFLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLSVYNPPSVRPPLDPEDEELLRD*********************GVSWLVKTQYISPL**********************GRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTAD********KSVRDAHESRAIMKSYVATGSDSANPEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYVPLPTKLNLRKKRAI**RSNDEVEHFPIPSSIAVRRRAN*********************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASYRPFPQPPQSSFPPPPPPNQNPSQPPPPPQQQQQQQRPNPYSQNWGGYSNTGGGAQQHYHQPYSYAQPPPPPPPESSYPPPPPPPPPPPPTQQQTQPSMYYSSNQYNQNSMYPPMQPPLPPPPPSSPPPSSSIPPPPPPGSPPPPPPKDVEGRDTGTSDRDKRASKEVSRHDPGHSKQHRPPVPPPGVKKVNGGSGRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNVVMQKSQMVASGKGGHGSMVGSRMGDRRAAPLLSGERTENRLKKPTTFLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLSVYNPPSVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSMESARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYVATGSDSANPEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYVPLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRANVTAIELKEQGAYSNSKGNSSSSKMGRVDSQEDLERSHNGSRQQDPYQSSGAEDDMYD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query677 2.2.26 [Sep-21-2011]
Q5RAX0 533 RNA polymerase II-associa yes no 0.432 0.549 0.304 5e-26
Q8N7H5 531 RNA polymerase II-associa yes no 0.432 0.551 0.304 6e-26
Q8K2T8 535 RNA polymerase II-associa yes no 0.432 0.547 0.301 9e-26
Q4V886 535 RNA polymerase II-associa yes no 0.432 0.547 0.301 1e-25
Q2KJ14 532 RNA polymerase II-associa yes no 0.432 0.550 0.301 1e-25
Q4U0S5503 RNA polymerase II-associa yes no 0.426 0.574 0.294 3e-25
Q6P2Y1 520 RNA polymerase II-associa yes no 0.451 0.588 0.284 2e-24
A2BD83 524 RNA polymerase II-associa N/A no 0.431 0.557 0.282 2e-23
P90783425 RNA polymerase II-associa yes no 0.387 0.616 0.258 1e-13
>sp|Q5RAX0|PAF1_PONAB RNA polymerase II-associated factor 1 homolog OS=Pongo abelii GN=PAF1 PE=2 SV=1 Back     alignment and function desciption
 Score =  120 bits (300), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 163/335 (48%), Gaps = 42/335 (12%)

Query: 282 LCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDL 341
           +C++K+ N LP+    PK +    D++RF +Y  +SLEK +K  L  EPDLG+ +DL++ 
Sbjct: 30  VCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQHKHDLLTEPDLGVTIDLINP 89

Query: 342 SVYN-PPSVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSM 400
             Y   P+V   LDP DE+LL ++E+  P      KR ++   K V W+ KT+YIS    
Sbjct: 90  DTYRIDPNV--LLDPADEKLL-EEEIQAPTSS---KRSQQHA-KVVPWMRKTEYIST--- 139

Query: 401 ESARQSLTEKQAKELREMKGGRSILENLN------DRERQIKEIEASFE-ACKLRPIHAT 453
           E  R  ++     E  E+K G S+ +         DR+ QI  IE +FE A K    H +
Sbjct: 140 EFNRYGIS----NEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYS 195

Query: 454 NKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYV 513
              + PVE++P+ PDF+ + +      FD  P       +  D S   A E   +M   +
Sbjct: 196 KPRVTPVEVMPVFPDFKMWINPCAQVIFDSDP-------APKDTSGAAALE---MMSQAM 245

Query: 514 ATGSDSANPEKFLAYMVPSVNELSKDMYDENEDVSFS--------WVREYHWDVRGDDAD 565
             G       +F+AY +P    L K   D+ E++ ++          REY+W+V+   + 
Sbjct: 246 IRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASK 305

Query: 566 --DPTTYLVSFDDDEARYVPLPTKLNLRKKRAIEG 598
             +   + +  + D   Y  L T++ L K+RA  G
Sbjct: 306 GYEENYFFIFREGDGVYYNELETRVRLSKRRAKAG 340




Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Connects PAF1C with the RNF20/40 E3 ubiquitin-protein ligase complex. Involved in polyadenylation of mRNA precursors.
Pongo abelii (taxid: 9601)
>sp|Q8N7H5|PAF1_HUMAN RNA polymerase II-associated factor 1 homolog OS=Homo sapiens GN=PAF1 PE=1 SV=2 Back     alignment and function description
>sp|Q8K2T8|PAF1_MOUSE RNA polymerase II-associated factor 1 homolog OS=Mus musculus GN=Paf1 PE=2 SV=1 Back     alignment and function description
>sp|Q4V886|PAF1_RAT RNA polymerase II-associated factor 1 homolog OS=Rattus norvegicus GN=Paf1 PE=2 SV=1 Back     alignment and function description
>sp|Q2KJ14|PAF1_BOVIN RNA polymerase II-associated factor 1 homolog OS=Bos taurus GN=PAF1 PE=2 SV=1 Back     alignment and function description
>sp|Q4U0S5|PAF1_DANRE RNA polymerase II-associated factor 1 homolog OS=Danio rerio GN=paf1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P2Y1|PAF1_XENTR RNA polymerase II-associated factor 1 homolog OS=Xenopus tropicalis GN=paf1 PE=2 SV=1 Back     alignment and function description
>sp|A2BD83|PAF1_XENLA RNA polymerase II-associated factor 1 homolog OS=Xenopus laevis GN=paf1 PE=2 SV=1 Back     alignment and function description
>sp|P90783|PAF1_CAEEL RNA polymerase II-associated factor 1 homolog OS=Caenorhabditis elegans GN=C55A6.9 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
356522920659 PREDICTED: uncharacterized protein LOC10 0.745 0.766 0.737 0.0
449480786706 PREDICTED: uncharacterized LOC101203806 0.973 0.933 0.616 0.0
449448058706 PREDICTED: uncharacterized protein LOC10 0.973 0.933 0.607 0.0
356526079666 PREDICTED: uncharacterized protein LOC10 0.748 0.761 0.723 0.0
359482895589 PREDICTED: RNA polymerase II-associated 0.846 0.972 0.711 0.0
255549826672 conserved hypothetical protein [Ricinus 0.760 0.766 0.722 0.0
224070975569 PAF1 complex component [Populus trichoca 0.754 0.898 0.711 0.0
297839959576 hypothetical protein ARALYDRAFT_477298 [ 0.726 0.854 0.661 0.0
224054406691 PAF1 complex component [Populus trichoca 0.698 0.684 0.648 0.0
297743192420 unnamed protein product [Vitis vinifera] 0.620 1.0 0.764 0.0
>gi|356522920|ref|XP_003530090.1| PREDICTED: uncharacterized protein LOC100800148 [Glycine max] Back     alignment and taxonomy information
 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/515 (73%), Positives = 436/515 (84%), Gaps = 10/515 (1%)

Query: 166 RASKEVSRHDPGHSKQHR--PPVPPPGVKKVNGGS-GRVETEEERRIRKKREYEKHRQEE 222
           R   E S H   H KQH+  PPVP   VKK+N G  GR ET+EE+R+RKKRE+EK RQEE
Sbjct: 152 RREYEHSNHGIAH-KQHKQQPPVP---VKKMNNGPPGRAETDEEKRLRKKREFEKQRQEE 207

Query: 223 KHRLQMKESQNVVMQKSQMVASGKGGHGSMVGSRMGDRRAAPLLSGERTENRLKKPTTFL 282
           KHR Q+KESQN V+QK+ M++SGKG HG + GSRMG+RR+ PLL  ER ENRLKKPTTFL
Sbjct: 208 KHRQQLKESQNTVLQKTHMLSSGKG-HGMIAGSRMGERRSTPLLGAERVENRLKKPTTFL 266

Query: 283 CKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEPDLGIPLDLLDLS 342
           CKLKFRNELP+PSAQPKLMA KKDKD++ +YT +SLEK YKP+L VEPDLGIPLDLLDLS
Sbjct: 267 CKLKFRNELPDPSAQPKLMASKKDKDQYAKYTITSLEKMYKPKLFVEPDLGIPLDLLDLS 326

Query: 343 VYNPPSVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSMES 402
           VYNPPSVRPPL PED+ELLRDDE VTP+KKDGIKRKERPTDKGV+WLVKTQYISPLSMES
Sbjct: 327 VYNPPSVRPPLAPEDKELLRDDEAVTPIKKDGIKRKERPTDKGVAWLVKTQYISPLSMES 386

Query: 403 ARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQPVEI 462
            +QSLTEKQAKELREMKGGR IL+NLN RERQI+EIEASFEA K  P+HATNK+L PVE+
Sbjct: 387 TKQSLTEKQAKELREMKGGRGILDNLNSRERQIREIEASFEAAKSDPVHATNKDLYPVEV 446

Query: 463 LPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYVATGSDSANP 522
           +PLLPDF+RYDDQFV A FD APTADSE+++KMDKSVRDA ES+A+MKSYVAT SD ANP
Sbjct: 447 MPLLPDFDRYDDQFVVAAFDNAPTADSEMHAKMDKSVRDAFESKAVMKSYVATSSDPANP 506

Query: 523 EKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEARYV 582
           EKFLAYMVP+  ELSKD+YDENEDVS+SW+REYHWDVRGDDADDP T+LV+FD+ EARY+
Sbjct: 507 EKFLAYMVPAPGELSKDIYDENEDVSYSWIREYHWDVRGDDADDPATFLVAFDESEARYL 566

Query: 583 PLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRANVTAIELKEQGAYSNSKGNSSSS 642
           PLPTKL LRKKRA EGRS DEVE  P+P+ + VRRR++V AIE K+ G Y++SKGN  SS
Sbjct: 567 PLPTKLVLRKKRAKEGRSGDEVEQCPVPARVTVRRRSSVAAIERKDSGVYTSSKGN--SS 624

Query: 643 KMGRVDSQEDLERSHNGSRQQDPYQSSGAEDDMYD 677
           K G ++  + LE  H G+  QD YQSSGAED M D
Sbjct: 625 KRGGLEMDDGLEDQHRGAPHQDNYQSSGAEDYMSD 659




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449480786|ref|XP_004155995.1| PREDICTED: uncharacterized LOC101203806 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448058|ref|XP_004141783.1| PREDICTED: uncharacterized protein LOC101203806 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356526079|ref|XP_003531647.1| PREDICTED: uncharacterized protein LOC100797526 [Glycine max] Back     alignment and taxonomy information
>gi|359482895|ref|XP_002278075.2| PREDICTED: RNA polymerase II-associated factor 1 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549826|ref|XP_002515964.1| conserved hypothetical protein [Ricinus communis] gi|223544869|gb|EEF46384.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224070975|ref|XP_002303312.1| PAF1 complex component [Populus trichocarpa] gi|222840744|gb|EEE78291.1| PAF1 complex component [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297839959|ref|XP_002887861.1| hypothetical protein ARALYDRAFT_477298 [Arabidopsis lyrata subsp. lyrata] gi|297333702|gb|EFH64120.1| hypothetical protein ARALYDRAFT_477298 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224054406|ref|XP_002298244.1| PAF1 complex component [Populus trichocarpa] gi|222845502|gb|EEE83049.1| PAF1 complex component [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297743192|emb|CBI36059.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
TAIR|locus:2017879589 ELF7 "AT1G79730" [Arabidopsis 0.645 0.741 0.609 1.3e-145
FB|FBgn0010750 538 atms "antimeros" [Drosophila m 0.478 0.602 0.258 2e-21
ZFIN|ZDB-GENE-050506-101503 paf1 "paf1, RNA polymerase II 0.534 0.719 0.236 2.2e-16
UNIPROTKB|G1K1Z2355 PAF1 "RNA polymerase II-associ 0.434 0.828 0.260 6.1e-16
MGI|MGI:1923988 535 Paf1 "Paf1, RNA polymerase II 0.543 0.687 0.243 7.3e-16
RGD|1306219 535 Paf1 "Paf1, RNA polymerase II 0.543 0.687 0.243 9.4e-16
UNIPROTKB|Q8N7H5 531 PAF1 "RNA polymerase II-associ 0.543 0.693 0.240 2e-15
UNIPROTKB|Q2KJ14 532 PAF1 "RNA polymerase II-associ 0.543 0.691 0.240 3.4e-15
UNIPROTKB|F1SEH0 532 PAF1 "Uncharacterized protein" 0.543 0.691 0.240 3.4e-15
UNIPROTKB|Q5RAX0 533 PAF1 "RNA polymerase II-associ 0.543 0.690 0.240 3.5e-15
TAIR|locus:2017879 ELF7 "AT1G79730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1384 (492.3 bits), Expect = 1.3e-145, Sum P(2) = 1.3e-145
 Identities = 278/456 (60%), Positives = 336/456 (73%)

Query:   220 QEEKHRLQMKESQNVVMQKSQMVASGKGGHGSMVGSRMGDRRAAPLLSGERTENRLKKPT 279
             Q+EKHR QMK S      KSQM      GH         +++  PLL+ +R ENRLKKPT
Sbjct:   149 QDEKHRQQMKNSH-----KSQMPK----GHTE-------EKKPTPLLTTDRVENRLKKPT 192

Query:   280 TFLCKLKFRNELPEPSAQPKLMALKKDKDRFTRYTFSSLEKNYKPQLHVEXXXXXXXXXX 339
             TF+CKLKFRNELP+PSAQ KLM +K+DKD+FT+YT +SLEK +KP++ VE          
Sbjct:   193 TFICKLKFRNELPDPSAQLKLMTIKRDKDQFTKYTITSLEKLWKPKIFVEPDLGIPLDLL 252

Query:   340 XXSVYNPPSXXXXXXXXXXXXXXXXXXXTPVKKDGIKRKERPTDKGVSWLVKTQYISPLS 399
               SVYNPP                    TP+KKDGI+RKERPTDKG+SWLVKTQYIS ++
Sbjct:   253 DLSVYNPPKVKAPLAPEDEELLRDDDAVTPIKKDGIRRKERPTDKGMSWLVKTQYISSIN 312

Query:   400 MESARQSLTEKQAKELREMKGGRSILENLNDRERQIKEIEASFEACKLRPIHATNKNLQP 459
              ESARQSLTEKQAKELREMKGG +IL NLN+RERQIK+IEASFEACK RP+HATNKNLQP
Sbjct:   313 NESARQSLTEKQAKELREMKGGINILHNLNNRERQIKDIEASFEACKSRPVHATNKNLQP 372

Query:   460 VEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVRDAHESRAIMKSYVATGSDS 519
             VE+LPLLP F+RYD+QFV A FDGAP ADSE + K+D S+RDAHESRAI+KSYV  GSD+
Sbjct:   373 VEVLPLLPYFDRYDEQFVVANFDGAPIADSEFFGKLDPSIRDAHESRAILKSYVVAGSDT 432

Query:   520 ANPEKFLAYMVPSVNELSKDMYDENEDVSFSWVREYHWDVRGDDADDPTTYLVSFDDDEA 579
             ANPEKFLAYMVPS++ELSKD++DENE++S++WVREY WDV+  +A+DP TYLVSFD+  A
Sbjct:   433 ANPEKFLAYMVPSLDELSKDIHDENEEISYTWVREYLWDVQ-PNANDPGTYLVSFDNGTA 491

Query:   580 RYVPLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRANVTAIELKEQGAYXXXXXXX 639
              Y+PLP +LNLRKKRA EGRS+DE+EHFP+PS + VRRR+ V+ IE K+ G Y       
Sbjct:   492 SYLPLPMRLNLRKKRAREGRSSDEIEHFPVPSRVTVRRRSTVSVIEHKDSGVYSSRVGAS 551

Query:   640 XXXXMGRVDSQEDLERSHNGSRQQDPYQ-SSGAEDD 674
                 M R++ +  L RS     +QD  Q S G EDD
Sbjct:   552 SSK-MRRLEDEGGLGRSWKHEPEQDANQYSDGNEDD 586


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0009910 "negative regulation of flower development" evidence=IMP
GO:0016571 "histone methylation" evidence=RCA;IMP
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
FB|FBgn0010750 atms "antimeros" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050506-101 paf1 "paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G1K1Z2 PAF1 "RNA polymerase II-associated factor 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1923988 Paf1 "Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306219 Paf1 "Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N7H5 PAF1 "RNA polymerase II-associated factor 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ14 PAF1 "RNA polymerase II-associated factor 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SEH0 PAF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAX0 PAF1 "RNA polymerase II-associated factor 1 homolog" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
pfam03985431 pfam03985, Paf1, Paf1 4e-78
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-15
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-11
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-11
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-10
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-10
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 9e-10
pfam04652315 pfam04652, DUF605, Vta1 like 2e-09
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 4e-09
pfam04652315 pfam04652, DUF605, Vta1 like 5e-09
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 8e-09
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 8e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-08
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 1e-08
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-07
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 1e-07
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 1e-07
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 2e-07
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 2e-07
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-07
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 2e-07
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-07
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-07
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 4e-07
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 4e-07
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 6e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-06
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-06
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 2e-06
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-06
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 3e-06
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 4e-06
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 4e-06
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 5e-06
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 7e-06
pfam06682317 pfam06682, DUF1183, Protein of unknown function (D 7e-06
pfam04652315 pfam04652, DUF605, Vta1 like 8e-06
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 8e-06
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 9e-06
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 9e-06
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 9e-06
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 1e-05
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 1e-05
pfam04487206 pfam04487, CITED, CITED 1e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 1e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 2e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 2e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 2e-05
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 2e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-05
pfam14179110 pfam14179, YppG, YppG-like protein 3e-05
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 4e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 5e-05
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 5e-05
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 6e-05
pfam05044908 pfam05044, Prox1, Homeobox prospero-like protein ( 6e-05
pfam10349111 pfam10349, WWbp, WW-domain ligand protein 6e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 7e-05
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 8e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 8e-05
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 8e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 8e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-05
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 9e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 1e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-04
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 1e-04
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 1e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-04
pfam12273124 pfam12273, RCR, Chitin synthesis regulation, resis 1e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-04
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 2e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
PHA033071352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 2e-04
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 2e-04
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 2e-04
pfam11029136 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP 2e-04
pfam09606768 pfam09606, Med15, ARC105 or Med15 subunit of Media 2e-04
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 4e-04
PHA03369663 PHA03369, PHA03369, capsid maturational protease; 4e-04
PHA033071352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-04
pfam07415489 pfam07415, Herpes_LMP2, Gammaherpesvirus latent me 5e-04
pfam02993238 pfam02993, MCPVI, Minor capsid protein VI 5e-04
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 5e-04
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 6e-04
pfam12273124 pfam12273, RCR, Chitin synthesis regulation, resis 7e-04
pfam04652315 pfam04652, DUF605, Vta1 like 8e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 9e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.001
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 0.001
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.001
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.001
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.001
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
pfam07415489 pfam07415, Herpes_LMP2, Gammaherpesvirus latent me 0.001
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
pfam06682317 pfam06682, DUF1183, Protein of unknown function (D 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.002
pfam11029136 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP 0.002
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 0.002
PRK10856331 PRK10856, PRK10856, cytoskeletal protein RodZ; Pro 0.002
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 0.002
TIGR03354396 TIGR03354, VI_FHA, type VI secretion system FHA do 0.002
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 0.003
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.003
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 0.003
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 0.003
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.003
pfam03251458 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote 0.003
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.003
PRK01741332 PRK01741, PRK01741, cell division protein ZipA; Pr 0.003
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 0.003
pfam12868135 pfam12868, DUF3824, Domain of unknwon function (DU 0.003
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 0.004
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.004
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.004
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 0.004
PHA03294 835 PHA03294, PHA03294, envelope glycoprotein H; Provi 0.004
PTZ00449943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 0.004
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
 Score =  255 bits (653), Expect = 4e-78
 Identities = 122/430 (28%), Positives = 189/430 (43%), Gaps = 62/430 (14%)

Query: 279 TTFLCKLKFRNELPEPSAQPKLMALK-KDKDRFTRYTFSSLEKNYKPQ--LHVEPDLGIP 335
             ++ K+K+ N LP+P   PKL+     D++RF+    +SL +  K    + ++ DLG+P
Sbjct: 1   QDYIAKVKYTNNLPDPPFPPKLITYPFPDENRFSPQLITSLYRKTKVTVLIQLDHDLGMP 60

Query: 336 LDLL--------DLSVYNPPSVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVS 387
           LDLL        D  VY    V   LDPED  LLRD          G  ++ +   K VS
Sbjct: 61  LDLLKIPGLLQGDTKVYYGDDVNVKLDPEDRILLRDP---------GADKRTKTDSKKVS 111

Query: 388 WLVKTQYISPLSMESARQSLTEKQAKELREMKGGRSILENL------NDRERQIKEIEAS 441
           +L +T+YIS    ESAR +    QA EL E K GR++ +NL       DRE QI+ IE +
Sbjct: 112 FLRRTEYIST---ESARFA---VQALELTESKVGRNVKQNLREEDEYLDREAQIEAIEKT 165

Query: 442 FEACKLR-PIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKSVR 500
           FE  K     H + KN++ VE+ PLLPD    D QF    FDG                +
Sbjct: 166 FEDVKKEILKHPSKKNVKAVEVWPLLPDTASMDQQFFQVRFDGDA----------APDGK 215

Query: 501 DAHESRAIMKSYVATGSDSANPEKFLAYMVPS----------VNELSKDM--YDENEDVS 548
           + H       S    G      E+F++Y +P           + + S D+  YDE+E+  
Sbjct: 216 EKHAQLTQASSTAIFGPVELEEEEFVSYYLPDEKDSEILEDTLEKRSDDLHDYDEDEEYK 275

Query: 549 FSWVREYHWDVRG--DDADDPTTYLVSFDDDEARYVPLPTKLNLRKKRAIEGRSNDEVEH 606
           F  VREY   V+      ++   + VS ++    Y PL +++ LR++R         +  
Sbjct: 276 FKRVREYDMKVKSKATKLNELALFFVSDENGVVYYKPLRSRVELRRRR--VNDVIRPLVR 333

Query: 607 FPIPSSIAVRRRANVTAIELKEQGAYSNSKGNSSSSKMGRVDSQEDLERS--HNGSRQQD 664
                 + V+ R N +  E K +             ++   + +E+ +RS  H     +D
Sbjct: 334 EHNNDQLNVKLR-NPSTKESKMRDKRRARLDPIDFEEVDEDEDEEEEQRSDEHEEEEGED 392

Query: 665 PYQSSGAEDD 674
             +      +
Sbjct: 393 SEEEGSQSRE 402


Members of this family are components of the RNA polymerase II associated Paf1 complex. The Paf1 complex functions during the elongation phase of transcription in conjunction with Spt4-Spt5 and Spt16-Pob3i. Length = 431

>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|218108 pfam04487, CITED, CITED Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222579 pfam14179, YppG, YppG-like protein Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|218397 pfam05044, Prox1, Homeobox prospero-like protein (PROX1) Back     alignment and domain information
>gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|221501 pfam12273, RCR, Chitin synthesis regulation, resistance to Congo red Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|220950 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP2) Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein Back     alignment and domain information
>gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|221501 pfam12273, RCR, Chitin synthesis regulation, resistance to Congo red Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|220950 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP2) Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|234178 TIGR03354, VI_FHA, type VI secretion system FHA domain protein Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|217453 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|223035 PHA03294, PHA03294, envelope glycoprotein H; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 677
PF03985436 Paf1: Paf1 ; InterPro: IPR007133 Members of this f 100.0
KOG2478452 consensus Putative RNA polymerase II regulator [Tr 100.0
KOG2478452 consensus Putative RNA polymerase II regulator [Tr 99.46
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.7
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.48
KOG1923830 consensus Rac1 GTPase effector FRL [Signal transdu 97.71
PHA032473151 large tegument protein UL36; Provisional 96.82
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 96.68
KOG1830518 consensus Wiskott Aldrich syndrome proteins [Cytos 95.01
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 87.24
KOG1923830 consensus Rac1 GTPase effector FRL [Signal transdu 86.13
KOG2236483 consensus Uncharacterized conserved protein [Funct 80.73
KOG2236483 consensus Uncharacterized conserved protein [Funct 80.3
>PF03985 Paf1: Paf1 ; InterPro: IPR007133 Members of this family are components of the RNA polymerase II associated Paf1 complex Back     alignment and domain information
Probab=100.00  E-value=1.4e-73  Score=624.41  Aligned_cols=357  Identities=34%  Similarity=0.610  Sum_probs=265.6

Q ss_pred             cccccccccccCCCCCCCCCceeeccC-CccccccCcCcchhhccCCCCcc--CCCCCcccccC--------CccCCCCC
Q 005794          279 TTFLCKLKFRNELPEPSAQPKLMALKK-DKDRFTRYTFSSLEKNYKPQLHV--EPDLGIPLDLL--------DLSVYNPP  347 (677)
Q Consensus       279 ~~fi~~iry~N~LP~pP~~PKLL~~p~-d~~r~t~y~~tSLe~~~k~~i~~--D~DLGmPLDLi--------~~~~Y~~p  347 (677)
                      ++|||+|||+|+||+|||+||||.|++ +..+++.|.++||++++++.|++  |+|||||||||        |.++|+.+
T Consensus         1 qd~i~~iry~N~LP~pp~~pK~L~~p~~~~~~~~~~~~tsL~~~~~~~~l~~~d~dlGmplDLi~~~g~~~~d~~~~~~~   80 (436)
T PF03985_consen    1 QDFICRIRYRNNLPPPPFPPKFLDIPFTDEQRFSPYFATSLEREYKFNILVEVDADLGMPLDLIGIPGVFEGDPSAYNAP   80 (436)
T ss_pred             CceeeeeeecCCCcccCCCCeeecCCCCchhccccchhhhHHHhcCcceecccccccCcccccccccCcccCChhhcCCC
Confidence            689999999999999999999999999 78999999999999999999966  99999999999        77888887


Q ss_pred             CCCCCCChhhhhccCCCCccCcccccCCcccCCCCCCCccCccccccccccchhhhhchhhHHHHHHHHhhhcCCchh--
Q 005794          348 SVRPPLDPEDEELLRDDEVVTPVKKDGIKRKERPTDKGVSWLVKTQYISPLSMESARQSLTEKQAKELREMKGGRSIL--  425 (677)
Q Consensus       348 d~~~~LdPeD~aLLrD~e~~~p~~s~Gi~kksR~~~~~VSWLRRTEYISs~~~~~~~~~~t~kqake~~E~k~G~~~~--  425 (677)
                      ...++|||+|++||+|+.++         ++++.++++|||||||||||++.++.+ .+.      ...+.+.|+.+.  
T Consensus        81 ~~~~~L~p~D~~LL~d~~~~---------~~~~~~~~~VswLRrTeYiS~~~~~~~-~~~------~~~~~~~~~~~~~~  144 (436)
T PF03985_consen   81 PNNPPLDPEDRALLRDPGAL---------KRSKPDAKNVSWLRRTEYISSEFTRKG-QSK------EKSEAKRGRNVKKK  144 (436)
T ss_pred             CCCCCCCHHHHHHhcCcccc---------ccccCCcCCCcccccceeecccccccc-ccc------cchhhccccccccc
Confidence            77889999999999998653         246667789999999999999876543 111      112233443332  


Q ss_pred             ----ccccCHHHHHHHHHhhHHHHhc---CCCCCCCCCCceeEeecCCCCcccccCceEEEEEcCCCCCCchhhcccChh
Q 005794          426 ----ENLNDRERQIKEIEASFEACKL---RPIHATNKNLQPVEILPLLPDFERYDDQFVAATFDGAPTADSEIYSKMDKS  498 (677)
Q Consensus       426 ----~~~~dresQI~aIEkTFeaAkk---~lkHPtKpnLkaVev~PLLPD~d~w~n~Yv~VkFD~dPs~~~e~~~kl~~s  498 (677)
                          +.+.++++||++||+||++|++   .++||||||||||++|||||||++|++.|++|+||++|+.+.....    .
T Consensus       145 ~~~~~~~~d~~~qi~~Ie~tF~~a~~~~~~~~HPtK~~lk~Ve~~PllPD~~~~~~~y~~v~Fd~~P~~~~~~~~----~  220 (436)
T PF03985_consen  145 FKEEELYNDRESQIRAIEKTFEAAKKDLPRLKHPTKPNLKAVEVWPLLPDFDAWPNPYVQVKFDGDPAPDDKEKE----E  220 (436)
T ss_pred             ccccccccCHHHHHHHHHHHHHHHhhccccccCCCCCCCeEEEEecCCCCchhcCCceEEEEECCCCcccccccc----c
Confidence                2368999999999999999987   7999999999999999999999999999999999999986542211    1


Q ss_pred             hhhHHHHHHHHhhhhccCCCCCCcceeEEeecCCcc-------ccccc---c----cCCCCCeecceeeeeeceeccCCC
Q 005794          499 VRDAHESRAIMKSYVATGSDSANPEKFLAYMVPSVN-------ELSKD---M----YDENEDVSFSWVREYHWDVRGDDA  564 (677)
Q Consensus       499 ~r~~~es~Ailk~~~~~~~D~~~~e~flaY~lP~~~-------el~k~---l----~dede~~~Yk~vReYd~~v~~~~~  564 (677)
                      ........+|++++.      .++++||+||||+..       .+.+.   .    +++++.|.|+|||+|+|++++...
T Consensus       221 ~~~~~~~~~i~~p~~------~~~~~fvsy~lP~~~~~~~~~~~l~~~~~d~~~~~~~~~~~~~y~~vReY~~~~~~~~~  294 (436)
T PF03985_consen  221 QEEQALQAAIFRPMD------SEGDQFVSYYLPDKEDAKELKEKLEKNSPDRDEEDDDDDEEYEYKRVREYEWSVQNEAS  294 (436)
T ss_pred             hhHHHHhhhccCCCC------CCCcceeeEEecChhhhhHhHHhhhcccccccccccCCCceeeccceecccceeeccCC
Confidence            112222346777764      356789999999322       12211   1    245577999999999999986442


Q ss_pred             -CCCceEEEE-EcCCceEEecCCCcceecccccccCCCCcccccCCCCceEEEeeccc-hHHHHHhhhcccccCCCCCCC
Q 005794          565 -DDPTTYLVS-FDDDEARYVPLPTKLNLRKKRAIEGRSNDEVEHFPIPSSIAVRRRAN-VTAIELKEQGAYSNSKGNSSS  641 (677)
Q Consensus       565 -~~~~e~~l~-Fddg~AyY~PL~tRi~LRKrRaK~~~~~dei~~f~~ps~Itv~~r~~-~~e~e~~e~~~~~~~~~~~~~  641 (677)
                       .+..+|+|+ +++++||||||.+||+|||||....  ........+.+.|+|++|++ ..|+..++.... ..++..+ 
T Consensus       295 ~~~e~~i~f~~~~~k~ayY~pI~~Rv~LrkrR~~~~--~~~~~~~~~~d~i~V~~R~p~e~E~~~~~~~r~-~~dp~~~-  370 (436)
T PF03985_consen  295 KGYEENIFFVDFKQKAAYYYPIETRVRLRKRRTNSK--IRPKVREQRPDQITVKHRDPTEEEEAERDKRRA-QLDPIEY-  370 (436)
T ss_pred             CCccceEEEEecCCCceEEeeccccceeeeeccccc--cccccccCCCceEEEEeCCCCHHHHHHHHHHHh-hccCCCc-
Confidence             445567777 6689999999999999999993322  22345567789999999975 566655554322 3344432 


Q ss_pred             CcCCCCCccchhhhccCCCCCCCC
Q 005794          642 SKMGRVDSQEDLERSHNGSRQQDP  665 (677)
Q Consensus       642 ~~~~~~~~~~~~~~~~~~~~~~~~  665 (677)
                      ..+.+.+++++.++...+...++.
T Consensus       371 ~~~ee~eeeee~~~e~~~~~~e~~  394 (436)
T PF03985_consen  371 EEEEEEEEEEEEEEEEEEEEEEED  394 (436)
T ss_pred             cccCcccccccccccccccccccc
Confidence            222333333333344444433333



The Paf1 complex functions during the elongation phase of transcription in conjunction with Spt4-Spt5 and Spt16-Pob3i [, ].

>KOG2478 consensus Putative RNA polymerase II regulator [Transcription] Back     alignment and domain information
>KOG2478 consensus Putative RNA polymerase II regulator [Transcription] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2236 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2236 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-21
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-19
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 9e-18
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-13
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 7e-11
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-08
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-08
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-11
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-09
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 8e-10
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-08
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 5e-08
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-07
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-06
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 2e-08
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-08
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 5e-08
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-07
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 5e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-07
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 8e-07
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-06
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-04
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 8e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 6e-06
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 3e-05
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 1e-04
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 2e-04
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 7e-06
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 1e-05
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 2e-04
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 5e-04
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 6e-04
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 2e-05
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 4e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 3e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 6e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 1e-04
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 6e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 8e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 9e-05
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 9e-05
4af8_A367 Metacaspase MCA2; hydrolase, cysteine peptidase, c 1e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 1e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 2e-04
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 3e-04
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 6e-04
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 4e-04
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 6e-04
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-04
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 6e-04
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 9e-04
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
 Score = 97.2 bits (241), Expect = 5e-21
 Identities = 24/144 (16%), Positives = 32/144 (22%)

Query: 5   RPFPQPPQSSFPPPPPPNQNPSQPPPPPQQQQQQQRPNPYSQNWGGYSNTGGGAQQHYHQ 64
           R +PQ          P  Q     PP                  G   + G        Q
Sbjct: 7   RVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQFLTPAQ 66

Query: 65  PYSYAQPPPPPPPESSYPPPPPPPPPPPPTQQQTQPSMYYSSNQYNQNSMYPPMQPPLPP 124
              + Q        +       P   P    Q   P    +  Q  Q  M  P       
Sbjct: 67  EQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPAYGQPSA 126

Query: 125 PPPSSPPPSSSIPPPPPPGSPPPP 148
               +  P + + P       PPP
Sbjct: 127 AMGQNMRPMNQLYPIDLLTELPPP 150


>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>4af8_A Metacaspase MCA2; hydrolase, cysteine peptidase, caspase/hemoglobin fold; 1.40A {Trypanosoma brucei} PDB: 4afp_A 4afv_A 4afr_A Length = 367 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Length = 810 Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Length = 810 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 677
d1jvra_137 a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell 0.002
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.002

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00