Citrus Sinensis ID: 005966


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------
MNGPSHHTLPKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRNILTA
ccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHcccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEccEEcc
cccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEcc
mngpshhtlpkTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYaqngashdsLKMFLGMLrlgeynpdnytypIVIKACTDLAWRKLGIALHGrvlitgfdmdtFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLksgvepdcasvvsvlpacgylkeIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLmqfegvrpnsltIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARtskkktvpwnaILAGCVHNGLARKAVELFRQMLVEVvepndatlNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFseipikdkdiVVWSVIIAgygmhghgETAVSLFKEMVqsgvqpnevTFTSALHacshgglldEGLDLFNFMLenhqtcsradhYTCIVDLLGRAGRLDEAYDLirtmplkpthAVWGALLGACVIHGNVELGEVAAKWLFelepenpgnyVLLSKLYSAVRRWKdaenvrdvmdekglrkapahsLIEVRNILTA
mngpshhtlpkTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFseipikdkdIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAEnvrdvmdekglrkapahslievrnilta
MNGPSHHTLPKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGsllsacsslyylKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRNILTA
***********TTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDV***********************
******HTLPKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRNILT*
*********PKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRNILTA
******HTLPKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRNIL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGPSHHTLPKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRNILTA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query667 2.2.26 [Sep-21-2011]
Q9FLZ9677 Pentatricopeptide repeat- yes no 0.967 0.952 0.569 0.0
Q9SN39 871 Pentatricopeptide repeat- no no 0.977 0.748 0.387 1e-134
Q3E6Q1 809 Pentatricopeptide repeat- no no 0.988 0.814 0.372 1e-125
Q9SS97660 Putative pentatricopeptid no no 0.907 0.916 0.375 1e-121
Q9LFL5 850 Pentatricopeptide repeat- no no 0.946 0.742 0.371 1e-119
Q9STE1857 Pentatricopeptide repeat- no no 0.959 0.746 0.353 1e-118
Q9ZQ74689 Pentatricopeptide repeat- no no 0.904 0.875 0.370 1e-115
Q9LUJ2 842 Pentatricopeptide repeat- no no 0.878 0.695 0.366 1e-114
Q9M9E2 866 Pentatricopeptide repeat- no no 0.908 0.699 0.364 1e-113
Q9SVA5834 Pentatricopeptide repeat- no no 0.935 0.748 0.352 1e-113
>sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protein At5g39350 OS=Arabidopsis thaliana GN=PCMP-E16 PE=2 SV=1 Back     alignment and function desciption
 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/651 (56%), Positives = 484/651 (74%), Gaps = 6/651 (0%)

Query: 19  LVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAY---GHVSNVRILFDEMSERSS 75
           L+  +AAT+SI+ TK LH  +IT G +  H+ S+L   Y   GH++  R LF+EM + S 
Sbjct: 21  LLNHFAATQSISKTKALHCHVITGGRVSGHILSTLSVTYALCGHITYARKLFEEMPQSSL 80

Query: 76  FLYNTVMKMYAQNGASHDSLKMFLGMLRLG-EYNPDNYTYPIVIKACTDLAWRKLGIALH 134
             YN V++MY + G  HD++ +F+ M+  G +  PD YTYP V KA  +L   KLG+ +H
Sbjct: 81  LSYNIVIRMYVREGLYHDAISVFIRMVSEGVKCVPDGYTYPFVAKAAGELKSMKLGLVVH 140

Query: 135 GRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAK 194
           GR+L + F  D +V N L+AMYMNFG+V+ AR VFD M    V+SWNT+ISGY++N Y  
Sbjct: 141 GRILRSWFGRDKYVQNALLAMYMNFGKVEMARDVFDVMKNRDVISWNTMISGYYRNGYMN 200

Query: 195 EALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALV 254
           +AL++FDWM+   V+ D A++VS+LP CG+LK++EMGR +H+LV   RLG  I   NALV
Sbjct: 201 DALMMFDWMVNESVDLDHATIVSMLPVCGHLKDLEMGRNVHKLVEEKRLGDKIEVKNALV 260

Query: 255 DMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSL 314
           +MY+KCG ++EAR VFDRM  RDV+TWT MINGY  +GDV NAL L +LMQFEGVRPN++
Sbjct: 261 NMYLKCGRMDEARFVFDRMERRDVITWTCMINGYTEDGDVENALELCRLMQFEGVRPNAV 320

Query: 315 TIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFART 374
           TI SL+S C     +  G+ LH W ++Q +  ++I+ET+LI MYAKC  V L F+VF+  
Sbjct: 321 TIASLVSVCGDALKVNDGKCLHGWAVRQQVYSDIIIETSLISMYAKCKRVDLCFRVFSGA 380

Query: 375 SKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAM 434
           SK  T PW+AI+AGCV N L   A+ LF++M  E VEPN ATLNSLLPAYA LADL+QAM
Sbjct: 381 SKYHTGPWSAIIAGCVQNELVSDALGLFKRMRREDVEPNIATLNSLLPAYAALADLRQAM 440

Query: 435 NIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPI--KDKDIVVWSVIIAGY 492
           NIHCYL + GF+S ++ +TGL+ +YSKCG+LESAHKIF+ I    K KD+V+W  +I+GY
Sbjct: 441 NIHCYLTKTGFMSSLDAATGLVHVYSKCGTLESAHKIFNGIQEKHKSKDVVLWGALISGY 500

Query: 493 GMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSR 552
           GMHG G  A+ +F EMV+SGV PNE+TFTSAL+ACSH GL++EGL LF FMLE+++T +R
Sbjct: 501 GMHGDGHNALQVFMEMVRSGVTPNEITFTSALNACSHSGLVEEGLTLFRFMLEHYKTLAR 560

Query: 553 ADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLF 612
           ++HYTCIVDLLGRAGRLDEAY+LI T+P +PT  VWGALL ACV H NV+LGE+AA  LF
Sbjct: 561 SNHYTCIVDLLGRAGRLDEAYNLITTIPFEPTSTVWGALLAACVTHENVQLGEMAANKLF 620

Query: 613 ELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRN 663
           ELEPEN GNYVLL+ +Y+A+ RWKD E VR +M+  GLRK P HS IE+R+
Sbjct: 621 ELEPENTGNYVLLANIYAALGRWKDMEKVRSMMENVGLRKKPGHSTIEIRS 671





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containing protein At3g01580 OS=Arabidopsis thaliana GN=PCMP-E87 PE=3 SV=2 Back     alignment and function description
>sp|Q9LFL5|PP390_ARATH Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1 Back     alignment and function description
>sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protein At4g21300 OS=Arabidopsis thaliana GN=PCMP-E36 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protein At2g03380, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E47 PE=3 SV=1 Back     alignment and function description
>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1 Back     alignment and function description
>sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protein At1g15510, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H73 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query667
225452956676 PREDICTED: pentatricopeptide repeat-cont 0.994 0.980 0.642 0.0
147819295676 hypothetical protein VITISV_019277 [Viti 0.994 0.980 0.641 0.0
224077710676 predicted protein [Populus trichocarpa] 0.992 0.979 0.646 0.0
356495419666 PREDICTED: pentatricopeptide repeat-cont 0.968 0.969 0.615 0.0
297805814674 pentatricopeptide repeat-containing prot 0.967 0.956 0.574 0.0
449439011 787 PREDICTED: pentatricopeptide repeat-cont 0.949 0.804 0.589 0.0
15241714677 pentatricopeptide repeat-containing prot 0.967 0.952 0.569 0.0
449476598709 PREDICTED: pentatricopeptide repeat-cont 0.938 0.882 0.567 0.0
255570240502 pentatricopeptide repeat-containing prot 0.698 0.928 0.570 1e-164
50251760667 pentatricopeptide (PPR) repeat-containin 0.901 0.901 0.464 1e-153
>gi|225452956|ref|XP_002279032.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350 [Vitis vinifera] gi|296082987|emb|CBI22288.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/677 (64%), Positives = 534/677 (78%), Gaps = 14/677 (2%)

Query: 1   MNGPSHHTLPKTTHLVI------KLVQQYAATKSIAGTKQLHAFIIT----SGPLFTHLR 50
           M+GPS   L K+ HL+        L+Q+  + KSI  TKQ+HA  IT    S P   HL 
Sbjct: 1   MDGPSQ-ALSKSKHLLTATARYQSLLQRCTSRKSIPNTKQIHAHTITLGLLSSPYSHHLL 59

Query: 51  SSLVRAY---GHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEY 107
           SSL  AY   G   + R LFDE+   S F +N +++MY  +G S+D+L +F+ ML  G  
Sbjct: 60  SSLAAAYAMFGCAPHARKLFDELRNPSLFSWNAMIRMYTNSGLSYDALGLFVQMLASGRR 119

Query: 108 NPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARK 167
            PDNYTYP VIKAC D    ++G  +H R +++GFD D FV N L+AMYMN GE++ AR+
Sbjct: 120 WPDNYTYPFVIKACGDYLLPEMGALIHARTVMSGFDSDAFVQNSLMAMYMNCGEMEVARR 179

Query: 168 VFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKE 227
           VFD M E ++VSWNT+I+GYFKN   KEAL+VFDWM+  G+EPDCA+VVSVLP C YLKE
Sbjct: 180 VFDLMRERTLVSWNTMINGYFKNGCVKEALMVFDWMIGKGIEPDCATVVSVLPVCSYLKE 239

Query: 228 IEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMING 287
           +E+GR +H LV    LG++I+ WN+L+DMY KCG+++EA+++F  M +RDVV+WT+M+NG
Sbjct: 240 LEVGRRVHALVEVKNLGEDISVWNSLLDMYAKCGNMDEAQMIFYEMDKRDVVSWTTMMNG 299

Query: 288 YALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECE 347
           Y LNGD R+AL L Q+MQFE V+PN +T+ S+LSAC+SLY LK GR LH W I+Q LE E
Sbjct: 300 YILNGDARSALLLCQMMQFESVKPNFVTLASVLSACASLYSLKHGRCLHGWAIRQKLESE 359

Query: 348 VIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLV 407
           VIVETALIDMYAKCN V LSF+VF++TSK++T PWNAI++GC+HNGL+RKA+ELF+QML+
Sbjct: 360 VIVETALIDMYAKCNNVNLSFRVFSKTSKQRTAPWNAIISGCIHNGLSRKAIELFKQMLM 419

Query: 408 EVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLES 467
           E V+PNDATLNSLLPAYA L DLQQA N+H YLIR GFLS +EV+T LIDIYSKCGSLES
Sbjct: 420 EAVDPNDATLNSLLPAYAFLTDLQQARNMHGYLIRSGFLSRIEVATILIDIYSKCGSLES 479

Query: 468 AHKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHAC 527
           AH IF+ IP KDKDI+ WS IIAGYGMHGHGETA+SLF +MVQSGV+PNE+TFTS LHAC
Sbjct: 480 AHNIFNGIPKKDKDIITWSAIIAGYGMHGHGETAISLFDQMVQSGVKPNEITFTSILHAC 539

Query: 528 SHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAV 587
           SH GL+DEGL LF FMLE++Q   R DHYTC++DLLGRAGRL+EAY+LIRTM  +P HAV
Sbjct: 540 SHAGLVDEGLGLFKFMLEDNQMSLRTDHYTCVIDLLGRAGRLEEAYELIRTMAFRPNHAV 599

Query: 588 WGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDE 647
           WGALLG+CVIH NVELGEVAAKWLFELEP N GNYVLL+ +YSAV RW+DAE+VR +M+ 
Sbjct: 600 WGALLGSCVIHENVELGEVAAKWLFELEPGNTGNYVLLANIYSAVGRWRDAEHVRLMMNN 659

Query: 648 KGLRKAPAHSLIEVRNI 664
            GLRK PAHSLIEVRNI
Sbjct: 660 IGLRKTPAHSLIEVRNI 676




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147819295|emb|CAN68962.1| hypothetical protein VITISV_019277 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224077710|ref|XP_002305373.1| predicted protein [Populus trichocarpa] gi|222848337|gb|EEE85884.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356495419|ref|XP_003516575.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Glycine max] Back     alignment and taxonomy information
>gi|297805814|ref|XP_002870791.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316627|gb|EFH47050.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449439011|ref|XP_004137281.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15241714|ref|NP_198751.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171567|sp|Q9FLZ9.1|PP405_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39350 gi|10177683|dbj|BAB11009.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332007040|gb|AED94423.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449476598|ref|XP_004154781.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39350-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570240|ref|XP_002526080.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534577|gb|EEF36274.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|50251760|dbj|BAD27693.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|222623393|gb|EEE57525.1| hypothetical protein OsJ_07836 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query667
TAIR|locus:2175653677 AT5G39350 "AT5G39350" [Arabido 0.967 0.952 0.563 1.5e-200
TAIR|locus:2124137 871 DOT4 "DEFECTIVELY ORGANIZED TR 0.976 0.747 0.386 1.1e-119
TAIR|locus:2202074 809 CRR22 "CHLORORESPIRATORY REDUC 0.988 0.814 0.365 5.9e-112
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.959 0.746 0.345 1.7e-107
TAIR|locus:2118964 823 EMB2758 "embryo defective 2758 0.935 0.758 0.367 4.6e-105
TAIR|locus:2063771689 AT2G03380 [Arabidopsis thalian 0.940 0.910 0.353 7.5e-105
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.901 0.693 0.356 1.6e-104
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.935 0.748 0.341 8.6e-104
TAIR|locus:2131631 804 AT4G35130 "AT4G35130" [Arabido 0.884 0.733 0.352 3.7e-103
TAIR|locus:2131939 792 MEF29 "AT4G30700" [Arabidopsis 0.976 0.821 0.338 1.6e-102
TAIR|locus:2175653 AT5G39350 "AT5G39350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1941 (688.3 bits), Expect = 1.5e-200, P = 1.5e-200
 Identities = 367/651 (56%), Positives = 478/651 (73%)

Query:    19 LVQQYAATKSIAGTKQLHAFIITSGPLFTHLRSSLVRAY---GHVSNVRILFDEMSERSS 75
             L+  +AAT+SI+ TK LH  +IT G +  H+ S+L   Y   GH++  R LF+EM + S 
Sbjct:    21 LLNHFAATQSISKTKALHCHVITGGRVSGHILSTLSVTYALCGHITYARKLFEEMPQSSL 80

Query:    76 FLYNTVMKMYAQNGASHDSLKMFLGMLRLG-EYNPDNYTYPIVIKACTDLAWRKLGIALH 134
               YN V++MY + G  HD++ +F+ M+  G +  PD YTYP V KA  +L   KLG+ +H
Sbjct:    81 LSYNIVIRMYVREGLYHDAISVFIRMVSEGVKCVPDGYTYPFVAKAAGELKSMKLGLVVH 140

Query:   135 GRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEHSVVSWNTLISGYFKNAYAK 194
             GR+L + F  D +V N L+AMYMNFG+V+ AR VFD M    V+SWNT+ISGY++N Y  
Sbjct:   141 GRILRSWFGRDKYVQNALLAMYMNFGKVEMARDVFDVMKNRDVISWNTMISGYYRNGYMN 200

Query:   195 EALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALV 254
             +AL++FDWM+   V+ D A++VS+LP CG+LK++EMGR +H+LV   RLG  I   NALV
Sbjct:   201 DALMMFDWMVNESVDLDHATIVSMLPVCGHLKDLEMGRNVHKLVEEKRLGDKIEVKNALV 260

Query:   255 DMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSL 314
             +MY+KCG ++EAR VFDRM  RDV+TWT MINGY  +GDV NAL L +LMQFEGVRPN++
Sbjct:   261 NMYLKCGRMDEARFVFDRMERRDVITWTCMINGYTEDGDVENALELCRLMQFEGVRPNAV 320

Query:   315 TIGXXXXXXXXXXXXKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFART 374
             TI               G+ LH W ++Q +  ++I+ET+LI MYAKC  V L F+VF+  
Sbjct:   321 TIASLVSVCGDALKVNDGKCLHGWAVRQQVYSDIIIETSLISMYAKCKRVDLCFRVFSGA 380

Query:   375 SKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAM 434
             SK  T PW+AI+AGCV N L   A+ LF++M  E VEPN ATLNSLLPAYA LADL+QAM
Sbjct:   381 SKYHTGPWSAIIAGCVQNELVSDALGLFKRMRREDVEPNIATLNSLLPAYAALADLRQAM 440

Query:   435 NIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIK--DKDIVVWSVIIAGY 492
             NIHCYL + GF+S ++ +TGL+ +YSKCG+LESAHKIF+ I  K   KD+V+W  +I+GY
Sbjct:   441 NIHCYLTKTGFMSSLDAATGLVHVYSKCGTLESAHKIFNGIQEKHKSKDVVLWGALISGY 500

Query:   493 GMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSR 552
             GMHG G  A+ +F EMV+SGV PNE+TFTSAL+ACSH GL++EGL LF FMLE+++T +R
Sbjct:   501 GMHGDGHNALQVFMEMVRSGVTPNEITFTSALNACSHSGLVEEGLTLFRFMLEHYKTLAR 560

Query:   553 ADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLF 612
             ++HYTCIVDLLGRAGRLDEAY+LI T+P +PT  VWGALL ACV H NV+LGE+AA  LF
Sbjct:   561 SNHYTCIVDLLGRAGRLDEAYNLITTIPFEPTSTVWGALLAACVTHENVQLGEMAANKLF 620

Query:   613 ELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEKGLRKAPAHSLIEVRN 663
             ELEPEN GNYVLL+ +Y+A+ RWKD E VR +M+  GLRK P HS IE+R+
Sbjct:   621 ELEPENTGNYVLLANIYAALGRWKDMEKVRSMMENVGLRKKPGHSTIEIRS 671


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063771 AT2G03380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131631 AT4G35130 "AT4G35130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131939 MEF29 "AT4G30700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FLZ9PP405_ARATHNo assigned EC number0.56980.96700.9527yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query667
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-167
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-112
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-92
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-57
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-50
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-07
pfam0153531 pfam01535, PPR, PPR repeat 5e-06
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 8e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
pfam0153531 pfam01535, PPR, PPR repeat 0.004
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  500 bits (1289), Expect = e-167
 Identities = 245/619 (39%), Positives = 358/619 (57%), Gaps = 6/619 (0%)

Query: 49  LRSSLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYN 108
           + S  VR +G + +   +F +M ER  F +N ++  YA+ G   ++L ++  ML  G   
Sbjct: 127 MLSMFVR-FGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAG-VR 184

Query: 109 PDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKV 168
           PD YT+P V++ C  +     G  +H  V+  GF++D  V N LI MY+  G+V +AR V
Sbjct: 185 PDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLV 244

Query: 169 FDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEI 228
           FD M     +SWN +ISGYF+N    E L +F  M +  V+PD  ++ SV+ AC  L + 
Sbjct: 245 FDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDE 304

Query: 229 EMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGY 288
            +GR +H  V       +++  N+L+ MY+  GS  EA  VF RM  +D V+WT+MI+GY
Sbjct: 305 RLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGY 364

Query: 289 ALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEV 348
             NG    AL  + LM+ + V P+ +TI S+LSAC+ L  L  G  LH    ++ L   V
Sbjct: 365 EKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYV 424

Query: 349 IVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVE 408
           +V  ALI+MY+KC  +  + +VF    +K  + W +I+AG   N    +A+  FRQML+ 
Sbjct: 425 VVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLT 484

Query: 409 VVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESA 468
           + +PN  TL + L A A +  L     IH +++R G      +   L+D+Y +CG +  A
Sbjct: 485 L-KPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYA 543

Query: 469 HKIFSEIPIKDKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACS 528
              F+     +KD+V W++++ GY  HG G  AV LF  MV+SGV P+EVTF S L ACS
Sbjct: 544 WNQFN---SHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACS 600

Query: 529 HGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTMPLKPTHAVW 588
             G++ +GL+ F+ M E +       HY C+VDLLGRAG+L EAY+ I  MP+ P  AVW
Sbjct: 601 RSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVW 660

Query: 589 GALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRDVMDEK 648
           GALL AC IH +VELGE+AA+ +FEL+P + G Y+LL  LY+   +W +   VR  M E 
Sbjct: 661 GALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMREN 720

Query: 649 GLRKAPAHSLIEVRNILTA 667
           GL   P  S +EV+  + A
Sbjct: 721 GLTVDPGCSWVEVKGKVHA 739


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 667
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG2076895 consensus RNA polymerase III transcription factor 99.87
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG2003840 consensus TPR repeat-containing protein [General f 99.81
KOG2076895 consensus RNA polymerase III transcription factor 99.81
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
KOG2003 840 consensus TPR repeat-containing protein [General f 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.7
KOG0547606 consensus Translocase of outer mitochondrial membr 99.69
KOG1915677 consensus Cell cycle control protein (crooked neck 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.62
KOG1126638 consensus DNA-binding cell division cycle control 99.61
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.61
KOG1915677 consensus Cell cycle control protein (crooked neck 99.61
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.6
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.59
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.56
KOG1126638 consensus DNA-binding cell division cycle control 99.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.51
KOG0547606 consensus Translocase of outer mitochondrial membr 99.5
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.5
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.49
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.48
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.47
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.46
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.45
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG1129478 consensus TPR repeat-containing protein [General f 99.42
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.42
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.41
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.36
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.36
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.35
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.31
KOG1129478 consensus TPR repeat-containing protein [General f 99.3
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.29
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.29
KOG2376652 consensus Signal recognition particle, subunit Srp 99.29
PRK12370553 invasion protein regulator; Provisional 99.29
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.28
PRK12370553 invasion protein regulator; Provisional 99.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.27
PF1304150 PPR_2: PPR repeat family 99.26
PRK11189296 lipoprotein NlpI; Provisional 99.26
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.25
PF1304150 PPR_2: PPR repeat family 99.24
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.23
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.23
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.17
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.17
PRK11189296 lipoprotein NlpI; Provisional 99.17
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.15
KOG1125579 consensus TPR repeat-containing protein [General f 99.14
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.13
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.1
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.08
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.08
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.08
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.0
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.99
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.98
PRK10370198 formate-dependent nitrite reductase complex subuni 98.96
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.96
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.9
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.9
PRK04841 903 transcriptional regulator MalT; Provisional 98.9
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.89
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.85
PRK15359144 type III secretion system chaperone protein SscB; 98.84
PRK15359144 type III secretion system chaperone protein SscB; 98.82
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.8
PLN02789320 farnesyltranstransferase 98.79
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.78
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.74
PLN02789320 farnesyltranstransferase 98.74
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.71
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.68
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.68
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.64
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.64
PRK10370198 formate-dependent nitrite reductase complex subuni 98.62
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.61
KOG1125579 consensus TPR repeat-containing protein [General f 98.6
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.6
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.59
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.56
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.56
PF1285434 PPR_1: PPR repeat 98.54
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.52
PF1285434 PPR_1: PPR repeat 98.52
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.49
PRK04841903 transcriptional regulator MalT; Provisional 98.49
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.46
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.45
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.43
KOG0553304 consensus TPR repeat-containing protein [General f 98.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.43
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.37
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.36
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.27
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.25
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.21
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.2
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.19
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.19
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.19
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.18
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.14
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.13
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.07
COG4700251 Uncharacterized protein conserved in bacteria cont 98.07
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.06
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.05
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.04
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.02
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.01
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.01
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.99
KOG0553 304 consensus TPR repeat-containing protein [General f 97.99
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.97
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.95
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.94
PF1337173 TPR_9: Tetratricopeptide repeat 97.92
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.84
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.84
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.84
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.82
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.81
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.79
PRK15331165 chaperone protein SicA; Provisional 97.79
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.77
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.67
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.67
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.65
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.65
PF1343134 TPR_17: Tetratricopeptide repeat 97.65
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.62
PRK10803263 tol-pal system protein YbgF; Provisional 97.62
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.6
KOG20411189 consensus WD40 repeat protein [General function pr 97.51
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.51
PF1342844 TPR_14: Tetratricopeptide repeat 97.49
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.48
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.44
KOG20411189 consensus WD40 repeat protein [General function pr 97.44
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.43
COG4700251 Uncharacterized protein conserved in bacteria cont 97.4
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.4
PF1337173 TPR_9: Tetratricopeptide repeat 97.39
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.39
PF12688120 TPR_5: Tetratrico peptide repeat 97.35
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.34
PF12688120 TPR_5: Tetratrico peptide repeat 97.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.29
PRK10803263 tol-pal system protein YbgF; Provisional 97.27
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.24
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.21
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.2
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.17
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.13
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.12
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.11
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.09
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.08
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.07
PF13512142 TPR_18: Tetratricopeptide repeat 97.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.99
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.99
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.98
PRK11906458 transcriptional regulator; Provisional 96.93
KOG4555175 consensus TPR repeat-containing protein [Function 96.93
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.93
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.87
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.83
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.81
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.76
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.75
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.69
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.64
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.54
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.48
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.4
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.35
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.29
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.28
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.21
KOG4234271 consensus TPR repeat-containing protein [General f 96.08
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.05
KOG1258577 consensus mRNA processing protein [RNA processing 96.02
PRK11906458 transcriptional regulator; Provisional 95.97
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.94
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.93
PRK15331165 chaperone protein SicA; Provisional 95.93
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.92
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.92
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.92
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.92
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.86
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.84
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.79
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.78
smart00299140 CLH Clathrin heavy chain repeat homology. 95.77
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.76
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.75
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.7
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.69
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.67
COG3947361 Response regulator containing CheY-like receiver a 95.66
KOG1258577 consensus mRNA processing protein [RNA processing 95.66
KOG1585308 consensus Protein required for fusion of vesicles 95.53
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.51
smart00299140 CLH Clathrin heavy chain repeat homology. 95.48
KOG4555175 consensus TPR repeat-containing protein [Function 95.46
PF13512142 TPR_18: Tetratricopeptide repeat 95.28
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.23
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 95.18
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.1
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.9
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.89
KOG1550552 consensus Extracellular protein SEL-1 and related 94.86
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.79
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.75
KOG3941406 consensus Intermediate in Toll signal transduction 94.74
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.7
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.36
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.28
PF1342844 TPR_14: Tetratricopeptide repeat 94.06
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.05
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.02
KOG4234271 consensus TPR repeat-containing protein [General f 93.93
KOG3941 406 consensus Intermediate in Toll signal transduction 93.84
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.83
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.78
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.75
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.7
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.64
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.54
KOG1586288 consensus Protein required for fusion of vesicles 93.31
PRK11619 644 lytic murein transglycosylase; Provisional 93.3
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.18
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.08
KOG1585308 consensus Protein required for fusion of vesicles 92.79
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.68
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.68
COG3629280 DnrI DNA-binding transcriptional activator of the 92.64
KOG1586288 consensus Protein required for fusion of vesicles 92.6
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.49
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.41
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.88
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.87
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.8
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.79
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.69
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.59
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.47
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.12
PRK10941269 hypothetical protein; Provisional 91.08
KOG4648 536 consensus Uncharacterized conserved protein, conta 90.98
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.81
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.74
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.73
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.38
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.35
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.19
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.13
KOG1550 552 consensus Extracellular protein SEL-1 and related 90.02
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 89.98
COG3629280 DnrI DNA-binding transcriptional activator of the 89.91
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.79
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 89.61
PF1343134 TPR_17: Tetratricopeptide repeat 89.49
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.39
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 89.36
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.17
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 89.06
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 89.01
PRK09687280 putative lyase; Provisional 88.93
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.5
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.45
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 88.23
COG4455 273 ImpE Protein of avirulence locus involved in tempe 88.14
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.5
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 86.97
PRK12798421 chemotaxis protein; Reviewed 86.9
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.86
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.75
PRK09687280 putative lyase; Provisional 86.44
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.41
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 85.84
KOG4570 418 consensus Uncharacterized conserved protein [Funct 85.52
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.35
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.32
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.09
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.94
COG5159 421 RPN6 26S proteasome regulatory complex component [ 84.93
COG1747 711 Uncharacterized N-terminal domain of the transcrip 84.79
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 84.65
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.23
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 84.04
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 83.72
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.56
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 83.36
KOG3364149 consensus Membrane protein involved in organellar 82.53
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 82.45
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 82.25
PF09477116 Type_III_YscG: Bacterial type II secretion system 81.84
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.6
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.38
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.24
KOG1498 439 consensus 26S proteasome regulatory complex, subun 81.21
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 81.17
PF13762145 MNE1: Mitochondrial splicing apparatus component 80.63
PRK10941269 hypothetical protein; Provisional 80.55
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-98  Score=820.24  Aligned_cols=654  Identities=38%  Similarity=0.669  Sum_probs=639.8

Q ss_pred             CCCCChhHHHHHHHHhhccCChhhHhHHHHHHHHhCCCc-hhhhh---hHhhhcCChhhHHHhhcccCCCCcchHHHHHH
Q 005966            8 TLPKTTHLVIKLVQQYAATKSIAGTKQLHAFIITSGPLF-THLRS---SLVRAYGHVSNVRILFDEMSERSSFLYNTVMK   83 (667)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~-~~~~~---~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~   83 (667)
                      +++++..++..+++.|...+.+..|.+++..+++.++.. ..+.+   ..|.++|+++.|.++|++|++||.++||.+|.
T Consensus        81 g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~~A~~~f~~m~~~d~~~~n~li~  160 (857)
T PLN03077         81 RVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVG  160 (857)
T ss_pred             CCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChHHHHHHHhcCCCCCeeEHHHHHH
Confidence            467788889999999999999999999999999998876 66666   88999999999999999999999999999999


Q ss_pred             HHHhCCCchHHHHHHHHhHHcCCCCCCcccHHHHHHHhccccchHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhcCCHH
Q 005966           84 MYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGIALHGRVLITGFDMDTFVGNCLIAMYMNFGEVK  163 (667)
Q Consensus        84 ~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~  163 (667)
                      +|++.|++++|+++|++|.+. |+.||..||+.++++|+..+++..+.+++..+.+.|+.||..++|.||.+|++.|+++
T Consensus       161 ~~~~~g~~~~A~~~f~~M~~~-g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~  239 (857)
T PLN03077        161 GYAKAGYFDEALCLYHRMLWA-GVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVV  239 (857)
T ss_pred             HHHhCCCHHHHHHHHHHHHHc-CCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHH
Confidence            999999999999999999998 8999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcccCCCChhhHHHHHHHHHHcCChhHHHHHHHHHHHCCCCCChHHHHHHHHHcccCcchHHHHHHHHHHHhcCC
Q 005966          164 AARKVFDAMWEHSVVSWNTLISGYFKNAYAKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRL  243 (667)
Q Consensus       164 ~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~  243 (667)
                      +|.++|++|+++|.++||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+.+.+.+++..+.+.|+
T Consensus       240 ~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~  319 (857)
T PLN03077        240 SARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGF  319 (857)
T ss_pred             HHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhHHHHHHHHHHhcCCHHHHHHHHhhcCCCChhHHHHHHHHHHhCCChHHHHHHHHHHHhcCCCCChhhHHHHHHHh
Q 005966          244 GKNIAAWNALVDMYVKCGSVNEARLVFDRMSERDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSAC  323 (667)
Q Consensus       244 ~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~t~~~ll~~~  323 (667)
                      .||..+|+.|+.+|+++|++++|.++|++|.+||..+||.+|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|
T Consensus       320 ~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~  399 (857)
T PLN03077        320 AVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSAC  399 (857)
T ss_pred             ccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccchHHHHHHHHHHHHhcCCCCchHHhHHHHHHHhcCCHHHHHHHHhccCCCCcccHHHHHHHHHhCCChHHHHHHHH
Q 005966          324 SSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFR  403 (667)
Q Consensus       324 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~  403 (667)
                      ++.|+++.+.++++.+.+.|+.++..++++|+++|+++|++++|.++|++|.++|.++|+.+|.+|++.|+.++|+++|+
T Consensus       400 ~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~  479 (857)
T PLN03077        400 ACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFR  479 (857)
T ss_pred             hccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHhCcCCHHHHHHHHHHHHHhCCCCCchHHHHHHHHHHhcCCHHHHHHHHhhCCCCCCCcc
Q 005966          404 QMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDKDIV  483 (667)
Q Consensus       404 ~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~  483 (667)
                      +|.. +++||..||+.++.+|++.|+++.+.+++..+.+.|+.++..++++|+++|+++|++++|.++|+.+ .  ||..
T Consensus       480 ~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~--~d~~  555 (857)
T PLN03077        480 QMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-E--KDVV  555 (857)
T ss_pred             HHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-C--CChh
Confidence            9986 6999999999999999999999999999999999999999999999999999999999999999999 4  9999


Q ss_pred             hHHHHHHHHHHcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHhHHhcCCCCchhHHHHHHHHH
Q 005966          484 VWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENHQTCSRADHYTCIVDLL  563 (667)
Q Consensus       484 ~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~l~~~~  563 (667)
                      +||++|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|.+.|++++|.++|+.|.+..++.|+..+|++++++|
T Consensus       556 s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l  635 (857)
T PLN03077        556 SWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLL  635 (857)
T ss_pred             hHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999997689999999999999999


Q ss_pred             hhcCChHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhccCCCCCchHHHHHHHHhhcCCchHHHHHHH
Q 005966          564 GRAGRLDEAYDLIRTMPLKPTHAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSAVRRWKDAENVRD  643 (667)
Q Consensus       564 ~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~  643 (667)
                      ++.|++++|.+++++|+.+||..+|.+|+.+|..+|+.+.|+...+++++++|+++..|..|+++|...|+|++|.++++
T Consensus       636 ~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~  715 (857)
T PLN03077        636 GRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRK  715 (857)
T ss_pred             HhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhCCCccCCCeeEEEeCCEec
Q 005966          644 VMDEKGLRKAPAHSLIEVRNILT  666 (667)
Q Consensus       644 ~~~~~~~~~~~~~~~~~~~~~~~  666 (667)
                      .|+++|++|+||+|||+|+++++
T Consensus       716 ~M~~~g~~k~~g~s~ie~~~~~~  738 (857)
T PLN03077        716 TMRENGLTVDPGCSWVEVKGKVH  738 (857)
T ss_pred             HHHHcCCCCCCCccEEEECCEEE
Confidence            99999999999999999999875



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query667
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 72.9 bits (177), Expect = 2e-13
 Identities = 14/138 (10%), Positives = 46/138 (33%), Gaps = 7/138 (5%)

Query: 193 AKEALVVFDWMLKSGVEPDCASVVSVLPACGYLKEIEMGRMIHELVAGGRLGKNIAAWNA 252
            + A  + D   ++   P    +  +L        +++ +      +  +L        A
Sbjct: 73  KQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLA 132

Query: 253 LVDMYVKCGSVNEARLVFDRMSER-------DVVTWTSMINGYALNGDVRNALGLFQLMQ 305
                +    +  A  +      +        +  + +++ G+A  G  +  + +  +++
Sbjct: 133 FFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVK 192

Query: 306 FEGVRPNSLTIGSLLSAC 323
             G+ P+ L+  + L   
Sbjct: 193 DAGLTPDLLSYAAALQCM 210


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query667
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.75
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.63
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.59
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.54
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.54
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.54
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.51
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.51
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.46
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.45
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.45
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.43
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.42
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.4
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.39
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.37
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.36
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.33
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.28
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.25
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.22
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.21
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.19
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.19
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.18
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.15
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.15
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.14
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.14
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.12
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.03
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.03
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.01
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.99
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.97
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.95
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.95
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.95
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.94
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.93
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.93
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.9
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.89
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.88
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.85
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.83
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.81
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.81
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.8
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.8
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.8
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.8
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.77
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.76
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.75
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.73
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.72
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.68
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.67
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.66
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.66
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.66
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.66
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.65
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.64
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.63
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.63
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.61
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.61
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.61
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.59
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.59
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.57
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.52
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.49
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.48
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.48
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.48
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.48
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.47
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.46
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.45
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.44
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.44
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.44
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.43
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.41
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.41
3k9i_A117 BH0479 protein; putative protein binding protein, 98.4
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.4
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.4
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.39
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.38
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.37
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.37
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.36
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.36
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.33
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.32
3k9i_A117 BH0479 protein; putative protein binding protein, 98.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.21
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.2
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.17
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.16
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.15
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.06
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.03
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.99
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.94
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.91
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.76
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.66
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.65
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.63
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.54
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.52
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.51
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.48
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.41
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.37
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.36
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.28
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.22
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.14
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.14
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.92
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.77
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.73
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.49
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.37
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.32
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.3
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.18
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.76
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.71
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.68
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.67
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.37
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.92
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.92
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.82
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.59
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.25
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.58
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.79
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.66
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.25
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.62
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.62
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.42
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.24
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 91.17
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.56
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.45
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.35
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.18
2uwj_G115 Type III export protein PSCG; virulence, chaperone 88.7
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.43
2p58_C116 Putative type III secretion protein YSCG; type III 88.32
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.21
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 87.57
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 87.34
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 86.63
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.57
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.8
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 85.34
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 83.89
2uwj_G115 Type III export protein PSCG; virulence, chaperone 83.03
2p58_C116 Putative type III secretion protein YSCG; type III 82.61
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 81.25
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.85
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.77
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.24
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2.8e-42  Score=369.62  Aligned_cols=503  Identities=8%  Similarity=-0.054  Sum_probs=391.7

Q ss_pred             hHhhhcCChhhHHHhhcccCCCCcchHHHHHHHHHhCCCchHHHHHHHHhHHcCCCCCCcccHHHHHHHhccccchHHHH
Q 005966           52 SLVRAYGHVSNVRILFDEMSERSSFLYNTVMKMYAQNGASHDSLKMFLGMLRLGEYNPDNYTYPIVIKACTDLAWRKLGI  131 (667)
Q Consensus        52 ~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~  131 (667)
                      ..+...|....+...|+.++.+++..|+.++..+.+.|++++|+.+|+++...   .|+..++..++.+|.+.|++++|.
T Consensus        61 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~---~p~~~~~~~l~~~~~~~g~~~~A~  137 (597)
T 2xpi_A           61 NNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDI---TGNPNDAFWLAQVYCCTGDYARAK  137 (597)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH---HCCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             ccccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHhh---CCCchHHHHHHHHHHHcCcHHHHH
Confidence            44566788888899999998889999999999999999999999999999965   678899999999999999999999


Q ss_pred             HHHHHHHHhCCCCchHHHHHHHHHHHhcCCHHHHHHHhcccCCC-------------------ChhhHHHHHHHHHHcCC
Q 005966          132 ALHGRVLITGFDMDTFVGNCLIAMYMNFGEVKAARKVFDAMWEH-------------------SVVSWNTLISGYFKNAY  192 (667)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~~~~~  192 (667)
                      .+|+.+...  +++..+++.++.+|.+.|++++|+++|+++...                   +..+|+.++.+|.+.|+
T Consensus       138 ~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  215 (597)
T 2xpi_A          138 CLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSN  215 (597)
T ss_dssp             HHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCC
Confidence            999988654  688999999999999999999999999965433                   47899999999999999


Q ss_pred             hhHHHHHHHHHHHCCCCCC-hHHHHHHHHHcccCcchHHH--HHH-HHHHHhcCCCcchhHHHHHHHHHHhcCCHHHHHH
Q 005966          193 AKEALVVFDWMLKSGVEPD-CASVVSVLPACGYLKEIEMG--RMI-HELVAGGRLGKNIAAWNALVDMYVKCGSVNEARL  268 (667)
Q Consensus       193 ~~~A~~~~~~m~~~g~~p~-~~~~~~ll~~~~~~~~~~~a--~~~-~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~  268 (667)
                      +++|+++|++|.+.  .|+ ...+..+...+...+..+.+  ..+ +..+...+..+...+|+.++..|.+.|++++|.+
T Consensus       216 ~~~A~~~~~~~~~~--~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~  293 (597)
T 2xpi_A          216 FDRAKECYKEALMV--DAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAED  293 (597)
T ss_dssp             HHHHHHHHHHHHHH--CTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHh--CchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHH
Confidence            99999999999885  354 34455555544444333322  222 5555555555566677888889999999999999


Q ss_pred             HHhhcCC--CChhHHHHHHHHHHhCCChHHHHHHHHHHHhcCCCCChhhHHHHHHHhhcccchHHHHHHHHHHHHhcCCC
Q 005966          269 VFDRMSE--RDVVTWTSMINGYALNGDVRNALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLEC  346 (667)
Q Consensus       269 ~~~~~~~--~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~  346 (667)
                      +|+++.+  ++..+|+.++..|.+.|++++|+++|+++.+.+  |+                                  
T Consensus       294 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~~----------------------------------  337 (597)
T 2xpi_A          294 YLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID--PY----------------------------------  337 (597)
T ss_dssp             HHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TT----------------------------------
T ss_pred             HHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC--cc----------------------------------
Confidence            9999987  788899999999999999999999999987643  21                                  


Q ss_pred             CchHHhHHHHHHHhcCCHHHHHHHHhccCCCCcccHHHHHHHHHhCCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhC
Q 005966          347 EVIVETALIDMYAKCNLVKLSFQVFARTSKKKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAI  426 (667)
Q Consensus       347 ~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~  426 (667)
                                                     +..+|+.++.++.+.|++++|.++++++.+. .+.+..++..+...|.+
T Consensus       338 -------------------------------~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~  385 (597)
T 2xpi_A          338 -------------------------------NLDVYPLHLASLHESGEKNKLYLISNDLVDR-HPEKAVTWLAVGIYYLC  385 (597)
T ss_dssp             -------------------------------CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHH-CTTSHHHHHHHHHHHHH
T ss_pred             -------------------------------cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhh-CcccHHHHHHHHHHHHH
Confidence                                           1223445555556666666777777766643 23456667777777777


Q ss_pred             cCCHHHHHHHHHHHHHhCCCCCchHHHHHHHHHHhcCCHHHHHHHHhhCCCCCC-CcchHHHHHHHHHHcCChHHHHHHH
Q 005966          427 LADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSEIPIKDK-DIVVWSVIIAGYGMHGHGETAVSLF  505 (667)
Q Consensus       427 ~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~a~~~~  505 (667)
                      .|++++|.++|+.+.+.. +.+..+++.++.+|.+.|++++|.++|+++....| +..+|+.++.+|.+.|++++|.++|
T Consensus       386 ~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  464 (597)
T 2xpi_A          386 VNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYL  464 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             hccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHH
Confidence            777777777777776654 44567788888888888888888888888766554 6788999999999999999999999


Q ss_pred             HHHHHcCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHhHHhc---CCCCc--hhHHHHHHHHHhhcCChHHHHHHHHhC-
Q 005966          506 KEMVQSGVQPNEVTFTSALHACSHGGLLDEGLDLFNFMLENH---QTCSR--ADHYTCIVDLLGRAGRLDEAYDLIRTM-  579 (667)
Q Consensus       506 ~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~---~~~~~--~~~~~~l~~~~~~~g~~~~A~~~~~~~-  579 (667)
                      +++.+.. +.+..+|..++..|.+.|++++|.++|+++.+..   +..|+  ..+|..++.+|.+.|++++|.+.++++ 
T Consensus       465 ~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  543 (597)
T 2xpi_A          465 QSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGL  543 (597)
T ss_dssp             HHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             HHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHH
Confidence            9999875 4477889999999999999999999999998732   55676  778999999999999999999999987 


Q ss_pred             CCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHhhccCCCCCchHHHHHHHHhh
Q 005966          580 PLKP-THAVWGALLGACVIHGNVELGEVAAKWLFELEPENPGNYVLLSKLYSA  631 (667)
Q Consensus       580 ~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~  631 (667)
                      ...| +..+|..++.+|...|++++|...++++++++|+++.++..++.+|..
T Consensus       544 ~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          544 LLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             HHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC-
T ss_pred             HhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhc
Confidence            3344 788999999999999999999999999999999999999999988864



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 667
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.8 bits (94), Expect = 4e-04
 Identities = 41/349 (11%), Positives = 111/349 (31%), Gaps = 13/349 (3%)

Query: 245 KNIAAWNALVDMYVKCGSVNEARLVFDRMSERD---VVTWTSMINGYALNGDVRNALGLF 301
            N      L  ++ +C  ++ +        +++      ++++ N Y   G ++ A+  +
Sbjct: 31  DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHY 90

Query: 302 QLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKC 361
           +             I    +  ++       ++  +          V  +   +      
Sbjct: 91  RHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGR 150

Query: 362 NLVKLSFQVFARTSKKKTVPWNAILAGCVHN-GLARKAVELFRQMLVEVVEPNDA-TLNS 419
                +  + A  ++       + L    +  G    A+  F + +   ++PN      +
Sbjct: 151 LEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV--TLDPNFLDAYIN 208

Query: 420 LLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLIDIYSKCGSLESAHKIFSE-IPIK 478
           L           +A+  +   +     +   V   L  +Y + G ++ A   +   I ++
Sbjct: 209 LGNVLKEARIFDRAVAAYLRALSLSP-NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ 267

Query: 479 DKDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDEGLD 538
                 +  +       G    A   +   ++      +     A +     G ++E + 
Sbjct: 268 PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLA-NIKREQGNIEEAVR 326

Query: 539 LFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAY-DLIRTMPLKPTHA 586
           L+   LE     + A  ++ +  +L + G+L EA       + + PT A
Sbjct: 327 LYRKALEVFPEFAAA--HSNLASVLQQQGKLQEALMHYKEAIRISPTFA 373


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query667
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.66
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.63
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.24
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.21
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.16
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.14
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.11
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.1
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.07
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.04
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.85
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.77
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.76
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.74
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.67
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.65
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.63
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.63
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.42
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.39
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.37
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.37
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.32
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.3
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.24
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.16
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.12
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.11
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.07
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.94
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.93
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.88
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.78
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.74
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.73
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.71
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.59
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.53
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.62
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.35
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.62
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.31
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.18
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.27
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 90.12
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.25
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.7
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=7.9e-22  Score=195.99  Aligned_cols=376  Identities=11%  Similarity=0.067  Sum_probs=272.6

Q ss_pred             HHcccCcchHHHHHHHHHHHhcCCCcchhHHHHHHHHHHhcCCHHHHHHHHhhcCC---CChhHHHHHHHHHHhCCChHH
Q 005966          220 PACGYLKEIEMGRMIHELVAGGRLGKNIAAWNALVDMYVKCGSVNEARLVFDRMSE---RDVVTWTSMINGYALNGDVRN  296 (667)
Q Consensus       220 ~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~~~~~~  296 (667)
                      ..+.+.|++++|.+.++.+.+.. +.+..++..+..+|.+.|++++|...|+++.+   .+..+|..+...+.+.|++++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccc
Confidence            34556677888888887777654 33566777777777788888888888777654   345567777777777788888


Q ss_pred             HHHHHHHHHhcCCCCChhhHHHHHHHhhcccchHHHHHHHHHHHHhcCCCCchHHhHHHHHHHhcCCHHHHHHHHhccCC
Q 005966          297 ALGLFQLMQFEGVRPNSLTIGSLLSACSSLYYLKRGRSLHAWTIKQNLECEVIVETALIDMYAKCNLVKLSFQVFARTSK  376 (667)
Q Consensus       297 a~~~~~~m~~~~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~  376 (667)
                      |++.+....+.... +..............................                                ..
T Consensus        86 A~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------------~~  132 (388)
T d1w3ba_          86 AIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQY--------------------------------NP  132 (388)
T ss_dssp             HHHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHH--------------------------------CT
T ss_pred             cccccccccccccc-ccccccccccccccccccccccccccccccc--------------------------------cc
Confidence            88777777664322 1122211221122222222222211111111                                12


Q ss_pred             CCcccHHHHHHHHHhCCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhCcCCHHHHHHHHHHHHHhCCCCCchHHHHHH
Q 005966          377 KKTVPWNAILAGCVHNGLARKAVELFRQMLVEVVEPNDATLNSLLPAYAILADLQQAMNIHCYLIRYGFLSVVEVSTGLI  456 (667)
Q Consensus       377 ~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~  456 (667)
                      ................+....+...+.+..... +-+...+..+...+...|+++.|...++...+.. +.+...+..+.
T Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~  210 (388)
T d1w3ba_         133 DLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLG  210 (388)
T ss_dssp             TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHH
T ss_pred             ccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHh
Confidence            222223444455556667777777777666542 3344566677777888888888888888887765 45667788888


Q ss_pred             HHHHhcCCHHHHHHHHhhCCCCC-CCcchHHHHHHHHHHcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCCHHH
Q 005966          457 DIYSKCGSLESAHKIFSEIPIKD-KDIVVWSVIIAGYGMHGHGETAVSLFKEMVQSGVQPNEVTFTSALHACSHGGLLDE  535 (667)
Q Consensus       457 ~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~  535 (667)
                      ..+...|++++|...++...... .+...+..+...+.+.|++++|+..|++..+.. +-+..++..+...+...|++++
T Consensus       211 ~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~  289 (388)
T d1w3ba_         211 NVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAE  289 (388)
T ss_dssp             HHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHH
T ss_pred             hhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHH
Confidence            89999999999999988776654 355677888889999999999999999998864 2345678889999999999999


Q ss_pred             HHHHHHHhHHhcCCCCchhHHHHHHHHHhhcCChHHHHHHHHhC-CCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHhhc
Q 005966          536 GLDLFNFMLENHQTCSRADHYTCIVDLLGRAGRLDEAYDLIRTM-PLKP-THAVWGALLGACVIHGNVELGEVAAKWLFE  613 (667)
Q Consensus       536 A~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~-~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  613 (667)
                      |.+.++....  ..+.+...+..++.++.+.|++++|++.+++. ...| +..++..++..+...|++++|+..++++++
T Consensus       290 A~~~~~~~~~--~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         290 AEDCYNTALR--LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHHHhhhc--cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            9999999887  44566778888999999999999999999986 5666 567888999999999999999999999999


Q ss_pred             cCCCCCchHHHHHHHHhhcCC
Q 005966          614 LEPENPGNYVLLSKLYSAVRR  634 (667)
Q Consensus       614 ~~p~~~~~~~~l~~~~~~~g~  634 (667)
                      ++|+++.++..|+.+|.+.||
T Consensus       368 l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         368 ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TCTTCHHHHHHHHHHHHHTCC
T ss_pred             hCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure