Citrus Sinensis ID: 005857

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---

MEGLHSRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCTVLRDEHDNAEIETDTETVFGDGSVSEVVVQNSDSEHNNAETVAEIVNFGGSQEVVENSGSERSTVETVSDIVRTGGNQNTVECSGPDCIGADTIINSHEMPPGDAGFALFEIVSSIPHPKESLYRFWNSHPVSPRRGIVILDNATSRNGRMDQSTADNSTELGARTLRRCRDLQDRIQAIRENWSALQNNSLRFSSIPVESGTKHRKRHNVSEVSQERSGQPCPSTSGTGQHLRSQDGSSCDSHDVGKAWKMMKTAKSMLRKSERASNVCKSSKNLNIKVNASKQAMNTRSSLHDAERQQPGNRSVMSDRRNQNTAMTVESSERLQSTYSTGLAQSPGNGKGNIQNQSNVCNFKGARLMGKSICGGSSSIPNKQGDSSSINLTGPVPGTSYSHIGEHDVLPSSSKIVDPEGKVLAESKARKYDHAKCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSSTVCSHGEHIKKLCKSTLMPDCCRECFYAFVKDVIRSIMFEKVDGTGRIH

ccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccc

ccHHcccccccEccccccccEccccccccEHHHHHHHHHHHHccccccccccEEEEEEEcccccEEEEEEEEccccccEEcccccccccccccccccccEEccccccccEEEEEccccccccHHHcccccccccccccccHHHcccccccccccccccHHHccccccccEEcccccccccccccHHHHccccccccEEEcccccccccccHccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccc

meglhsrscgiclmdegksirgqidscdhYFCFVCIMEWAkieskcpmckrrftsirrppkdgvfprerfvvvpkrdqiyggfgiassrtadpyayVRCNVCQGTTYESLLLLCDlcdtashtycvgmgnavpegdwfchdctvlrdehdnaeietdtetvfgdgSVSEVVVQnsdsehnnAETVAEIVNFGGsqevvensgserstveTVSDIVRtggnqntvecsgpdcigadtiinshemppgdagFALFEIvssiphpkeslyrfwnshpvsprrgivildnatsrngrmdqstadnstELGARTLRRCRDLQDRIQAIRENWSALqnnslrfssipvesgtkhrkrhnvsevsqersgqpcpstsgtgqhlrsqdgsscdshDVGKAWKMMKTAKSMLRkserasnvckssknlniKVNASKQAMNtrsslhdaerqqpgnrsvmsdrrnqntamtVESSERlqstystglaqspgngkgniqnqsnvcnfkgarlmgksicggsssipnkqgdsssinltgpvpgtsyshigehdvlpssskivdpegkvlaeskarkydhakCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILAscglehpksgirfhpsstvcshgehikklckstlmpdccrECFYAFVKDVIRSIMFEkvdgtgrih

meglhsrsCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFtsirrppkdgvfprerfvvvpkrdqiyggfgiassrtadpYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCTVLRDEHDNAEIEtdtetvfgdgSVSEVVVQNSDSEHNNAETVAEIVNFGGSQEVvensgserstveTVSDIvrtggnqntvecsgpDCIGADTIINSHEMPPGDAGFALFEIVSSIPHPKESLYRFWnshpvsprrgIVILDNatsrngrmdqstadnstelgartlRRCRDLQDRIQAIREnwsalqnnslrfssipvesgtkhrkrhnvsevsqersgqpcpstsgtgqhlrsqdgsscdSHDVGKAWKMMKTAKSmlrkserasnvckssknlnikvnasKQAMntrsslhdaerqqpgnrsvmsdrrnqNTAMTVESSERLQSTYSTGLaqspgngkgniQNQSNVCNFKGARLMGKSICGGSssipnkqgdsssINLTGPVPGTSYSHIGEHDVLPSSSKIVDPEGKVLAEskarkydhakceiqslvklnlkclsrDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSSTVCSHGEHIKKLCKSTLMPDCCRECFYAFVKDVIRSIMfekvdgtgrih

********CGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCTVLRDEHDNAEIE***ETVFG************************IV************************IVR****QNTVECSGPDCIGADTIINSHEMPPGDAGFALFEIVSSIPHPKESLYRFWNSHPVSPRRGIVILD***************************CRDLQDRIQAIRENWSAL*******************************************************************************************************************************************************************CNFKGARL**************************************************************KYDHAKCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSSTVCSHGEHIKKLCKSTLMPDCCRECFYAFVKDVIRSIMFEKV*******

*****SRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCT****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************DAFKKVAKLATHTIL*************************************DCCRECFYAFVKDVIRSIMF***D******

MEGLHSRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCTVLRDEHDNAEIETDTETVFGDGSVSEVVVQNSDSEHNNAETVAEIVNFGGSQE**************VSDIVRTGGNQNTVECSGPDCIGADTIINSHEMPPGDAGFALFEIVSSIPHPKESLYRFWNSHPVSPRRGIVILDNATSRNGRMDQSTADNSTELGARTLRRCRDLQDRIQAIRENWSALQNNSLRFSSIP**********************************************DVGKAWKMMKTA**************KSSKNLNIKVNASKQ***********************DRRNQNTAMTVESSERLQSTYSTGLAQSPGNGKGNIQNQSNVCNFKGARLMGKSICGGSSSIPNKQGDSSSINLTGPVPGTSYSHIGEHDVLPSSSKIVDPEGKVLAESKARKYDHAKCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSSTVCSHGEHIKKLCKSTLMPDCCRECFYAFVKDVIRSIMFEKVDGTGRIH

*****SRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGF*IASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCTVL*************************************E************E**********TVETVSDIVRTGGNQNTVECSGPDCIGADTIINSHEMPPGDAGFALFEIVSSIPHP************************************************RRCRDLQDRIQAIRENWSALQNNSLRF*******************************************************W*******************************************************************************************************K*********************************************************************HAKCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSSTVCSHGEHIKKLCKSTLMPDCCRECFYAFVKDVIRSIMFEKVD******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEGLHSRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMGNAVPEGDWFCHDCTVLRDEHDNAEIETDTETVFGDGSVSEVVVQNSDSEHNNAETVAEIVNFGGSQEVVENSGSERSTVETVSDIVRTGGNQNTVECSGPDCIGADTIINSHEMPPGDAGFALFEIVSSIPHPKESLYRFWNSHPVSPRRGIVILDNATSRNGRMDQSTADNSTELGARTLRRxxxxxxxxxxxxxxxxxxxxxSLRFSSIPVESGTKHRKRHNVSEVSQERSGQPCPSTSGTGQHLRSQDGSSCDSHDVGKAWKMMKTAKSMLRKSERASNVCKSSKNLNIKVNASKQAMNTRSSLHDAERQQPGNRSVMSDRRNQNTAMTVESSERLQSTYSTGLAQSPGNGKGNIQNQSNVCNFKGARLMGKSICGGSSSIPNKQGDSSSINLTGPVPGTSYSHIGEHDVLPSSSKIVDPEGKVLAESKARKYDHAKCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSSTVCSHGEHIKKLCKSTLMPDCCRECFYAFVKDVIRSIMFEKVDGTGRIH

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		673	2.2.26 [Sep-21-2011]
A6H619		1682	PHD and RING finger domai	yes	no	0.202	0.080	0.305	7e-12
Q63625		1685	PHD and RING finger domai	yes	no	0.202	0.080	0.299	1e-10
Q9P1Y6		1649	PHD and RING finger domai	yes	no	0.185	0.075	0.323	1e-10
O94400		571	PHD and RING finger domai	yes	no	0.156	0.183	0.302	2e-10
B7ZS37		1698	Bromodomain adjacent to z	N/A	no	0.080	0.031	0.472	7e-07
Q9UIF8		2168	Bromodomain adjacent to z	no	no	0.068	0.021	0.489	3e-06
Q9DE13		2130	Bromodomain adjacent to z	yes	no	0.068	0.021	0.489	3e-06
O88379		1555	Bromodomain adjacent to z	no	no	0.068	0.029	0.468	5e-06
Q9NS56		1045	E3 ubiquitin-protein liga	no	no	0.123	0.079	0.320	6e-06
Q9NRL2		1556	Bromodomain adjacent to z	no	no	0.068	0.029	0.468	6e-06

>sp\|A6H619\|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2	Back alignment and function desciption

 Score = 73.2 bits (178), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 69/154 (44%), Gaps = 18/154 (11%)

Query: 6   SRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVF 65
           + SC ICL        G  ++C HYFC  CI+EW++  + CP+ +  F  I         
Sbjct: 106 AESCPICLNAFRDQAVGTPETCAHYFCLDCIIEWSRNANSCPVDRTVFKCI--------C 157

Query: 66  PRERFVVVPKRDQIYGGFGIASSRT--ADPYAYVRCNVCQGTTYESLLLLCDLCDTASHT 123
            R +F       +I     + +++   A+      C VC  +  E  LLLCD CD   H 
Sbjct: 158 IRAQF-----NGKILKKIPVENTKACEAEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHM 212

Query: 124 YCVGMG-NAVPEGDWFCHDCTV--LRDEHDNAEI 154
            C+      VP  +WFC +CTV  +   HD A +
Sbjct: 213 ECLDPPLQEVPVDEWFCPECTVPGVDPTHDAAPV 246

Mus musculus (taxid: 10090)

>sp\|Q63625\|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2	Back alignment and function description

>sp\|Q9P1Y6\|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3	Back alignment and function description

>sp\|O94400\|YQF7_SCHPO PHD and RING finger domain-containing protein C126.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.07c PE=4 SV=1	Back alignment and function description

>sp\|B7ZS37\|BAZ2A_XENLA Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis GN=baz2a PE=2 SV=1	Back alignment and function description

>sp\|Q9UIF8\|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3	Back alignment and function description

>sp\|Q9DE13\|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1	Back alignment and function description

>sp\|O88379\|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3	Back alignment and function description

>sp\|Q9NS56\|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens GN=TOPORS PE=1 SV=1	Back alignment and function description

>sp\|Q9NRL2\|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		673
255547077		632	splicing factor, arginine/serine-rich 2,	0.805	0.857	0.393	2e-84
225455732		648	PREDICTED: uncharacterized protein LOC10	0.233	0.242	0.652	9e-62
449439671		375	PREDICTED: uncharacterized protein LOC10	0.466	0.837	0.364	9e-58
449529742		398	PREDICTED: uncharacterized protein LOC10	0.457	0.773	0.362	1e-57
115467592		763	Os06g0283200 [Oryza sativa Japonica Grou	0.508	0.448	0.344	2e-53
218197976		1223	hypothetical protein OsI_22555 [Oryza sa	0.508	0.279	0.346	7e-53
222635399		1288	hypothetical protein OsJ_20986 [Oryza sa	0.508	0.265	0.346	1e-52
226507234		733	PHD-finger family protein [Zea mays] gi\|	0.887	0.814	0.293	2e-51
193848531		748	PHD finger family [Brachypodium distachy	0.539	0.485	0.339	3e-45
326519945		948	predicted protein [Hordeum vulgare subsp	0.548	0.389	0.349	3e-45

>gi\|255547077\|ref\|XP_002514596.1\| splicing factor, arginine/serine-rich 2,rnap interacting protein, putative [Ricinus communis] gi\|223546200\|gb\|EEF47702.1\| splicing factor, arginine/serine-rich 2,rnap interacting protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  319 bits (818), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 259/658 (39%), Positives = 343/658 (52%), Gaps = 116/658 (17%)

Query: 9   CGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRE 68
           CGICL +   ++RGQIDSCDHYFCF+CIMEWAKIES+CPMCKRRF +I RPPKDGVFP E
Sbjct: 48  CGICLSENWSAMRGQIDSCDHYFCFICIMEWAKIESRCPMCKRRFNNIHRPPKDGVFPSE 107

Query: 69  RFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGM 128
           R V VPKRDQ+Y  FG  +    DPYA V+C++C     ESLLLLCDLCD+A+HTYCVG+
Sbjct: 108 RLVNVPKRDQVYHLFGNTTVEPFDPYAQVQCSICHTAEDESLLLLCDLCDSAAHTYCVGL 167

Query: 129 GNAVPEGDWFCHDCTVLRDEHDNAEIETDTETVFGDGSV-SEVVVQNSDSEHNNAETVAE 187
           G  VPE DWFCHDC V R EH+N   + D + +    SV SEVV+        N++  +E
Sbjct: 168 GFTVPECDWFCHDCAVSRTEHEN--FQKDEDNITQTLSVKSEVVLAAEPYVAVNSQNTSE 225

Query: 188 IVNFGGSQEVVENSGSERSTVETVSDIVRTGGNQNTVECSGPDCIGADTIINSHEMPPGD 247
             N+        N+G+E       SD      NQ+         IG     +S    P +
Sbjct: 226 --NY--------NAGAENGANFCQSD------NQS---------IGRPRARSSQVPSPSE 260

Query: 248 AGFALFEIVSSIPHPKESLYRFWNSHPVSPRRGIVILDNATSRNGRMDQSTADNSTELGA 307
               L  +   +  P+E+                      T+R G   ++   ++     
Sbjct: 261 ---RLSNLADDMSQPRET----------------------TTRTGPGQETPQSDA----- 290

Query: 308 RTLRRCRDLQDRIQAIRENWSALQNNSLRFSSIPVESGTKHRKRHNVSEVSQERSGQPCP 367
           RTLRRCRD+   ++A+RENW AL++ SLRFSS  VES ++   +     V+ E SGQ   
Sbjct: 291 RTLRRCRDVHSYVRALRENWDALRSGSLRFSSSSVESCSRSIAKCYTPVVTHESSGQSHT 350

Query: 368 STSGTGQHLRSQDG------SSCDSHDVGKAWKMMKTAKSMLRKSERASNVCKSSKNLNI 421
            +S +GQ L   DG          SHD  KAWKMM  AKS          + + SKN + 
Sbjct: 351 MSSTSGQQLTINDGLPGTFAQDRHSHDAKKAWKMMAKAKS----------IHQGSKNPST 400

Query: 422 KVNASKQAMNTRSSLH-----------------------DAERQQPGNRSVMSDRRNQNT 458
           K NAS++A  +  SLH                         ERQ    + V S  + QN 
Sbjct: 401 KGNASRKATGSSCSLHMLRSQFGTSGMVNFTVEKQHKRYSPERQT--EKHVFSKLKMQNH 458

Query: 459 AMT-----VESSERLQSTYSTGLAQSPGNGKGNIQNQSNVCNFKGARLMGKSICGGSSSI 513
            +      V   + L +T  +G + S  + K    +Q+ + N + AR   +++   SS  
Sbjct: 459 GINFSKEIVRPGDNLPTT--SGFSASITSWKVQTSSQT-LENQEPAR--QQNLRRASSKF 513

Query: 514 PNKQ-GDSSSINLTGPVPGTSYSHIGEHDVLPSSS-KIVDPEGKVL-----AESKARKYD 566
            N+Q G    + L GPV GTS S   + D+  S S K+  PEG V       ESK R  D
Sbjct: 514 TNQQIGSGRLMPLVGPVSGTSKSVNTKADISESFSCKVNVPEGDVRLGKGGTESKPRNDD 573

Query: 567 HAKCEIQSLVKLNLKCLSRDKRLEYDAFKKVAKLATHTILASCGLEHPKSGIRFHPSS 624
           +AK EIQSLVKLN+  L   K+L  D FK+VA+LAT+TILA+CG +H +      PSS
Sbjct: 574 NAKSEIQSLVKLNMNLLKGVKQLGVDEFKEVARLATYTILAACGFKHSRHVFHSFPSS 631

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225455732\|ref\|XP_002273302.1\| PREDICTED: uncharacterized protein LOC100266325 [Vitis vinifera] gi\|297734114\|emb\|CBI15361.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449439671\|ref\|XP_004137609.1\| PREDICTED: uncharacterized protein LOC101204928 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449529742\|ref\|XP_004171857.1\| PREDICTED: uncharacterized protein LOC101229274 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|115467592\|ref\|NP_001057395.1\| Os06g0283200 [Oryza sativa Japonica Group] gi\|55297405\|dbj\|BAD69258.1\| 2x PHD domain containing protein-like [Oryza sativa Japonica Group] gi\|113595435\|dbj\|BAF19309.1\| Os06g0283200 [Oryza sativa Japonica Group] gi\|215707203\|dbj\|BAG93663.1\| unnamed protein product [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|218197976\|gb\|EEC80403.1\| hypothetical protein OsI_22555 [Oryza sativa Indica Group]	Back alignment and taxonomy information

>gi\|222635399\|gb\|EEE65531.1\| hypothetical protein OsJ_20986 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|226507234\|ref\|NP_001151466.1\| PHD-finger family protein [Zea mays] gi\|195646974\|gb\|ACG42955.1\| PHD-finger family protein [Zea mays] gi\|413953705\|gb\|AFW86354.1\| PHD-finger family protein [Zea mays]	Back alignment and taxonomy information

>gi\|193848531\|gb\|ACF22720.1\| PHD finger family [Brachypodium distachyon]	Back alignment and taxonomy information

>gi\|326519945\|dbj\|BAK03897.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		673
TAIR\|locus:2078092		883	AT3G05670 "AT3G05670" [Arabido	0.199	0.151	0.489	9.5e-48
ZFIN\|ZDB-GENE-030131-624		1670	phrf1 "PHD and ring finger dom	0.191	0.077	0.316	1.8e-10
UNIPROTKB\|I3LU11		1643	PHRF1 "Uncharacterized protein	0.187	0.076	0.335	2.1e-10
FB\|FBgn0037344		2296	CG2926 [Drosophila melanogaste	0.227	0.066	0.280	1.7e-09
ASPGD\|ASPL0000065135		614	AN7294 [Emericella nidulans (t	0.187	0.205	0.3	3.6e-09
MGI\|MGI:2141847		1682	Phrf1 "PHD and ring finger dom	0.209	0.083	0.316	4e-09
TAIR\|locus:2123446		192	AT4G10940 "AT4G10940" [Arabido	0.086	0.302	0.433	4.3e-09
UNIPROTKB\|E9PJ24		1645	PHRF1 "PHD and RING finger dom	0.184	0.075	0.338	9e-09
UNIPROTKB\|F8WEF5		1647	PHRF1 "PHD and RING finger dom	0.184	0.075	0.338	9e-09
UNIPROTKB\|Q9P1Y6		1649	PHRF1 "PHD and RING finger dom	0.184	0.075	0.338	9.1e-09

TAIR\|locus:2078092 AT3G05670 "AT3G05670" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 398 (145.2 bits), Expect = 9.5e-48, Sum P(3) = 9.5e-48
 Identities = 67/137 (48%), Positives = 92/137 (67%)

Query:     9 CGICLMDEG-KSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKD--GVF 65
             CGICL +E  + ++G +D C HYFCF CIMEW+K+ES+CP+CK+RF +I +P +   GV 
Sbjct:   413 CGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTPGVD 472

Query:    66 PRERFVVVPKRDQIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYC 125
              RE  + VP+RDQ+Y           DPY  + C  C     + L+LLCDLCD+++HTYC
Sbjct:   473 LREVVIPVPERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDLCDSSAHTYC 532

Query:   126 VGMGNAVPEGDWFCHDC 142
             VG+G  VPEG+W+C  C
Sbjct:   533 VGLGREVPEGNWYCEGC 549

GO:0003677 "DNA binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISM

GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS

GO:0008270 "zinc ion binding" evidence=IEA

ZFIN\|ZDB-GENE-030131-624 phrf1 "PHD and ring finger domains 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LU11 PHRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

FB\|FBgn0037344 CG2926 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000065135 AN7294 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

MGI\|MGI:2141847 Phrf1 "PHD and ring finger domains 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

TAIR\|locus:2123446 AT4G10940 "AT4G10940" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E9PJ24 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F8WEF5 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9P1Y6 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00017553001	SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (530 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		673
pfam00628		51	pfam00628, PHD, PHD-finger	5e-09
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	1e-07
PHA02929		238	PHA02929, PHA02929, N1R/p28-like protein; Provisio	2e-07
smart00249		47	smart00249, PHD, PHD zinc finger	4e-07
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	4e-07
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	5e-05
smart00184		40	smart00184, RING, Ring finger	1e-04
COG5141		669	COG5141, COG5141, PHD zinc finger-containing prote	2e-04
PHA02926		242	PHA02926, PHA02926, zinc finger-like protein; Prov	2e-04
pfam12678		73	pfam12678, zf-rbx1, RING-H2 zinc finger	0.002

>gnl\|CDD\|201356 pfam00628, PHD, PHD-finger	Back alignment and domain information

 Score = 52.1 bits (125), Expect = 5e-09
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 98  RCNVCQGTTYESLLLLCDLCDTASHTYCVGMG---NAVPEGDWFCHDCTV 144
            C VC     +  LLLCD CD   H  C+G       +PEG+W+C +C  
Sbjct: 1   YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|214584 smart00249, PHD, PHD zinc finger	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|221705 pfam12678, zf-rbx1, RING-H2 zinc finger	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		673
KOG0825		1134	consensus PHD Zn-finger protein [General function	99.71
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.97
PHA02929		238	N1R/p28-like protein; Provisional	98.75
PHA02926		242	zinc finger-like protein; Provisional	98.71
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.59
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.55
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.5
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	98.47
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.46
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.44
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.4
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.35
PF14634		44	zf-RING_5: zinc-RING finger domain	98.25
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.24
KOG1244		336	consensus Predicted transcription factor Requiem/N	98.22
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.21
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.2
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.2
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.19
PF00628		51	PHD: PHD-finger; InterPro: IPR019787 Zinc finger (	98.15
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.15
KOG1512		381	consensus PHD Zn-finger protein [General function	98.1
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.1
KOG4443		694	consensus Putative transcription factor HALR/MLL3,	98.02
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.02
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.0
smart00249		47	PHD PHD zinc finger. The plant homeodomain (PHD) f	97.86
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.84
KOG0955		1051	consensus PHD finger protein BR140/LIN-49 [General	97.84
KOG4299		613	consensus PHD Zn-finger protein [General function	97.81
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	97.78
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	97.75
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.75
KOG1973		274	consensus Chromatin remodeling protein, contains P	97.72
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.67
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.63
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	97.6
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.58
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	97.51
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	97.47
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	97.41
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	97.38
COG5141		669	PHD zinc finger-containing protein [General functi	97.36
KOG4323		464	consensus Polycomb-like PHD Zn-finger protein [Gen	97.28
KOG0956		900	consensus PHD finger protein AF10 [General functio	97.27
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	97.27
COG5034		271	TNG2 Chromatin remodeling protein, contains PhD zi	97.23
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.19
KOG0383		696	consensus Predicted helicase [General function pre	97.14
cd04718		148	BAH_plant_2 BAH, or Bromo Adjacent Homology domain	97.07
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	96.98
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	96.86
KOG0954		893	consensus PHD finger protein [General function pre	96.84
KOG1245		1404	consensus Chromatin remodeling complex WSTF-ISWI,	96.84
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	96.82
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	96.79
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.67
KOG0957		707	consensus PHD finger protein [General function pre	96.67
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	96.6
KOG4430		553	consensus Topoisomerase I-binding arginine-serine-	96.23
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	96.11
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	95.8
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	95.66
PF13831		36	PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A.	95.64
KOG2660		331	consensus Locus-specific chromosome binding protei	95.6
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	95.47
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	95.12
KOG4367		699	consensus Predicted Zn-finger protein [Function un	95.12
KOG4445		368	consensus Uncharacterized conserved protein, conta	95.1
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	95.08
KOG1002		791	consensus Nucleotide excision repair protein RAD16	95.02
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	94.88
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	94.82
KOG0297		391	consensus TNF receptor-associated factor [Signal t	94.81
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	94.57
PHA03096		284	p28-like protein; Provisional	94.54
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	94.51
KOG1941		518	consensus Acetylcholine receptor-associated protei	93.77
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	93.64
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	93.22
COG5152		259	Uncharacterized conserved protein, contains RING a	92.98
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	92.8
COG5175		480	MOT2 Transcriptional repressor [Transcription]	92.29
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	91.53
KOG0956		900	consensus PHD finger protein AF10 [General functio	91.08
PHA02862		156	5L protein; Provisional	90.85
PF04641		260	Rtf2: Rtf2 RING-finger	90.5
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	89.94
KOG0957		707	consensus PHD finger protein [General function pre	89.88
COG5222		427	Uncharacterized conserved protein, contains RING Z	89.81
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	89.7
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	89.02
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	88.76
KOG0825		1134	consensus PHD Zn-finger protein [General function	88.52
PHA02825		162	LAP/PHD finger-like protein; Provisional	88.15
KOG3039		303	consensus Uncharacterized conserved protein [Funct	86.57
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	86.4
PF15446		175	zf-PHD-like: PHD/FYVE-zinc-finger like domain	84.84
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	84.83
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	84.33
KOG3053		293	consensus Uncharacterized conserved protein [Funct	83.04
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	82.7
KOG1940		276	consensus Zn-finger protein [General function pred	81.87
KOG4739		233	consensus Uncharacterized protein involved in syna	81.68
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	81.45
COG5236		493	Uncharacterized conserved protein, contains RING Z	81.27
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	81.14
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	80.66
KOG0298		1394	consensus DEAD box-containing helicase-like transc	80.23

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

Probab=99.71  E-value=2e-18  Score=194.04  Aligned_cols=141  Identities=24%  Similarity=0.619  Sum_probs=104.6

Q ss_pred             cccccccccccccCCCcEeccCCCccCHhHHHHHHHhcCCCCCCccccccccCCCCCCCCCcceeeeecccccccccccc
Q 005857            6 SRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAKIESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRDQIYGGFGI   85 (673)
Q Consensus         6 d~~CpICLE~f~~~~~~~Ld~CgH~FC~~CI~eWsk~k~sCPlCRkeFt~I~~~~vdG~f~nErLv~VpeRdQvyepseE   85 (673)
                      ...|+||+..+.+..+.....|.|+||..||..|.+....||+||.+|..+......+.-...+.+.+.+..+..+..+.
T Consensus       123 ~~~CP~Ci~s~~DqL~~~~k~c~H~FC~~Ci~sWsR~aqTCPiDR~EF~~v~V~eS~~~~~~vR~lP~EEs~~~~e~~~d  202 (1134)
T KOG0825|consen  123 ENQCPNCLKSCNDQLEESEKHTAHYFCEECVGSWSRCAQTCPVDRGEFGEVKVLESTGIEANVRCLPSEESENILEKGGD  202 (1134)
T ss_pred             hhhhhHHHHHHHHHhhccccccccccHHHHhhhhhhhcccCchhhhhhheeeeeccccccceeEecchhhhhhhhhhccc
Confidence            35699999998877777778899999999999999999999999999998874433332122223333333332222111


Q ss_pred             cc--cCCCCcccccccccccCCCCccccccccccccc-cccccccCC-CCCCCCCccCcCCCCcc
Q 005857           86 AS--SRTADPYAYVRCNVCQGTTYESLLLLCDLCDTA-SHTYCVGMG-NAVPEGDWFCHDCTVLR  146 (673)
Q Consensus        86 Es--~~eeDp~e~~~CsVC~~~d~ee~LL~CD~Cd~a-fH~~CL~pp-~~VP~gdW~Cp~Cr~~~  146 (673)
                      +.  .......+...|.+|..++.+++||+||.|+.+ ||+|||+|+ .++|.+.|||+.|....
T Consensus       203 ~~~d~~~~~~~E~~~C~IC~~~DpEdVLLLCDsCN~~~YH~YCLDPdl~eiP~~eWYC~NC~dL~  267 (1134)
T KOG0825|consen  203 EKQDQISGLSQEEVKCDICTVHDPEDVLLLCDSCNKVYYHVYCLDPDLSESPVNEWYCTNCSLLE  267 (1134)
T ss_pred             cccccccCcccccccceeeccCChHHhheeecccccceeeccccCcccccccccceecCcchhhh
Confidence            11  111122345789999999999999999999997 999999997 68999999999997654

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription]	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1512 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>smart00249 PHD PHD zinc finger	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only]	Back alignment and domain information

>KOG4299 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5141 PHD zinc finger-containing protein [General function prediction only]	Back alignment and domain information

>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG0956 consensus PHD finger protein AF10 [General function prediction only]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0383 consensus Predicted helicase [General function prediction only]	Back alignment and domain information

>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG0954 consensus PHD finger protein [General function prediction only]	Back alignment and domain information

>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0957 consensus PHD finger protein [General function prediction only]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG4430 consensus Topoisomerase I-binding arginine-serine-rich protein [Transcription]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG0956 consensus PHD finger protein AF10 [General function prediction only]	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0957 consensus PHD finger protein [General function prediction only]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3053 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		673
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	2e-12
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	3e-12
2ku3_A		71	Bromodomain-containing protein 1; PHD finger, chro	3e-11
2e6r_A		92	Jumonji/ARID domain-containing protein 1D; PHD dom	9e-11
2l43_A		88	N-teminal domain from histone H3.3, linker, PHD1 f	3e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	6e-10
3asl_A		70	E3 ubiquitin-protein ligase UHRF1; histone reader	2e-09
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	2e-09
1mm2_A		61	MI2-beta; PHD, zinc finger, protein scaffold, DNA	2e-09
3shb_A		77	E3 ubiquitin-protein ligase UHRF1; unmodified hist	4e-09
3ask_A		226	E3 ubiquitin-protein ligase UHRF1; histone reader	5e-09
2e6s_A		77	E3 ubiquitin-protein ligase UHRF2; PHD domain, str	7e-09
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-08
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	2e-08
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	3e-08
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	4e-06
1fp0_A		88	KAP-1 corepressor; PHD domain, C3HC4 type zinc bin	4e-08
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	4e-08
2yql_A		56	PHD finger protein 21A; PHD domain, structural gen	4e-08
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	7e-08
2puy_A		60	PHD finger protein 21A; PHD finger, histone CODE,	7e-08
1wev_A		88	Riken cDNA 1110020M19; structural genomics, PHD do	9e-08
1xwh_A		66	Autoimmune regulator; PHD domain, Zn binding domai	1e-07
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	2e-07
2yt5_A		66	Metal-response element-binding transcription facto	3e-07
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	4e-07
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	8e-07
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	1e-06
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	2e-06
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	6e-06
2ro1_A		189	Transcription intermediary factor 1-beta; KAP, TIF	8e-06
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	2e-05
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	2e-05
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	4e-05
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	4e-05
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	5e-05
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	6e-05
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	9e-05
3o70_A		68	PHD finger protein 13; PHF13, structural genomics	1e-04
3o7a_A		52	PHD finger protein 13 variant; PHF13, zinc finger,	1e-04
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	1e-04
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	1e-04
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	3e-04
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	3e-04
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	4e-04
1x4i_A		70	Inhibitor of growth protein 3; structural genomics	5e-04
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	6e-04
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	6e-04
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	6e-04
3o36_A		184	Transcription intermediary factor 1-alpha; TRIM24,	6e-04
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	7e-04
2g6q_A		62	Inhibitor of growth protein 2; protein-peptide com	8e-04

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51	Back alignment and structure

 Score = 60.8 bits (148), Expect = 2e-12
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 98  RCNVCQGTTYESLLLLCDLCDTASHTYCVGMG-NAVPEGDWFCHDCTV 144
           RC VC+    +  L+LCD C+ A H +C+      VP+G+W C  C  
Sbjct: 2   RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP 49

PyMOL of 1f62

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75	Back alignment and structure

>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114	Back alignment and structure

>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61	Back alignment and structure

>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77	Back alignment and structure

>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226	Back alignment and structure

>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111	Back alignment and structure

>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60	Back alignment and structure

>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88	Back alignment and structure

>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101	Back alignment and structure

>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68	Back alignment and structure

>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		673
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	99.3
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	99.25
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	99.22
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.12
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.06
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.04
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.04
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.02
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.01
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	98.99
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.97
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.97
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.96
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.95
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.95
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.95
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.91
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.9
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.9
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.89
2e6r_A		92	Jumonji/ARID domain-containing protein 1D; PHD dom	98.89
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.88
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.88
1mm2_A		61	MI2-beta; PHD, zinc finger, protein scaffold, DNA	98.88
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	98.87
1xwh_A		66	Autoimmune regulator; PHD domain, Zn binding domai	98.87
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	98.87
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.84
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	98.83
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.82
2ku3_A		71	Bromodomain-containing protein 1; PHD finger, chro	98.82
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.82
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.81
1fp0_A		88	KAP-1 corepressor; PHD domain, C3HC4 type zinc bin	98.8
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.8
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.79
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.79
3asl_A		70	E3 ubiquitin-protein ligase UHRF1; histone reader	98.78
2e6s_A		77	E3 ubiquitin-protein ligase UHRF2; PHD domain, str	98.78
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.77
1wev_A		88	Riken cDNA 1110020M19; structural genomics, PHD do	98.77
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.77
2l43_A		88	N-teminal domain from histone H3.3, linker, PHD1 f	98.76
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.75
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.75
2yql_A		56	PHD finger protein 21A; PHD domain, structural gen	98.74
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.73
3shb_A		77	E3 ubiquitin-protein ligase UHRF1; unmodified hist	98.73
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.72
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	98.71
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.71
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.71
2yt5_A		66	Metal-response element-binding transcription facto	98.7
2puy_A		60	PHD finger protein 21A; PHD finger, histone CODE,	98.68
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.66
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.65
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	98.63
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.62
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.62
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.61
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.61
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.6
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.6
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.59
3u5n_A		207	E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b	98.59
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.58
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.56
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.55
3ask_A		226	E3 ubiquitin-protein ligase UHRF1; histone reader	98.53
3o36_A		184	Transcription intermediary factor 1-alpha; TRIM24,	98.52
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.51
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.51
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.48
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.48
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.47
1wen_A		71	Inhibitor of growth family, member 4; ING1-like pr	98.44
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.43
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.41
2ro1_A		189	Transcription intermediary factor 1-beta; KAP, TIF	98.4
2lv9_A		98	Histone-lysine N-methyltransferase MLL5; zinc fing	98.4
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.38
1weu_A		91	Inhibitor of growth family, member 4; structural g	98.36
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.36
2vnf_A		60	ING 4, P29ING4, inhibitor of growth protein 4; ace	98.32
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.29
3c6w_A		59	P28ING5, inhibitor of growth protein 5; chromatin,	98.29
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.28
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.27
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.25
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.24
2g6q_A		62	Inhibitor of growth protein 2; protein-peptide com	98.19
4gne_A		107	Histone-lysine N-methyltransferase NSD3; zinc fing	98.17
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.14
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.14
2jmi_A		90	Protein YNG1, ING1 homolog 1; PHD, histone, recogn	98.13
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.13
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.11
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.05
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	98.05
3o70_A		68	PHD finger protein 13; PHF13, structural genomics	98.0
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.86
1x4i_A		70	Inhibitor of growth protein 3; structural genomics	97.84
1wew_A		78	DNA-binding family protein; structural genomics, P	97.8
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	97.7
2lbm_A		142	Transcriptional regulator ATRX; metal binding prot	97.68
1wee_A		72	PHD finger family protein; structural genomics, PH	97.68
1wem_A		76	Death associated transcription factor 1; structura	97.64
2rsd_A		68	E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant	97.64
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	97.64
3o7a_A		52	PHD finger protein 13 variant; PHF13, zinc finger,	97.61
1we9_A		64	PHD finger family protein; structural genomics, PH	97.57
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.53
1wep_A		79	PHF8; structural genomics, PHD domain, riken struc	97.37
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	97.36
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	97.35
2ri7_A		174	Nucleosome-remodeling factor subunit BPTF; zinc fi	97.2
3ql9_A		129	Transcriptional regulator ATRX; zinc finger, trans	97.2
2vpb_A		65	Hpygo1, pygopus homolog 1; gene regulation, WNT si	97.16
2xb1_A		105	Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro;	97.16
2kgg_A		52	Histone demethylase jarid1A; PHD finger, histone m	97.12
3kqi_A		75	GRC5, PHD finger protein 2; metal-binding, zinc-fi	97.01
4gne_A		107	Histone-lysine N-methyltransferase NSD3; zinc fing	96.49
3lqh_A		183	Histone-lysine N-methyltransferase MLL; PHD finger	96.12
3nw0_A		238	Non-structural maintenance of chromosomes element	95.87
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	95.86
3kv5_D		488	JMJC domain-containing histone demethylation prote	95.44
3pur_A		528	Lysine-specific demethylase 7 homolog; oxidoreduct	95.2
1wil_A		89	KIAA1045 protein; ring finger domain, structural g	95.08
3kv4_A		447	PHD finger protein 8; epigenetics, histone CODE, c	94.73
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	92.83
4bbq_A		117	Lysine-specific demethylase 2A; oxidoreductase, ub	92.31
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	91.95
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	91.56
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	91.17
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	90.42
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	89.58
1mm2_A		61	MI2-beta; PHD, zinc finger, protein scaffold, DNA	88.84
1we9_A		64	PHD finger family protein; structural genomics, PH	87.96
2lbm_A		142	Transcriptional regulator ATRX; metal binding prot	87.16
3o36_A		184	Transcription intermediary factor 1-alpha; TRIM24,	87.14
1xwh_A		66	Autoimmune regulator; PHD domain, Zn binding domai	87.06
3u5n_A		207	E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b	86.74
2e6r_A		92	Jumonji/ARID domain-containing protein 1D; PHD dom	86.27
2l43_A		88	N-teminal domain from histone H3.3, linker, PHD1 f	85.76
2yql_A		56	PHD finger protein 21A; PHD domain, structural gen	85.51
1fp0_A		88	KAP-1 corepressor; PHD domain, C3HC4 type zinc bin	85.42
2ku3_A		71	Bromodomain-containing protein 1; PHD finger, chro	85.19
2lv9_A		98	Histone-lysine N-methyltransferase MLL5; zinc fing	85.13
1weo_A		93	Cellulose synthase, catalytic subunit (IRX3); stru	84.76
3ql9_A		129	Transcriptional regulator ATRX; zinc finger, trans	84.37
2yt5_A		66	Metal-response element-binding transcription facto	82.6
2ect_A		78	Ring finger protein 126; metal binding protein, st	82.3
1weu_A		91	Inhibitor of growth family, member 4; structural g	81.48
2puy_A		60	PHD finger protein 21A; PHD finger, histone CODE,	80.78
1wep_A		79	PHF8; structural genomics, PHD domain, riken struc	80.62

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens}	Back alignment and structure

Probab=99.30  E-value=4.9e-13  Score=120.01  Aligned_cols=97  Identities=25%  Similarity=0.623  Sum_probs=75.6

Q ss_pred             CCCCcccccccccccccCCCcEeccCCCccCHhHHHHHHH----hcCCCCCCccccccccCCCCCCCCCcceeeeecccc
Q 005857            2 EGLHSRSCGICLMDEGKSIRGQIDSCDHYFCFVCIMEWAK----IESKCPMCKRRFTSIRRPPKDGVFPRERFVVVPKRD   77 (673)
Q Consensus         2 e~~Ed~~CpICLE~f~~~~~~~Ld~CgH~FC~~CI~eWsk----~k~sCPlCRkeFt~I~~~~vdG~f~nErLv~VpeRd   77 (673)
                      .+.+++.|.||.+..+..+....+.|...||..|+.....    ..+.||.|                            
T Consensus         3 ~~~~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C----------------------------   54 (111)
T 2ysm_A            3 SGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPEC----------------------------   54 (111)
T ss_dssp             CCCCCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTT----------------------------
T ss_pred             CCCCCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcC----------------------------
Confidence            3567899999998663334467788999999999865321    12333333                            


Q ss_pred             cccccccccccCCCCcccccccccccCCCCccccccccccccccccccccCC-CCCCCCCccCcCCCCc
Q 005857           78 QIYGGFGIASSRTADPYAYVRCNVCQGTTYESLLLLCDLCDTASHTYCVGMG-NAVPEGDWFCHDCTVL  145 (673)
Q Consensus        78 QvyepseEEs~~eeDp~e~~~CsVC~~~d~ee~LL~CD~Cd~afH~~CL~pp-~~VP~gdW~Cp~Cr~~  145 (673)
                                         ..|.+|+..+++..+++|+.|+++||++||+|+ ..+|.++|||+.|...
T Consensus        55 -------------------~~C~~C~~~~~~~~ll~Cd~C~~~yH~~Cl~ppl~~~P~g~W~C~~C~~c  104 (111)
T 2ysm_A           55 -------------------KVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRIC  104 (111)
T ss_dssp             -------------------CCCTTTCCCSCCTTEEECSSSCCEEEGGGSSSCCSSCCSSCCCCHHHHCC
T ss_pred             -------------------CcccccCccCCCCCeeECCCCCcHHhHHhcCCccccCCCCCcCCcCCcCc
Confidence                               268899988877889999999999999999987 7899999999999764

PyMOL of 2ysm

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A*	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B	Back alignment and structure

>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus}	Back alignment and structure

>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A*	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A*	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens}	Back alignment and structure

>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens}	Back alignment and structure

>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A*	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A*	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus}	Back alignment and structure

>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A*	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A*	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens}	Back alignment and structure

>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A	Back alignment and structure

>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens}	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A*	Back alignment and structure

>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A*	Back alignment and structure

>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A	Back alignment and structure

>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A*	Back alignment and structure

>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens}	Back alignment and structure

>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A*	Back alignment and structure

>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A*	Back alignment and structure

>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A*	Back alignment and structure

>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A*	Back alignment and structure

>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3	Back alignment and structure

>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens}	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens}	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A*	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A	Back alignment and structure

>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A	Back alignment and structure

>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A	Back alignment and structure

>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A*	Back alignment and structure

>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens}	Back alignment and structure

>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens}	Back alignment and structure

>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1	Back alignment and structure

>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A	Back alignment and structure

>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens}	Back alignment and structure

>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		673
d1f62a_		51	g.50.1.2 (A:) Williams-Beuren syndrome transcripti	9e-10
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	2e-09
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	2e-08
d1fp0a1		70	g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-	8e-08
d1mm2a_		61	g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens	2e-07
d1we9a_		64	g.50.1.2 (A:) PHD finger protein At5g26210 {Thale	4e-07
d1weea_		72	g.50.1.2 (A:) PHD finger protein At1g33420 {Thale	4e-07
d1wema_		76	g.50.1.2 (A:) Death associated transcription facto	5e-07
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	2e-06
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	5e-06
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	6e-06
d1weva_		88	g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu	3e-05
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	3e-05
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	5e-05
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	1e-04
d2pnxa1		51	g.50.1.2 (A:195-245) Inhibitor of growth protein 4	3e-04
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	7e-04
d1wepa_		79	g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus	0.001
d1wima_		94	g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016	0.003

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure


class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.3 bits (125), Expect = 9e-10
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 98  RCNVCQGTTYESLLLLCDLCDTASHTYCVGMGN-AVPEGDWFCHDC 142
           RC VC+    +  L+LCD C+ A H +C+      VP+G+W C  C
Sbjct: 2   RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47

PyMOL of d1f62a_

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64	Back information, alignment and structure

>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		673
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.1
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.1
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.93
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.92
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.89
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.83
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	98.82
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.82
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.78
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.77
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.72
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.71
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.71
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.59
d1fp0a1		70	Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo	98.57
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.56
d1mm2a_		61	Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606	98.55
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.54
d1wesa_		71	PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu	98.34
d1weva_		88	PHD finger protein 22 {Mouse (Mus musculus) [TaxId	98.22
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.21
d1weea_		72	PHD finger protein At1g33420 {Thale cress (Arabido	98.01
d2pnxa1		51	Inhibitor of growth protein 4, Ing4 {Homo sapiens	97.99
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	97.94
d1we9a_		64	PHD finger protein At5g26210 {Thale cress (Arabido	97.82
d1wema_		76	Death associated transcription factor 1, Datf1 (DI	97.69
d1wepa_		79	PHD finger protein 8 {Mouse (Mus musculus) [TaxId:	97.69
d1wewa_		78	Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop	97.58
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	92.13
d1mm2a_		61	Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606	91.15
d1fp0a1		70	Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo	88.02
d1we9a_		64	PHD finger protein At5g26210 {Thale cress (Arabido	84.97
d1weoa_		93	Cellulose synthase A catalytic subunit 7, IRX3 {Th	83.8
d1wema_		76	Death associated transcription factor 1, Datf1 (DI	81.6
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	81.57
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	81.21
d1wesa_		71	PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu	80.73
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	80.4

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.10  E-value=1.5e-11  Score=96.38  Aligned_cols=50  Identities=24%  Similarity=0.625  Sum_probs=42.2

Q ss_pred             CCcccccccccccccCCCc-EeccCCCccCHhHHHHHHHhcCCCCCCcccc
Q 005857            4 LHSRSCGICLMDEGKSIRG-QIDSCDHYFCFVCIMEWAKIESKCPMCKRRF   53 (673)
Q Consensus         4 ~Ed~~CpICLE~f~~~~~~-~Ld~CgH~FC~~CI~eWsk~k~sCPlCRkeF   53 (673)
                      .++.+|+|||+.|...... .+..|+|.||..||.+|++....||+||+.+
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            4567899999999754444 4557999999999999999999999999875

PyMOL of d1iyma_

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure