Citrus Sinensis ID: 006630


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------64
MQRSSSKALSLLTKHRRFSFAPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVDGRKRRARQRRWGGGRSKAKIL
ccccHHHHHHHHHHHHHccccccHHcHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHccc
ccccHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEHHHHHccc
MQRSSSKALSLLTKhrrfsfaprpntttshvesTATTTNQLNSNLVclktkeddckcnnttdthgshnefshDVEKIFRILKKFHSRLPKLELALQhsgvvlrpgltervinrcgdagnlGYRYYMWaskqpnyvhSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLdempkygcepdefVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMkdagfepdIVVYNNLLSGYAQMGKMTDAFELLKEMRrkgcdpnansYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMiqrgilpnQLTYLHIMLAHEKKEELEECVELMGEMrkigcvpdvsnyNVVIRLACKLGELKEAVNVWNEmeaaslspgtdsFVVMVHGFLGQGCLIEACEYFKEMVGrgllsapqyGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLdmmdadvmpqpDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVDGRKRRARqrrwgggrskakil
MQRSSSKALSLLtkhrrfsfaprpntttshvestatttnqlnsNLVCLKTKEDDCKCNNTtdthgshnefshDVEKIFRILKKFHSRLPKLELalqhsgvvlrpgltervinRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRkekpqlitTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRrkgcdpnanSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTlisgfcksrKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKigcvpdvsnYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFkmykrrgerdlkekakkqvdgrkrrarqrrwgggrskakil
MQRSSSKALSLLTKHRRFSFAPRPNtttshvestatttNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHekkeeleecvelmgemRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVDgrkrrarqrrwgggrSKAKIL
*******************************************NLVCLKTKEDDCKCNNT*******NEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFK****************************************
*****SK**SLLTKHRRFSFAPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVDG****ARQRRWGGGRSKAKIL
**********LLTKHRRFSFAPR************TTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGE*********************************
*QRSSSKALSLLTKHRRFSFAPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVDGRKRRARQRRWGGGRSKAKIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRSSSKALSLLTKHRRFSFAPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVDGRKRRARQRRWGGGRSKAKIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query638 2.2.26 [Sep-21-2011]
Q9FH87637 Putative pentatricopeptid yes no 0.942 0.943 0.657 0.0
P0C8A0638 Pentatricopeptide repeat- no no 0.894 0.894 0.679 0.0
Q9FVX2517 Pentatricopeptide repeat- no no 0.722 0.891 0.330 8e-71
Q9C9A2510 Pentatricopeptide repeat- no no 0.652 0.815 0.330 7e-70
Q9LZP3599 Pentatricopeptide repeat- no no 0.677 0.721 0.311 1e-62
Q3EAF8599 Pentatricopeptide repeat- no no 0.677 0.721 0.308 1e-61
Q9LEQ7598 Pentatricopeptide repeat- no no 0.677 0.722 0.308 2e-61
Q9LFQ4572 Pentatricopeptide repeat- no no 0.644 0.718 0.310 9e-61
Q3EDF8598 Pentatricopeptide repeat- no no 0.625 0.667 0.312 6e-58
Q9SSR6523 Pentatricopeptide repeat- no no 0.670 0.818 0.291 5e-56
>sp|Q9FH87|PP447_ARATH Putative pentatricopeptide repeat-containing protein At5g65820 OS=Arabidopsis thaliana GN=At5g65820 PE=3 SV=1 Back     alignment and function desciption
 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/611 (65%), Positives = 501/611 (81%), Gaps = 10/611 (1%)

Query: 17  RFSFAPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEK 76
           RF    R    +  +E     +N +   LVCL+      K +N    +  ++EF+ DVEK
Sbjct: 34  RFDLIHRSFHVSRALEDNFRRSNGIG--LVCLE------KSHNDRTKNSKYDEFASDVEK 85

Query: 77  IFRILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVH 136
            +RIL+KFHSR+PKLELAL  SGV LRPGL ERV+NRCGDAGNLGYR+++WA+KQP Y H
Sbjct: 86  SYRILRKFHSRVPKLELALNESGVELRPGLIERVLNRCGDAGNLGYRFFVWAAKQPRYCH 145

Query: 137 SYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEV 196
           S +VY++++K LSKMR+FGAVW L+EEMRKE PQLI  E+FV+L++RFASA MVKKAIEV
Sbjct: 146 SIEVYKSMVKILSKMRQFGAVWGLIEEMRKENPQLIEPELFVVLVQRFASADMVKKAIEV 205

Query: 197 LDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKE 256
           LDEMPK+G EPDE+VFGCLLDALCK+ SVK+AAKLF++MR RF  +LR+FTSLLYGWC+ 
Sbjct: 206 LDEMPKFGFEPDEYVFGCLLDALCKHGSVKDAAKLFEDMRMRFPVNLRYFTSLLYGWCRV 265

Query: 257 GKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSY 316
           GK++EAKYVLVQM +AGFEPDIV Y NLLSGYA  GKM DA++LL++MRR+G +PNAN Y
Sbjct: 266 GKMMEAKYVLVQMNEAGFEPDIVDYTNLLSGYANAGKMADAYDLLRDMRRRGFEPNANCY 325

Query: 317 TVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQ 376
           TVLIQALC++++MEEA + FVEMER  CEADVVTYT L+SGFCK  KID+CY +LD MI+
Sbjct: 326 TVLIQALCKVDRMEEAMKVFVEMERYECEADVVTYTALVSGFCKWGKIDKCYIVLDDMIK 385

Query: 377 RGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKE 436
           +G++P++LTY+HIM+AHEKKE  EEC+ELM +MR+I   PD+  YNVVIRLACKLGE+KE
Sbjct: 386 KGLMPSELTYMHIMVAHEKKESFEECLELMEKMRQIEYHPDIGIYNVVIRLACKLGEVKE 445

Query: 437 AVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKAL 496
           AV +WNEME   LSPG D+FV+M++G   QGCL+EA ++FKEMV RGL S  QYGTLK L
Sbjct: 446 AVRLWNEMEENGLSPGVDTFVIMINGLASQGCLLEASDHFKEMVTRGLFSVSQYGTLKLL 505

Query: 497 LNSLLRAQKVEMAKDVWSCIVTKG-CELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDAD 555
           LN++L+ +K+EMAKDVWSCI +KG CELNV +WTIWIH+LFS G+ KEACSYC++M++ D
Sbjct: 506 LNTVLKDKKLEMAKDVWSCITSKGACELNVLSWTIWIHALFSKGYEKEACSYCIEMIEMD 565

Query: 556 VMPQPDTFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQ 615
            MPQPDTFAKLM+GLKKLYNR+ A EITEKVR MAAER+++FKMYKRRG +DL EKAK +
Sbjct: 566 FMPQPDTFAKLMKGLKKLYNREFAGEITEKVRNMAAEREMSFKMYKRRGVQDLTEKAKSK 625

Query: 616 VDGRKRRARQR 626
            D R+ + +QR
Sbjct: 626 QD-REGKKKQR 635





Arabidopsis thaliana (taxid: 3702)
>sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 Back     alignment and function description
>sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 Back     alignment and function description
>sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 Back     alignment and function description
>sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query638
359496995622 PREDICTED: putative pentatricopeptide re 0.921 0.945 0.741 0.0
449463822641 PREDICTED: pentatricopeptide repeat-cont 0.990 0.985 0.686 0.0
356557306654 PREDICTED: putative pentatricopeptide re 0.948 0.925 0.728 0.0
147767159655 hypothetical protein VITISV_021787 [Viti 0.847 0.825 0.787 0.0
449494638664 PREDICTED: pentatricopeptide repeat-cont 0.907 0.871 0.742 0.0
356547370628 PREDICTED: putative pentatricopeptide re 0.968 0.984 0.716 0.0
224068054602 predicted protein [Populus trichocarpa] 0.874 0.926 0.774 0.0
255579531596 pentatricopeptide repeat-containing prot 0.907 0.971 0.710 0.0
15239161637 pentatricopeptide repeat-containing prot 0.942 0.943 0.657 0.0
297819626 1188 pentatricopeptide repeat-containing prot 0.855 0.459 0.699 0.0
>gi|359496995|ref|XP_003635394.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/596 (74%), Positives = 511/596 (85%), Gaps = 8/596 (1%)

Query: 24  PNTTTSHVESTATTTNQLNSN--LVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRIL 81
           PN   S+      T ++      LV L++  ++C  +   D      EFS DVEK++RIL
Sbjct: 12  PNHRLSNFGDKNCTISERRGGFGLVRLESNRENCTYDQNYD------EFSADVEKVYRIL 65

Query: 82  KKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVY 141
           +KFHSR+PKLELALQ SGV +R GLTERV+NRCGDAGNLGYR+++WASKQP Y HSY+VY
Sbjct: 66  RKFHSRVPKLELALQESGVAVRSGLTERVLNRCGDAGNLGYRFFVWASKQPGYRHSYEVY 125

Query: 142 RALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMP 201
           +A+IK L KMR+FGAVWAL+EEMR+E PQ ++  VFV+LMRRFASARMVKKAIEVLDEMP
Sbjct: 126 KAMIKILGKMRQFGAVWALIEEMRRENPQFVSPYVFVVLMRRFASARMVKKAIEVLDEMP 185

Query: 202 KYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVE 261
           KYGCEPDE VFGCLLDALCKN SVKEAA LF++MR RF P+L+HFTSLLYGWC+EGKL+E
Sbjct: 186 KYGCEPDEHVFGCLLDALCKNGSVKEAASLFEDMRIRFTPTLKHFTSLLYGWCREGKLME 245

Query: 262 AKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQ 321
           AKYVLVQ+++AGFEPDIVVYNNLL+GYA  GKM DA++LLKEMRRK C+PN  S+T LIQ
Sbjct: 246 AKYVLVQIREAGFEPDIVVYNNLLTGYAAAGKMVDAYDLLKEMRRKECEPNVMSFTTLIQ 305

Query: 322 ALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILP 381
           ALC  +KMEEA R F EM+  GC AD VTYTTLISGFCK  KI + YE+LD+MIQ+G +P
Sbjct: 306 ALCAKKKMEEAMRVFFEMQSCGCPADAVTYTTLISGFCKWGKISKGYELLDNMIQQGHIP 365

Query: 382 NQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELKEAVNVW 441
           N +TYLHIM AHEKKEELEEC+ELM EMRKIGC PD++ YN+VIRLACKLGE+KE V VW
Sbjct: 366 NPMTYLHIMAAHEKKEELEECIELMEEMRKIGCTPDLNIYNIVIRLACKLGEIKEGVRVW 425

Query: 442 NEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLL 501
           NEMEA  LSPG D+FV+M+HGFL Q CL+EACE+FKEMVGRGLLSAPQYGTLK LLNSLL
Sbjct: 426 NEMEATGLSPGLDTFVIMIHGFLSQRCLVEACEFFKEMVGRGLLSAPQYGTLKELLNSLL 485

Query: 502 RAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPD 561
           RA+K+EM+KDVWSCI+TKGC+LNVYAWTIWIH+LFSNGHVKEACSYCLDMMDA VMPQPD
Sbjct: 486 RAEKLEMSKDVWSCIMTKGCDLNVYAWTIWIHALFSNGHVKEACSYCLDMMDAGVMPQPD 545

Query: 562 TFAKLMRGLKKLYNRQIAAEITEKVRKMAAERQITFKMYKRRGERDLKEKAKKQVD 617
           TFAKLMRGL+KLYNRQIAAEITEKVRKMAAER++TFKMYKRRGER+LKEK K+  D
Sbjct: 546 TFAKLMRGLRKLYNRQIAAEITEKVRKMAAEREMTFKMYKRRGERNLKEKIKEAKD 601




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449463822|ref|XP_004149630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356557306|ref|XP_003546958.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Glycine max] Back     alignment and taxonomy information
>gi|147767159|emb|CAN71515.1| hypothetical protein VITISV_021787 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449494638|ref|XP_004159605.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356547370|ref|XP_003542086.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Glycine max] Back     alignment and taxonomy information
>gi|224068054|ref|XP_002302657.1| predicted protein [Populus trichocarpa] gi|222844383|gb|EEE81930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255579531|ref|XP_002530608.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529856|gb|EEF31788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15239161|ref|NP_201383.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170571|sp|Q9FH87.1|PP447_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g65820 gi|9758569|dbj|BAB09050.1| unnamed protein product [Arabidopsis thaliana] gi|332010728|gb|AED98111.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297819626|ref|XP_002877696.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323534|gb|EFH53955.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query638
TAIR|locus:2156213637 AT5G65820 [Arabidopsis thalian 0.888 0.890 0.667 1.8e-213
TAIR|locus:2097395638 AT3G49730 [Arabidopsis thalian 0.855 0.855 0.681 1.3e-211
TAIR|locus:2026346510 AT1G71060 [Arabidopsis thalian 0.691 0.864 0.324 2.8e-66
TAIR|locus:2096099599 AT3G62470 "AT3G62470" [Arabido 0.673 0.717 0.312 4.5e-59
TAIR|locus:2096074599 AT3G62540 "AT3G62540" [Arabido 0.670 0.714 0.312 2.5e-58
TAIR|locus:2185455598 AT5G14820 "AT5G14820" [Arabido 0.670 0.715 0.312 3.2e-58
TAIR|locus:2094394562 AT3G22670 [Arabidopsis thalian 0.697 0.791 0.280 1.3e-54
TAIR|locus:2035206523 AT1G52640 [Arabidopsis thalian 0.670 0.818 0.287 2.4e-51
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.644 0.687 0.296 4e-51
TAIR|locus:2012883537 AT1G20300 [Arabidopsis thalian 0.650 0.772 0.262 5.2e-49
TAIR|locus:2156213 AT5G65820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2063 (731.3 bits), Expect = 1.8e-213, P = 1.8e-213
 Identities = 383/574 (66%), Positives = 473/574 (82%)

Query:    45 LVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIFRILKKFHSRLPKLELALQHSGVVLRP 104
             LVCL+      K +N    +  ++EF+ DVEK +RIL+KFHSR+PKLELAL  SGV LRP
Sbjct:    60 LVCLE------KSHNDRTKNSKYDEFASDVEKSYRILRKFHSRVPKLELALNESGVELRP 113

Query:   105 GLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEM 164
             GL ERV+NRCGDAGNLGYR+++WA+KQP Y HS +VY++++K LSKMR+FGAVW L+EEM
Sbjct:   114 GLIERVLNRCGDAGNLGYRFFVWAAKQPRYCHSIEVYKSMVKILSKMRQFGAVWGLIEEM 173

Query:   165 RKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSS 224
             RKE PQLI  E+FV+L++RFASA MVKKAIEVLDEMPK+G EPDE+VFGCLLDALCK+ S
Sbjct:   174 RKENPQLIEPELFVVLVQRFASADMVKKAIEVLDEMPKFGFEPDEYVFGCLLDALCKHGS 233

Query:   225 VKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNL 284
             VK+AAKLF++MR RF  +LR+FTSLLYGWC+ GK++EAKYVLVQM +AGFEPDIV Y NL
Sbjct:   234 VKDAAKLFEDMRMRFPVNLRYFTSLLYGWCRVGKMMEAKYVLVQMNEAGFEPDIVDYTNL 293

Query:   285 LSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGC 344
             LSGYA  GKM DA++LL++MRR+G +PNAN YTVLIQALC++++MEEA + FVEMER  C
Sbjct:   294 LSGYANAGKMADAYDLLRDMRRRGFEPNANCYTVLIQALCKVDRMEEAMKVFVEMERYEC 353

Query:   345 EADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHXXXXXXXXXXX 404
             EADVVTYT L+SGFCK  KID+CY +LD MI++G++P++LTY+HIM+AH           
Sbjct:   354 EADVVTYTALVSGFCKWGKIDKCYIVLDDMIKKGLMPSELTYMHIMVAHEKKESFEECLE 413

Query:   405 XXXXXRKIGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFL 464
                  R+I   PD+  YNVVIRLACKLGE+KEAV +WNEME   LSPG D+FV+M++G  
Sbjct:   414 LMEKMRQIEYHPDIGIYNVVIRLACKLGEVKEAVRLWNEMEENGLSPGVDTFVIMINGLA 473

Query:   465 GQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSCIVTKG-CEL 523
              QGCL+EA ++FKEMV RGL S  QYGTLK LLN++L+ +K+EMAKDVWSCI +KG CEL
Sbjct:   474 SQGCLLEASDHFKEMVTRGLFSVSQYGTLKLLLNTVLKDKKLEMAKDVWSCITSKGACEL 533

Query:   524 NVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGLKKLYNRQIAAEIT 583
             NV +WTIWIH+LFS G+ KEACSYC++M++ D MPQPDTFAKLM+GLKKLYNR+ A EIT
Sbjct:   534 NVLSWTIWIHALFSKGYEKEACSYCIEMIEMDFMPQPDTFAKLMKGLKKLYNREFAGEIT 593

Query:   584 EKVRKMAAERQITFKMYKRRGERDLKEKAKKQVD 617
             EKVR MAAER+++FKMYKRRG +DL EKAK + D
Sbjct:   594 EKVRNMAAEREMSFKMYKRRGVQDLTEKAKSKQD 627




GO:0005739 "mitochondrion" evidence=ISM
TAIR|locus:2097395 AT3G49730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026346 AT1G71060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096099 AT3G62470 "AT3G62470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096074 AT3G62540 "AT3G62540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185455 AT5G14820 "AT5G14820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094394 AT3G22670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035206 AT1G52640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012883 AT1G20300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FH87PP447_ARATHNo assigned EC number0.65790.94200.9434yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.II.687.1
hypothetical protein (602 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-24
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-19
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-18
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-15
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-15
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-12
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-10
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-07
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-06
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-06
pfam0153531 pfam01535, PPR, PPR repeat 9e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-04
pfam10037417 pfam10037, MRP-S27, Mitochondrial 28S ribosomal pr 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  107 bits (268), Expect = 5e-24
 Identities = 78/320 (24%), Positives = 149/320 (46%), Gaps = 23/320 (7%)

Query: 128 ASKQPNYVHSYDVYRALIKSLSKM----RKFGAVWALMEEMRKEKPQLITTEVFVILMRR 183
           A  + N VH++    ALI   ++     + FGA + +M   +  KP  +   VF  L+  
Sbjct: 501 AGVEAN-VHTFG---ALIDGCARAGQVAKAFGA-YGIMRS-KNVKPDRV---VFNALISA 551

Query: 184 FASARMVKKAIEVLDEM--PKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRE-RFK 240
              +  V +A +VL EM    +  +PD    G L+ A      V  A +++  + E   K
Sbjct: 552 CGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIK 611

Query: 241 PSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFEL 300
            +   +T  +    ++G    A  +   MK  G +PD V ++ L+      G +  AFE+
Sbjct: 612 GTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEI 671

Query: 301 LKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLISGFCK 360
           L++ R++G      SY+ L+ A    +  ++A   + +++       V T   LI+  C+
Sbjct: 672 LQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCE 731

Query: 361 SRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSN 420
             ++ +  E+L  M + G+ PN +TY  +++A E+K++ +  ++L+ + ++ G  P++  
Sbjct: 732 GNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVM 791

Query: 421 YNVVIRL-------ACKLGE 433
              +  L       AC LGE
Sbjct: 792 CRCITGLCLRRFEKACALGE 811


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|220535 pfam10037, MRP-S27, Mitochondrial 28S ribosomal protein S27 Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 638
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.92
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.9
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
PRK14574 822 hmsH outer membrane protein; Provisional 99.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.89
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
KOG2003840 consensus TPR repeat-containing protein [General f 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
KOG1915677 consensus Cell cycle control protein (crooked neck 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.76
KOG2003840 consensus TPR repeat-containing protein [General f 99.76
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.73
KOG2076 895 consensus RNA polymerase III transcription factor 99.72
KOG2076 895 consensus RNA polymerase III transcription factor 99.72
KOG1915677 consensus Cell cycle control protein (crooked neck 99.71
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.67
KOG0547606 consensus Translocase of outer mitochondrial membr 99.66
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.65
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.6
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.58
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.57
KOG0547606 consensus Translocase of outer mitochondrial membr 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.54
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.51
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.48
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.48
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.47
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.44
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.41
PRK12370553 invasion protein regulator; Provisional 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.39
PRK12370553 invasion protein regulator; Provisional 99.38
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.37
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.37
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.37
KOG1129478 consensus TPR repeat-containing protein [General f 99.34
KOG2376652 consensus Signal recognition particle, subunit Srp 99.34
KOG1129478 consensus TPR repeat-containing protein [General f 99.31
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.28
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.27
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.27
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.26
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.26
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.25
PF1304150 PPR_2: PPR repeat family 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.25
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.22
PF1304150 PPR_2: PPR repeat family 99.21
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.21
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.18
PRK11189296 lipoprotein NlpI; Provisional 99.18
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.16
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.16
PRK11189296 lipoprotein NlpI; Provisional 99.13
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.13
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.12
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.12
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.07
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.06
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.05
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.05
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.04
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.0
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.98
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.94
PRK04841903 transcriptional regulator MalT; Provisional 98.93
PRK04841903 transcriptional regulator MalT; Provisional 98.92
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.89
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.85
KOG1125579 consensus TPR repeat-containing protein [General f 98.81
PLN02789320 farnesyltranstransferase 98.81
KOG1125579 consensus TPR repeat-containing protein [General f 98.8
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.79
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.79
PLN02789320 farnesyltranstransferase 98.79
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.76
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.72
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.7
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.69
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.68
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.66
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.65
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.64
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.63
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.62
PRK10370198 formate-dependent nitrite reductase complex subuni 98.62
PF1285434 PPR_1: PPR repeat 98.6
PF1285434 PPR_1: PPR repeat 98.59
PRK15359144 type III secretion system chaperone protein SscB; 98.58
PRK10370198 formate-dependent nitrite reductase complex subuni 98.55
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.54
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.54
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.51
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.48
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.47
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.45
PRK15359144 type III secretion system chaperone protein SscB; 98.45
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.42
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.41
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.38
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.36
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.29
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.26
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.21
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.19
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.06
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.06
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.03
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.02
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.01
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.97
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.96
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.95
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.91
KOG20411189 consensus WD40 repeat protein [General function pr 97.91
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.88
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.87
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.86
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.84
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.8
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.78
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.73
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.73
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.72
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.71
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.69
COG4700251 Uncharacterized protein conserved in bacteria cont 97.65
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.64
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.64
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.64
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.64
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.59
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.59
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.58
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.57
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.55
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.53
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.53
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.47
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.45
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.44
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.44
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.43
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.43
PF12688120 TPR_5: Tetratrico peptide repeat 97.41
PF12688120 TPR_5: Tetratrico peptide repeat 97.4
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.37
KOG0553304 consensus TPR repeat-containing protein [General f 97.37
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.37
PRK10803263 tol-pal system protein YbgF; Provisional 97.37
PRK15331165 chaperone protein SicA; Provisional 97.34
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.32
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.31
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.3
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.3
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.26
COG4700251 Uncharacterized protein conserved in bacteria cont 97.25
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.25
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.24
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.23
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.23
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.19
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.17
COG3898531 Uncharacterized membrane-bound protein [Function u 97.1
PF1337173 TPR_9: Tetratricopeptide repeat 97.1
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.99
PRK10803263 tol-pal system protein YbgF; Provisional 96.95
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.93
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.93
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.84
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.82
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.78
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.76
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.75
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.71
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.62
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.59
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.53
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.48
PF1342844 TPR_14: Tetratricopeptide repeat 96.46
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.35
PF1337173 TPR_9: Tetratricopeptide repeat 96.35
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.25
PRK15331165 chaperone protein SicA; Provisional 96.2
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.17
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.15
KOG1258577 consensus mRNA processing protein [RNA processing 96.11
KOG4234271 consensus TPR repeat-containing protein [General f 96.1
PRK11906458 transcriptional regulator; Provisional 96.07
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.04
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.01
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.0
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.93
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.92
PF13512142 TPR_18: Tetratricopeptide repeat 95.88
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.81
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.78
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.76
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.72
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.7
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.68
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.62
COG3898531 Uncharacterized membrane-bound protein [Function u 95.61
KOG1258577 consensus mRNA processing protein [RNA processing 95.61
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.59
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.59
KOG4555175 consensus TPR repeat-containing protein [Function 95.56
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.47
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.47
KOG1585308 consensus Protein required for fusion of vesicles 95.45
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.36
PRK11906458 transcriptional regulator; Provisional 95.31
smart00299140 CLH Clathrin heavy chain repeat homology. 95.21
KOG4555175 consensus TPR repeat-containing protein [Function 95.18
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.13
smart00299140 CLH Clathrin heavy chain repeat homology. 95.03
KOG4648 536 consensus Uncharacterized conserved protein, conta 94.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.91
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.89
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 94.83
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 94.83
PF13512142 TPR_18: Tetratricopeptide repeat 94.83
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.79
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 94.73
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.72
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.72
KOG1550552 consensus Extracellular protein SEL-1 and related 94.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.64
PF1343134 TPR_17: Tetratricopeptide repeat 94.62
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.48
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.48
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.46
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.45
KOG4234271 consensus TPR repeat-containing protein [General f 94.37
KOG20411189 consensus WD40 repeat protein [General function pr 94.32
PF1342844 TPR_14: Tetratricopeptide repeat 94.31
KOG3941406 consensus Intermediate in Toll signal transduction 94.24
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.1
KOG1585308 consensus Protein required for fusion of vesicles 94.09
KOG3941406 consensus Intermediate in Toll signal transduction 94.07
COG3629280 DnrI DNA-binding transcriptional activator of the 93.88
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.79
COG1747 711 Uncharacterized N-terminal domain of the transcrip 93.75
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 93.56
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.5
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.02
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 92.96
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.81
KOG4648 536 consensus Uncharacterized conserved protein, conta 92.24
KOG4570418 consensus Uncharacterized conserved protein [Funct 92.16
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.1
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.08
PRK09687280 putative lyase; Provisional 91.77
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.65
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.63
COG3629280 DnrI DNA-binding transcriptional activator of the 91.53
KOG3364149 consensus Membrane protein involved in organellar 91.52
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 91.49
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 91.23
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.0
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.44
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.32
PF1343134 TPR_17: Tetratricopeptide repeat 90.25
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.09
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.64
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 89.42
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.4
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 89.35
PF06552186 TOM20_plant: Plant specific mitochondrial import r 89.3
KOG1550552 consensus Extracellular protein SEL-1 and related 89.26
KOG1586288 consensus Protein required for fusion of vesicles 88.84
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.74
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.09
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.03
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.9
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.52
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.31
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 86.01
PRK12798421 chemotaxis protein; Reviewed 85.92
KOG4570418 consensus Uncharacterized conserved protein [Funct 85.79
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.54
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.53
COG3947361 Response regulator containing CheY-like receiver a 85.5
COG1747 711 Uncharacterized N-terminal domain of the transcrip 85.49
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.63
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.6
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.52
PRK09687280 putative lyase; Provisional 84.22
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.92
KOG4507 886 consensus Uncharacterized conserved protein, conta 83.8
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.72
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.7
PRK11619644 lytic murein transglycosylase; Provisional 83.55
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 83.37
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.34
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.7
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.47
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 82.28
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 81.64
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 81.57
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 81.42
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.41
KOG1586288 consensus Protein required for fusion of vesicles 81.39
PF06552186 TOM20_plant: Plant specific mitochondrial import r 80.88
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 80.71
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.57
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 80.16
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-70  Score=614.91  Aligned_cols=516  Identities=18%  Similarity=0.221  Sum_probs=479.5

Q ss_pred             HHHHhhcCCCCChhHHHHHHHHhccCchhHHHHHHHhhhCCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhcCCCC
Q 006630           92 ELALQHSGVVLRPGLTERVINRCGDAGNLGYRYYMWASKQPNYVHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQL  171 (638)
Q Consensus        92 ~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~~  171 (638)
                      +..+...|+.++..+++.+|..|+++|++..+...|....   .+|..+||+||.+|++.|++++|+++|++|...+ ..
T Consensus       210 ~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~---~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g-~~  285 (857)
T PLN03077        210 HAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMP---RRDCISWNAMISGYFENGECLEGLELFFTMRELS-VD  285 (857)
T ss_pred             HHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCC---CCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcC-CC
Confidence            3344445666666667777778888887777777676543   4688899999999999999999999999998876 45


Q ss_pred             CCHHHHHHHHHHHHhcCCHHHHHHHHHhchhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHhccCCCCHHHHHHHHH
Q 006630          172 ITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLY  251 (638)
Q Consensus       172 ~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~li~  251 (638)
                      ||..||+.++.+|++.|+.+.|.+++..|.+.|+.||..+|++|+.+|+++|++++|.++|++|..   ||..+||.+|.
T Consensus       286 Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~---~d~~s~n~li~  362 (857)
T PLN03077        286 PDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMET---KDAVSWTAMIS  362 (857)
T ss_pred             CChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCC---CCeeeHHHHHH
Confidence            899999999999999999999999999999999999999999999999999999999999999974   59999999999


Q ss_pred             HHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHhHHHHHHHHHHHcCCCCCHHhHHHHHHHHHhcCCHHH
Q 006630          252 GWCKEGKLVEAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEE  331 (638)
Q Consensus       252 ~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~  331 (638)
                      +|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.|.++++.|.+.|+.|+..+|+.||++|+++|++++
T Consensus       363 ~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~  442 (857)
T PLN03077        363 GYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDK  442 (857)
T ss_pred             HHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHH
Q 006630          332 ANRAFVEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRK  411 (638)
Q Consensus       332 A~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~  411 (638)
                      |.++|++|.    .+|.++|+++|.+|++.|+.++|+.+|++|.. ++.||..||+.++.+|++.|.++.+.+++..+.+
T Consensus       443 A~~vf~~m~----~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~  517 (857)
T PLN03077        443 ALEVFHNIP----EKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLR  517 (857)
T ss_pred             HHHHHHhCC----CCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHH
Confidence            999999998    57999999999999999999999999999986 5999999999999999999999999999999999


Q ss_pred             CCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCCcHH
Q 006630          412 IGCVPDVSNYNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYG  491 (638)
Q Consensus       412 ~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~p~~~  491 (638)
                      .|+.+|..++++||++|+++|++++|.++|+.+     .||..+||+||.+|++.|+.++|+++|++|.+.|+  .||..
T Consensus       518 ~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~--~Pd~~  590 (857)
T PLN03077        518 TGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGV--NPDEV  590 (857)
T ss_pred             hCCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCC--CCCcc
Confidence            999999999999999999999999999999987     58999999999999999999999999999999998  79999


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHH-HcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHH
Q 006630          492 TLKALLNSLLRAQKVEMAKDVWSCIV-TKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQPDTFAKLMRGL  570 (638)
Q Consensus       492 ~~~~ll~~~~~~g~~~~A~~~~~~~~-~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~t~~~ll~~~  570 (638)
                      ||+.++.+|++.|++++|.++|+.|. +.|+.|+..+|++|+++|++.|++++|.+++++|   ++.||..+|.+|+.+|
T Consensus       591 T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m---~~~pd~~~~~aLl~ac  667 (857)
T PLN03077        591 TFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKM---PITPDPAVWGALLNAC  667 (857)
T ss_pred             cHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHC---CCCCCHHHHHHHHHHH
Confidence            99999999999999999999999998 5699999999999999999999999999999988   4799999999999999


Q ss_pred             HhhcCHHHHHHHHHHHHHHHHhccccc----chhhhhhhhhhHHHHHhhhhhhhhhh-hhhhcc
Q 006630          571 KKLYNRQIAAEITEKVRKMAAERQITF----KMYKRRGERDLKEKAKKQVDGRKRRA-RQRRWG  629 (638)
Q Consensus       571 ~~~g~~~~A~~~~~~~~~~~p~~~~~~----~~y~~~g~~~~A~~~~~~~~~~~~~~-~~~~~~  629 (638)
                      ...|+.+.|+.+.+++++++|+++..+    ++|+..|+|++|.++++.|++++-++ +...|.
T Consensus       668 ~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~i  731 (857)
T PLN03077        668 RIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWV  731 (857)
T ss_pred             HHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEE
Confidence            999999999999999999999998875    79999999999999999999988754 444453



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-21
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 96.8 bits (239), Expect = 6e-21
 Identities = 30/201 (14%), Positives = 74/201 (36%), Gaps = 4/201 (1%)

Query: 221 KNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKD---AGFEPD 277
           K S   E A      + +     +   +         +L  A ++LV             
Sbjct: 105 KLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLT 164

Query: 278 IVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEA-NRAF 336
           + +YN ++ G+A+ G   +   +L  ++  G  P+  SY   +Q + R ++      R  
Sbjct: 165 LDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCL 224

Query: 337 VEMERSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKK 396
            +M + G +   +    L+S   ++  +   +++  +      LP  +    ++     K
Sbjct: 225 EQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAK 284

Query: 397 EELEECVELMGEMRKIGCVPD 417
           +      +L   ++ + C+ +
Sbjct: 285 DGRVSYPKLHLPLKTLQCLFE 305


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query638
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.98
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.98
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.87
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.81
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.66
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.66
3u4t_A272 TPR repeat-containing protein; structural genomics 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.58
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.55
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.49
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.49
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.48
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.48
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.4
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.4
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.4
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.38
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.36
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.36
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.36
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.3
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.25
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.22
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.15
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.1
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.07
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.05
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.03
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.02
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.01
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.94
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.94
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.93
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.92
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.9
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.9
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.88
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.83
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.82
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.82
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.81
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.79
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.77
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.75
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.72
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.72
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.67
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.67
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.65
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.65
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.65
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.64
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.64
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.63
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.62
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.61
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.61
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.59
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.59
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.59
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.57
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.56
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.56
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.55
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.49
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.49
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.41
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.4
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.38
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.33
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.31
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.29
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.28
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.26
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.26
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.25
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.24
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.22
3k9i_A117 BH0479 protein; putative protein binding protein, 98.22
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.21
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.21
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.2
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.19
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.16
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.12
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.11
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.11
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.01
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.99
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.92
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.9
3k9i_A117 BH0479 protein; putative protein binding protein, 97.88
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.87
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.86
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.69
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.66
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.66
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.58
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.57
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.51
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.49
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.46
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.36
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.33
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.3
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.23
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.03
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.92
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.81
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.81
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.71
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.59
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.49
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.44
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.36
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.03
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.6
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.45
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.31
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.19
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.18
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.01
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.84
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.73
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.97
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.97
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.96
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.67
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.54
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.24
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.23
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.07
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.4
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 88.99
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.96
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.92
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.45
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.24
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.87
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 85.56
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 85.54
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.23
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 84.72
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 84.22
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 83.98
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.28
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 81.16
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 80.54
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.12
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2.3e-42  Score=376.63  Aligned_cols=473  Identities=9%  Similarity=-0.003  Sum_probs=347.7

Q ss_pred             CCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHhchhCCCCCCHHHHHH
Q 006630          135 VHSYDVYRALIKSLSKMRKFGAVWALMEEMRKEKPQLITTEVFVILMRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGC  214 (638)
Q Consensus       135 ~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~~~~~~~~~  214 (638)
                      .+++..|+.++..|.+.|++++|+.+|++|....|   +..++..++.+|.+.|++++|+.+|+.+...  +++..+++.
T Consensus        81 ~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p---~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~  155 (597)
T 2xpi_A           81 LSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITG---NPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACRYL  155 (597)
T ss_dssp             -CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHC---CHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHccCchHHHHHHHHHHhhCC---CchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHHHH
Confidence            36788999999999999999999999999987654   6688899999999999999999999998654  789999999


Q ss_pred             HHHHHHhCCCHHHHHHHHHHHhccC----------------CCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCH
Q 006630          215 LLDALCKNSSVKEAAKLFDEMRERF----------------KPSLRHFTSLLYGWCKEGKLVEAKYVLVQMKDAGFEPDI  278 (638)
Q Consensus       215 li~~~~~~g~~~~A~~~~~~~~~~~----------------~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~  278 (638)
                      ++.+|.+.|++++|.++|+++....                +++..+|+.++.+|.+.|++++|.++|++|.+.+ +.+.
T Consensus       156 l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~  234 (597)
T 2xpi_A          156 AAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD-AKCY  234 (597)
T ss_dssp             HHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCH
T ss_pred             HHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-chhh
Confidence            9999999999999999999643221                3458999999999999999999999999999875 3345


Q ss_pred             HHHHHHHHHHHHcCCHhH--HHHH-HHHHHHcCCCCCHHhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHH
Q 006630          279 VVYNNLLSGYAQMGKMTD--AFEL-LKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEMERSGCEADVVTYTTLI  355 (638)
Q Consensus       279 ~~~~~ll~~~~~~g~~~~--a~~~-~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~~~li  355 (638)
                      ..+..+...+...+..+.  +..+ +..+...+..+...+|+.++..|.+.|++++|.++|+++.+.  +++..+|+.++
T Consensus       235 ~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~  312 (597)
T 2xpi_A          235 EAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKA  312 (597)
T ss_dssp             HHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHH
T ss_pred             HHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHH
Confidence            555555544332222111  1111 334444444444555666677777777777777777777654  46777777777


Q ss_pred             HHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHH
Q 006630          356 SGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSNYNVVIRLACKLGELK  435 (638)
Q Consensus       356 ~~~~~~g~~~~A~~~~~~m~~~~~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~  435 (638)
                      .+|.+.|++++|+++|+++.+.+.. +..++..++.++.+.|++++|.++++.+.+.. +.+..+++.++.+|.+.|+++
T Consensus       313 ~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~  390 (597)
T 2xpi_A          313 DTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKIS  390 (597)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHH
Confidence            7777777777777777777765433 55667777777777777777777777776543 556677777777777777777


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 006630          436 EAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSLLRAQKVEMAKDVWSC  515 (638)
Q Consensus       436 ~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~p~~~~~~~ll~~~~~~g~~~~A~~~~~~  515 (638)
                      +|.++|+++.+.+ +.+..+|+.++.+|.+.|++++|+++|+++.+.+   +.+..++..++.+|.+.|++++|.++|++
T Consensus       391 ~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~---~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  466 (597)
T 2xpi_A          391 EARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF---QGTHLPYLFLGMQHMQLGNILLANEYLQS  466 (597)
T ss_dssp             HHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT---TTCSHHHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC---ccchHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            7777777776654 4456677777777777777777777777777665   34566777777777777777777777777


Q ss_pred             HHHcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhC----CCCCC--HHHHHHHHHHHHhhcCHHHHHHHHHHHHHH
Q 006630          516 IVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDA----DVMPQ--PDTFAKLMRGLKKLYNRQIAAEITEKVRKM  589 (638)
Q Consensus       516 ~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~----~~~p~--~~t~~~ll~~~~~~g~~~~A~~~~~~~~~~  589 (638)
                      +.+.. +.+..+|+.++.+|.+.|++++|+++|+++.+.    +..|+  ..+|..++.+|.+.|++++|+++++++++.
T Consensus       467 ~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  545 (597)
T 2xpi_A          467 SYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLL  545 (597)
T ss_dssp             HHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHh
Confidence            76653 235677777777777777777777777777654    55666  567777777777777777777777777777


Q ss_pred             HHhccccc----chhhhhhhhhhHHHHHhhhhhhhhh
Q 006630          590 AAERQITF----KMYKRRGERDLKEKAKKQVDGRKRR  622 (638)
Q Consensus       590 ~p~~~~~~----~~y~~~g~~~~A~~~~~~~~~~~~~  622 (638)
                      +|+++..+    .+|.+.|++++|.+.++++.+..+.
T Consensus       546 ~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          546 STNDANVHTAIALVYLHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             SSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCC
Confidence            77766554    5677777777777777776655443



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query638
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.61
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.32
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.28
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.27
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.21
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.17
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.14
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.12
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.11
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.1
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.06
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.72
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.72
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.67
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.64
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.56
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.53
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.49
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.49
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.32
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.3
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.19
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.19
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.11
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.08
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.01
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.98
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.91
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.86
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.78
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.77
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.75
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.71
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.66
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.63
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.61
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.6
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.53
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.49
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.42
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.42
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.4
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.15
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.05
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.88
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.2
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.54
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.53
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.61
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.82
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=3.7e-23  Score=208.73  Aligned_cols=369  Identities=12%  Similarity=0.032  Sum_probs=187.4

Q ss_pred             HHHHHhcCCHHHHHHHHHhchhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHhccCCCCHHHHHHHHHHHHhcCCHH
Q 006630          181 MRRFASARMVKKAIEVLDEMPKYGCEPDEFVFGCLLDALCKNSSVKEAAKLFDEMRERFKPSLRHFTSLLYGWCKEGKLV  260 (638)
Q Consensus       181 i~~~~~~~~~~~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~  260 (638)
                      ...+.+.|++++|++.++++.+.. +-+..++..+..+|.+.|++++|...|++..+..|.+..+|..+...|.+.|+++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccc
Confidence            334445555555555555554432 2234455555555555555555555555554444445555555555555555555


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHhHHHHHHHHHHHcCCCCCHHhHHHHHHHHHhcCCHHHHHHHHHHHH
Q 006630          261 EAKYVLVQMKDAGFEPDIVVYNNLLSGYAQMGKMTDAFELLKEMRRKGCDPNANSYTVLIQALCRMEKMEEANRAFVEME  340 (638)
Q Consensus       261 ~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~  340 (638)
                      +|...+....+.. +.+...+..........+....+............                               
T Consensus        85 ~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------  132 (388)
T d1w3ba_          85 EAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNP-------------------------------  132 (388)
T ss_dssp             HHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCT-------------------------------
T ss_pred             ccccccccccccc-ccccccccccccccccccccccccccccccccccc-------------------------------
Confidence            5555555554433 22333333333333333333333333333332211                               


Q ss_pred             HcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHH
Q 006630          341 RSGCEADVVTYTTLISGFCKSRKIDRCYEILDSMIQRGILPNQLTYLHIMLAHEKKEELEECVELMGEMRKIGCVPDVSN  420 (638)
Q Consensus       341 ~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~  420 (638)
                           ................+....+...+......... +...+..+...+...|++++|...+....+.. +.+...
T Consensus       133 -----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~  205 (388)
T d1w3ba_         133 -----DLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDA  205 (388)
T ss_dssp             -----TCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHH
T ss_pred             -----ccccccccccccccccchhhhhHHHHHHhhccCcc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHH
Confidence                 12222223333334444444444444444433211 33344444444555555555555555544432 334445


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHH
Q 006630          421 YNVVIRLACKLGELKEAVNVWNEMEAASLSPGTDSFVVMVHGFLGQGCLIEACEYFKEMVGRGLLSAPQYGTLKALLNSL  500 (638)
Q Consensus       421 ~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~p~~~~~~~ll~~~  500 (638)
                      +..+...+...|++++|...|++....+ +.+...+..+...+...|++++|+..|+++++..   +.+..++..+...+
T Consensus       206 ~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~---p~~~~~~~~l~~~~  281 (388)
T d1w3ba_         206 YINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ---PHFPDAYCNLANAL  281 (388)
T ss_dssp             HHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC---SSCHHHHHHHHHHH
T ss_pred             HHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC---CCCHHHHHHHHHHH
Confidence            5555555556666666666666555543 3444555556666666666666666666665554   23445555556666


Q ss_pred             HHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhCCCCCC-HHHHHHHHHHHHhhcCHHHH
Q 006630          501 LRAQKVEMAKDVWSCIVTKGCELNVYAWTIWIHSLFSNGHVKEACSYCLDMMDADVMPQ-PDTFAKLMRGLKKLYNRQIA  579 (638)
Q Consensus       501 ~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~-~~t~~~ll~~~~~~g~~~~A  579 (638)
                      ...|++++|.+.++.+... .+.+...+..+..++...|++++|+..|++.++.  .|+ ..++..+..++...|++++|
T Consensus       282 ~~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A  358 (388)
T d1w3ba_         282 KEKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEA  358 (388)
T ss_dssp             HHHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHH
T ss_pred             HHcCCHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHH
Confidence            6666666666666665554 2334555556666666666666666666665543  333 44455666666666666666


Q ss_pred             HHHHHHHHHHHHhcccc
Q 006630          580 AEITEKVRKMAAERQIT  596 (638)
Q Consensus       580 ~~~~~~~~~~~p~~~~~  596 (638)
                      +..++++++++|+++.+
T Consensus       359 ~~~~~~al~l~P~~~~a  375 (388)
T d1w3ba_         359 LMHYKEAIRISPTFADA  375 (388)
T ss_dssp             HHHHHHHHTTCTTCHHH
T ss_pred             HHHHHHHHHhCCCCHHH
Confidence            66666666666665554



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure