Citrus Sinensis ID: 006667

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630------
MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFHK
cccccccccccccccccccccccEEccccccccccccccccEEEEEEccccccHHHHHHHHHHHcccEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEccccEEEEEccEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHcccccccccEEEcccccccccccHHHHHHHHcccccHHHHHHHHHccccccccccccEEEccccccccccccEEEEEccccEEEEEEEcccccccEEEccccEEEEEHHHHccccccccHHHHHHHHcccEEEccEEEEEEccccccccccEEEEcccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccEEEEEEccccccc
cccccccccccccccccHHHHHHHHHHHcccccEEEEEcccEEEEEEccccccHHHHHHHHHHHcccEEEEEccccccHHHHHcccccccccccHHHHHHHHHHHHcccccEEEEEEcEEccccccEEEEEccccEEEEEEHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHEEEEEEEEEEcHHHHHHHHHHHHHHHHcccccEEEEccccccccccHHEEEcccccccEEEEccccccccEEEEccEEEEEEHHHHHHHHHHccEEEEEEEEEEEEEEccEEEEEEEcHHcccccEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHcccccHHccccccHHHcHccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHccccccccccccccccccEEEEEccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEcHHHHHHHHHHHHHHHHHHHHHHHcccccc
maqdtssgadsprrrpgllrdQVQLvkkkdsdryeivpiedtlsfekgpsgagktvFTEKVLNFMPSIAVITmdnyndssriidgnfddprltdyDTLLENIRglkegkavqvpiydfksssrigyrtlevpssrIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPmykafiepdlQTAHIKIInkfnpftgfqnptyilkstrpvTVDEIKAVMskehtetteetydiyllppgedpdacQSYLRMRNRDGKYNLMFEewvtdspfiispriTFEVSVRLLGGLMALGYTIATILKRsshifyddrvcvkTDWLEQLNRKYVQVQGRDRLYVKYVGEqlgldgsyvprtyIEQIQLEKLVNDVmalpddlktklsidddlvsspkeaLSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNnrrfdgrtpespaslanQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAeacngsgptslfmtglangsltgsvlpnsssssqlarespLMEEVLLVARGQRQIMHQLDSISNLLHEYwgertrqertdrpsrvidvdsigVPLILTLAVGGLGLFLFKGLTFHK
maqdtssgadsprrrpgllrdqvqlvkkkdsdryeivpiedtlsfekgpsgagKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENirglkegkavqvpiydfksssrigyrtlevpssrivIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRdiqrvgqepeEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVmskehtetteetydiyllppgeDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRkyvqvqgrdrLYVKYVGEqlgldgsyvPRTYIEQIQLEKLVNDVMALPDDLKTklsidddlvsspkealsrasadrrtkylsrsisnsfsnqreknltklARVAVNnrrfdgrtpespaslanqgvINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGErtrqertdrpsrvidvDSIGVPLILTLAVGGLGLFLFKGLTFHK
MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNsssssQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLIltlavgglglflfkgltfHK
*********************************YEIVPIEDTLSF*****GAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMS*****TTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLK*******************************************************************************************************************************************************************VLLVARGQRQIMHQLDSISNLLHEYWGER**********RVIDVDSIGVPLILTLAVGGLGLFLFKGLTF**
*********************************YEIVPIEDTLSFEKGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDE***************TYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA*******************************************************************************************NERMDEFTSRIEEMN************************SGPTSLFMTGLANGS************************VLLVARGQRQIMHQLDSISNLLHE*********************SIGVPLILTLAVGGLGLFLFKGLT***
**************RPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDL******************YLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGS***************PLMEEVLLVARGQRQIMHQLDSISNLLHEYWGE*********PSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFHK
***************PGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSP************************************************TPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAI**VS***QNL*LQA*ACNGSGPTSLFMTGLAN*SLTG***********LARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWG***********SRVIDVDSIGVPLILTLAVGGLGLFLFKGLT***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFHK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query636 2.2.26 [Sep-21-2011]
Q54R62449 Uridine-cytidine kinase C yes no 0.570 0.808 0.465 1e-101
Q9GNF0492 Uridine-cytidine kinase D no no 0.517 0.668 0.337 5e-57
Q9RXZ5210 Uridine kinase OS=Deinoco yes no 0.283 0.857 0.328 5e-19
B5ZBE2207 Uridine kinase OS=Ureapla yes no 0.259 0.797 0.289 4e-18
Q91YL3548 Uridine-cytidine kinase-l yes no 0.256 0.297 0.310 5e-18
Q9PQF9207 Uridine kinase OS=Ureapla yes no 0.259 0.797 0.284 9e-18
B1AIX1207 Uridine kinase OS=Ureapla yes no 0.259 0.797 0.284 9e-18
C1CXN1207 Uridine kinase OS=Deinoco yes no 0.283 0.869 0.317 1e-17
Q4L6V8207 Uridine kinase OS=Staphyl yes no 0.248 0.763 0.327 2e-17
P67412207 Uridine kinase OS=Staphyl yes no 0.248 0.763 0.333 2e-17
>sp|Q54R62|UCKC_DICDI Uridine-cytidine kinase C OS=Dictyostelium discoideum GN=udkC PE=3 SV=1 Back     alignment and function desciption
 Score =  370 bits (949), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/397 (46%), Positives = 267/397 (67%), Gaps = 34/397 (8%)

Query: 22  QVQLVKKKDSD-RYEIVPIEDTLSFEKG--------------------------PSGAGK 54
           +++++ + D D RY I P++DTLSF+KG                          PSGAGK
Sbjct: 5   EIEVIPRPDKDDRYTIKPLKDTLSFDKGFFLAVRAIQSIRKKSQGSVIVVGIAGPSGAGK 64

Query: 55  TVFTEKVLNFMPSIAVITMDNYNDSSR-IIDGNFDDPRLTDYDTLLENIRGLKEGKAVQV 113
           T   +K+++ +P   +I++DNY DSSR II+ N+DD RL D++ L +NI  L   K   +
Sbjct: 65  TSIAQKIVSVLPKSILISLDNYLDSSRQIIEENYDDYRLVDFELLKKNISDLISNKPTDL 124

Query: 114 PIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFR 173
           P+YDF  S R  Y+ ++ P S++++IEGIYAL E++R L+DLRVS++GGVHFDL+KR+FR
Sbjct: 125 PLYDFTKSGRYAYKRVQPPESKVLLIEGIYALHEEIRHLLDLRVSISGGVHFDLIKRIFR 184

Query: 174 DIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTR 233
           D+ R GQ+P E + QI++TVYPMYKAFIEPDLQ A I+++NKFNPF G  NP YILKS +
Sbjct: 185 DVHRTGQQPHESLQQITDTVYPMYKAFIEPDLQLAEIQVVNKFNPFGGLLNPIYILKSVK 244

Query: 234 P-VTVDEIKAVMSKEHT-ETTEETYDIYLLPPG---EDPDACQSYLRMRNRDGKYNLMFE 288
             VTVD I +V++K    E T   YDIYL+PP     +  +C  ++R+RN DG+Y++MF 
Sbjct: 245 QGVTVDMIHSVLNKSTIQENTARYYDIYLIPPNTTFANSSSC-DWIRVRNADGQYSIMFS 303

Query: 289 EWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLN 348
           E + + PFIISPR+ F V V +LGGLM+LGY +  I+ R S IF D ++ +  D LE+L 
Sbjct: 304 EEIKEGPFIISPRVDFVVGVNMLGGLMSLGYQMVAIIHRKSTIFKDGKIIISYDELEELG 363

Query: 349 RKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQ 385
           + +VQ++G D   V+  G++LGL+ +Y+ ++YIE  Q
Sbjct: 364 QTFVQIKGFDATSVQEAGKKLGLENNYLQKSYIELYQ 400
Catalyzes the conversion of uridine into uridine monophosphate and cytidine into cytidine monophosphate in the pyrimidine salvage pathway.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q9GNF0|UCKD_DICDI Uridine-cytidine kinase D OS=Dictyostelium discoideum GN=udkD PE=2 SV=1 Back     alignment and function description
>sp|Q9RXZ5|URK_DEIRA Uridine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|B5ZBE2|URK_UREU1 Uridine kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 Back     alignment and function description
>sp|Q9PQF9|URK_UREPA Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|B1AIX1|URK_UREP2 Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|C1CXN1|URK_DEIDV Uridine kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q4L6V8|URK_STAHJ Uridine kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|P67412|URK_STAAW Uridine kinase OS=Staphylococcus aureus (strain MW2) GN=udk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query636
317106657661 JHL10I11.7 [Jatropha curcas] 1.0 0.962 0.839 0.0
255541904657 uridine cytidine kinase I, putative [Ric 0.993 0.961 0.824 0.0
225455758661 PREDICTED: uridine-cytidine kinase C [Vi 1.0 0.962 0.819 0.0
356511573660 PREDICTED: uridine-cytidine kinase C-lik 0.996 0.960 0.812 0.0
356562664661 PREDICTED: uridine-cytidine kinase C-lik 0.996 0.959 0.802 0.0
224130198658 predicted protein [Populus trichocarpa] 0.993 0.960 0.829 0.0
357477775688 Uridine-cytidine kinase C [Medicago trun 1.0 0.924 0.761 0.0
449440868664 PREDICTED: uridine-cytidine kinase C-lik 1.0 0.957 0.768 0.0
255546967657 uridine cytidine kinase I, putative [Ric 0.982 0.951 0.723 0.0
225425041663 PREDICTED: uridine-cytidine kinase C [Vi 0.990 0.950 0.729 0.0
>gi|317106657|dbj|BAJ53161.1| JHL10I11.7 [Jatropha curcas] Back     alignment and taxonomy information
 Score = 1151 bits (2977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/661 (83%), Positives = 603/661 (91%), Gaps = 25/661 (3%)

Query: 1   MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKG------------ 48
           MAQDT+ G +SPRRR GLLRDQVQLVKKKDSDRYEI PIEDTL+FEKG            
Sbjct: 1   MAQDTNHGIESPRRRSGLLRDQVQLVKKKDSDRYEIAPIEDTLAFEKGFFVVIRACQLLA 60

Query: 49  -------------PSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDY 95
                        PSGAGKTVFTEKVLNFMPSIAVITMDNYND+SRIIDGNFDDPRLTDY
Sbjct: 61  QKNDGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDASRIIDGNFDDPRLTDY 120

Query: 96  DTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDL 155
           DTLL+NI GLK GKAVQVPIYDFK+SSR+GYRT+EVPSSRIVIIEGIYALSE+LRPL+DL
Sbjct: 121 DTLLDNIHGLKAGKAVQVPIYDFKTSSRVGYRTVEVPSSRIVIIEGIYALSERLRPLLDL 180

Query: 156 RVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 215
           RVS+TGGVHFDLVKRV RDIQR GQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK
Sbjct: 181 RVSITGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 240

Query: 216 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLR 275
           FNPFTGFQ+PTYILKS R VT+++IKAVMS+E+TE  EETYDIYLLPPGEDP+ACQSYLR
Sbjct: 241 FNPFTGFQSPTYILKSARSVTLEQIKAVMSEEYTERNEETYDIYLLPPGEDPEACQSYLR 300

Query: 276 MRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDD 335
           MRNRDG+YNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIA ILKRSSH+F+D+
Sbjct: 301 MRNRDGQYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIAAILKRSSHVFFDN 360

Query: 336 RVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 395
           RVCVKTDWLEQLNR+YVQVQGRDRLYVKYV EQLGLDGSYVPRTYIEQIQLEKLVNDVMA
Sbjct: 361 RVCVKTDWLEQLNRQYVQVQGRDRLYVKYVAEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 420

Query: 396 LPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVN 455
           LPDDLKTKLSIDDDLVSSPKEALSRASADRR KYLSRS+S S++NQREKNL+KL R+AVN
Sbjct: 421 LPDDLKTKLSIDDDLVSSPKEALSRASADRRNKYLSRSVSLSYANQREKNLSKLTRLAVN 480

Query: 456 NRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQN 515
           NRRFDGRTPESPA+LANQGV+ QLSEQI+TLNERMDEFTSRIEE+N+KF +RKVSASQQN
Sbjct: 481 NRRFDGRTPESPATLANQGVVTQLSEQIATLNERMDEFTSRIEELNSKFTVRKVSASQQN 540

Query: 516 LALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQI 575
           LA+QAEACNGSGPTS F+ GLANGSLTGS+LP SSSSSQLARESPLMEE++L+ARGQRQI
Sbjct: 541 LAMQAEACNGSGPTSAFVNGLANGSLTGSLLPTSSSSSQLARESPLMEEIVLIARGQRQI 600

Query: 576 MHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFH 635
           MHQLD++SN LHE+WG R RQERTDR +R IDVDSI +PLI+TLA+GGLG FLF+G    
Sbjct: 601 MHQLDNLSNFLHEHWGGRARQERTDRINRAIDVDSIALPLIVTLAIGGLGAFLFRGFASQ 660

Query: 636 K 636
           K
Sbjct: 661 K 661

Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541904|ref|XP_002512016.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223549196|gb|EEF50685.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225455758|ref|XP_002269501.1| PREDICTED: uridine-cytidine kinase C [Vitis vinifera] gi|297734126|emb|CBI15373.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511573|ref|XP_003524499.1| PREDICTED: uridine-cytidine kinase C-like [Glycine max] Back     alignment and taxonomy information
>gi|356562664|ref|XP_003549589.1| PREDICTED: uridine-cytidine kinase C-like [Glycine max] Back     alignment and taxonomy information
>gi|224130198|ref|XP_002328678.1| predicted protein [Populus trichocarpa] gi|222838854|gb|EEE77205.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357477775|ref|XP_003609173.1| Uridine-cytidine kinase C [Medicago truncatula] gi|355510228|gb|AES91370.1| Uridine-cytidine kinase C [Medicago truncatula] Back     alignment and taxonomy information
>gi|449440868|ref|XP_004138206.1| PREDICTED: uridine-cytidine kinase C-like [Cucumis sativus] gi|449525411|ref|XP_004169711.1| PREDICTED: uridine-cytidine kinase C-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255546967|ref|XP_002514541.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223546145|gb|EEF47647.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225425041|ref|XP_002270620.1| PREDICTED: uridine-cytidine kinase C [Vitis vinifera] gi|297738236|emb|CBI27437.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query636
TAIR|locus:2028809674 AT1G26190 [Arabidopsis thalian 0.863 0.814 0.741 1e-235
TAIR|locus:2031541643 AT1G73980 [Arabidopsis thalian 0.839 0.830 0.739 8.3e-223
DICTYBASE|DDB_G0283371449 udkC "adenylate cyclase domain 0.577 0.817 0.474 6.8e-98
DICTYBASE|DDB_G0271146492 udkD "adenylate cyclase domain 0.553 0.715 0.326 2.3e-55
UNIPROTKB|Q9KT67213 udk "Uridine kinase" [Vibrio c 0.254 0.760 0.335 4.6e-18
TIGR_CMR|VC_1038213 VC_1038 "uridine kinase" [Vibr 0.254 0.760 0.335 4.6e-18
TIGR_CMR|SO_2617212 SO_2617 "uridine kinase" [Shew 0.254 0.764 0.333 5.6e-17
TIGR_CMR|CPS_1974216 CPS_1974 "uridine kinase" [Col 0.273 0.805 0.303 1.5e-16
UNIPROTKB|F1M1K5252 Uckl1 "Protein Uckl1" [Rattus 0.238 0.603 0.307 1.9e-16
UNIPROTKB|F1NB19511 UCKL1 "Uridine kinase" [Gallus 0.256 0.318 0.316 2.6e-16
TAIR|locus:2028809 AT1G26190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2150 (761.9 bits), Expect = 1.0e-235, Sum P(2) = 1.0e-235
 Identities = 413/557 (74%), Positives = 485/557 (87%)

Query:    48 GPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKE 107
             GPSGAGKTVFTEK+LNF+PS+AVI+MDNYNDSSRI+DGNFDDPRLTDYDTLL+N+  LKE
Sbjct:    72 GPSGAGKTVFTEKILNFLPSVAVISMDNYNDSSRIVDGNFDDPRLTDYDTLLKNLEDLKE 131

Query:   108 GKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDL 167
             GK V+VPIYDFKSSSR+GYRTL+VP SRIVIIEGIYALSEKLRPL+DLRVSVTGGVHFDL
Sbjct:   132 GKQVEVPIYDFKSSSRVGYRTLDVPPSRIVIIEGIYALSEKLRPLLDLRVSVTGGVHFDL 191

Query:   168 VKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTY 227
             VKRV RDIQR GQ+PEEIIHQISETVYPMYKAFIEPDLQTA IKIINKFNPFTGFQ+PTY
Sbjct:   192 VKRVLRDIQRAGQQPEEIIHQISETVYPMYKAFIEPDLQTAQIKIINKFNPFTGFQSPTY 251

Query:   228 ILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMF 287
             ILKS + V+VD+IKAV+S  HTET EETYDIYLLPPGEDP++CQSYLRMRN+DGKY+LMF
Sbjct:   252 ILKSRKEVSVDQIKAVLSDGHTETKEETYDIYLLPPGEDPESCQSYLRMRNKDGKYSLMF 311

Query:   288 EEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQL 347
             EEWVTD+PF+ISPRITFEVSVRLLGGLMALGYTIATILKR+SH+F  D+V VK DWLEQL
Sbjct:   312 EEWVTDTPFVISPRITFEVSVRLLGGLMALGYTIATILKRNSHVFATDKVFVKIDWLEQL 371

Query:   348 NRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSID 407
             NR Y+QVQG+DR  V+   EQLGL+GS++PRTYIEQIQLEKL+N+VMALPDDLK KLS+D
Sbjct:   372 NRHYMQVQGKDRQLVQSTAEQLGLEGSFIPRTYIEQIQLEKLINEVMALPDDLKNKLSLD 431

Query:   408 DDLVSS--PKEALSRASADR---RTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGR 462
             +DLVSS  PKEAL RASADR   R K L R +S+S+S QR+KNL+KLA  + ++RR++ R
Sbjct:   432 EDLVSSSSPKEALLRASADRVAMRNKNLKRGMSHSYSTQRDKNLSKLAGYSSSDRRYEER 491

Query:   463 TPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEA 522
               +SPA   N+G +  LSEQIS+LNERMDEFTSRIEE+N+K +  K S +QQ+L++Q E 
Sbjct:   492 NHDSPA---NEGFMTLLSEQISSLNERMDEFTSRIEELNSKLSCNKNSPTQQSLSIQTEV 548

Query:   523 CNGSGPTSLFMTGLANGSLTGSVLPNXXXXXQLARESPLMEEVLLVARGQRQIMHQLDSI 582
             CNGS PTS F++GL NG LT S++P+     QLA++SPLMEE+  ++RGQRQ+MHQLD++
Sbjct:   549 CNGSAPTSYFISGLDNGCLTNSIMPHSSSSSQLAKDSPLMEEISTISRGQRQVMHQLDNL 608

Query:   583 SNLLHEYWGERTRQERT 599
              NL+ E   ER+R  RT
Sbjct:   609 CNLMRESSAERSRLART 625
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006796 "phosphate-containing compound metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016301 "kinase activity" evidence=IEA;ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
TAIR|locus:2031541 AT1G73980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283371 udkC "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271146 udkD "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KT67 udk "Uridine kinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1038 VC_1038 "uridine kinase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2617 SO_2617 "uridine kinase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1974 CPS_1974 "uridine kinase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|F1M1K5 Uckl1 "Protein Uckl1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NB19 UCKL1 "Uridine kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.19LOW CONFIDENCE prediction!
4th Layer2.7.1.48LOW CONFIDENCE prediction!
3rd Layer3.6.1.28LOW CONFIDENCE prediction!
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query636
PLN02318656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 0.0
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 2e-62
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 9e-32
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 6e-31
TIGR00235207 TIGR00235, udk, uridine kinase 2e-29
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 3e-29
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 3e-20
pfam01928175 pfam01928, CYTH, CYTH domain 4e-19
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 2e-14
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 4e-14
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 8e-12
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 3e-09
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrol 0.001
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information 
 Score = 1178 bits (3049), Expect = 0.0
 Identities = 525/658 (79%), Positives = 581/658 (88%), Gaps = 29/658 (4%)

Query: 1   MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKG------------ 48
           MAQDTS GA+SPRRR GLL+DQVQLVK+KDSDRYEIVPI+D LSFEKG            
Sbjct: 1   MAQDTS-GAESPRRRHGLLKDQVQLVKRKDSDRYEIVPIQDPLSFEKGFFVVIRACQLLA 59

Query: 49  -------------PSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDY 95
                        PSGAGKTVFTEKVLNFMPSIAVI+MDNYNDSSRIIDGNFDDPRLTDY
Sbjct: 60  QKNDGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVISMDNYNDSSRIIDGNFDDPRLTDY 119

Query: 96  DTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDL 155
           DTLL+NI  LK GK+VQVPIYDFKSSSR+GYRTLEVPSSRIVIIEGIYALSEKLRPL+DL
Sbjct: 120 DTLLDNIHDLKAGKSVQVPIYDFKSSSRVGYRTLEVPSSRIVIIEGIYALSEKLRPLLDL 179

Query: 156 RVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 215
           RVSVTGGVHFDLVKRV RDIQR GQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKI+NK
Sbjct: 180 RVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIVNK 239

Query: 216 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLR 275
           FNPF+GFQNPTYILKS+R VTV++IKAV+S++HTETTEETYDIYLLPPGEDP+ CQSYLR
Sbjct: 240 FNPFSGFQNPTYILKSSRSVTVEQIKAVLSEDHTETTEETYDIYLLPPGEDPETCQSYLR 299

Query: 276 MRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDD 335
           MRNRDGKY+LMFEEWVTD PFIISPRITFEVSVRLLGGLMALGYTIATILKRSSH+F DD
Sbjct: 300 MRNRDGKYSLMFEEWVTDEPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHVFSDD 359

Query: 336 RVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 395
           +VCVK DWLEQLNRKYVQVQG+DRL VK V EQLGL+GSY+PRTYIEQIQLEKLVN+VMA
Sbjct: 360 KVCVKIDWLEQLNRKYVQVQGKDRLVVKDVAEQLGLEGSYIPRTYIEQIQLEKLVNEVMA 419

Query: 396 LPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVN 455
           LP+DLKTKLS+DDDLVSSPKEALSRASADRR K L   +S+S+S QR+KNL+KL  +AV 
Sbjct: 420 LPEDLKTKLSLDDDLVSSPKEALSRASADRRNKNLKSGLSHSYSTQRDKNLSKLTGLAVT 479

Query: 456 NRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQN 515
           NRRFD R  ESPA+L NQG I QLSEQIS+LNERMDEFTSRIEE+N+K +I+K S SQQN
Sbjct: 480 NRRFDERNSESPAAL-NQGAITQLSEQISSLNERMDEFTSRIEELNSKLSIKKNSPSQQN 538

Query: 516 LALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQI 575
           LALQAEACNGS PTS F++GL NGSLTGS+LP SSSSSQLA+ESPLMEE+L +ARGQRQ+
Sbjct: 539 LALQAEACNGSAPTSYFVSGLGNGSLTGSILPLSSSSSQLAKESPLMEEILGIARGQRQV 598

Query: 576 MHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLT 633
           MHQLD++SNLLHE  GE  R  R  R SR+++VDS  +PLIL+LA+GG+G+FLFK L 
Sbjct: 599 MHQLDNLSNLLHESLGE--RSGRNRRNSRLLNVDSSQLPLILSLAIGGIGIFLFKRLK 654

Length = 656
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|216793 pfam01928, CYTH, CYTH domain Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|236442 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 636
PLN02318656 phosphoribulokinase/uridine kinase 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 100.0
PTZ00301210 uridine kinase; Provisional 100.0
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 100.0
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 100.0
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 100.0
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.97
PRK15453290 phosphoribulokinase; Provisional 99.97
PRK05480209 uridine/cytidine kinase; Provisional 99.97
PLN02348395 phosphoribulokinase 99.97
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.97
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.96
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.95
PRK05439311 pantothenate kinase; Provisional 99.95
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.95
COG1437178 CyaB Adenylate cyclase, class 2 (thermophilic) [Nu 99.95
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.94
PRK07429327 phosphoribulokinase; Provisional 99.93
TIGR00318174 cyaB adenylyl cyclase CyaB, putative. The protein 99.92
PRK06696223 uridine kinase; Validated 99.92
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.91
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.88
PRK07667193 uridine kinase; Provisional 99.87
cd07890169 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class I 99.79
PRK06547172 hypothetical protein; Provisional 99.79
PRK08233182 hypothetical protein; Provisional 99.74
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.69
PLN03046460 D-glycerate 3-kinase; Provisional 99.68
KOG3308225 consensus Uncharacterized protein of the uridine k 99.61
PLN02796347 D-glycerate 3-kinase 99.58
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.56
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.43
cd07762180 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the 99.42
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.41
PF01928185 CYTH: CYTH domain; InterPro: IPR008172 The CYTH do 99.38
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.37
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.37
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 99.37
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.37
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.36
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.36
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 99.33
cd07758196 ThTPase Thiamine Triphosphatase. ThTPase is a solu 99.29
PTZ00451244 dephospho-CoA kinase; Provisional 99.29
PRK06217183 hypothetical protein; Validated 99.28
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.27
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 99.27
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.26
PLN02422232 dephospho-CoA kinase 99.24
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.22
PRK07261171 topology modulation protein; Provisional 99.18
PRK08118167 topology modulation protein; Reviewed 99.18
PRK06762166 hypothetical protein; Provisional 99.11
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 98.98
PRK04182180 cytidylate kinase; Provisional 98.97
COG4240300 Predicted kinase [General function prediction only 98.97
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.96
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.96
PRK01184184 hypothetical protein; Provisional 98.94
COG3954289 PrkB Phosphoribulokinase [Energy production and co 98.88
PRK00023225 cmk cytidylate kinase; Provisional 98.86
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 98.84
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 98.8
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 98.78
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.78
PRK14737186 gmk guanylate kinase; Provisional 98.77
KOG2878282 consensus Predicted kinase [General function predi 98.74
PRK08356195 hypothetical protein; Provisional 98.73
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.71
PRK05541176 adenylylsulfate kinase; Provisional 98.6
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.59
PRK04040188 adenylate kinase; Provisional 98.59
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.59
cd07891148 CYTH-like_CthTTM-like_1 CYTH-like Clostridium ther 98.57
PLN02200234 adenylate kinase family protein 98.55
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.55
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.54
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.53
PRK03839180 putative kinase; Provisional 98.5
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 98.49
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.48
PRK00131175 aroK shikimate kinase; Reviewed 98.46
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.44
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 98.43
PRK00300205 gmk guanylate kinase; Provisional 98.39
PRK14530215 adenylate kinase; Provisional 98.37
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.31
PRK05057172 aroK shikimate kinase I; Reviewed 98.29
PRK13949169 shikimate kinase; Provisional 98.29
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.29
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.26
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.25
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.23
PRK00625173 shikimate kinase; Provisional 98.21
PRK14528186 adenylate kinase; Provisional 98.2
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.2
PRK14531183 adenylate kinase; Provisional 98.18
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.18
PRK13946184 shikimate kinase; Provisional 98.18
PRK03731171 aroL shikimate kinase II; Reviewed 98.17
PRK14527191 adenylate kinase; Provisional 98.15
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.13
PRK13808333 adenylate kinase; Provisional 98.12
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 98.11
PRK02496184 adk adenylate kinase; Provisional 98.11
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 98.1
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.07
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.05
cd07761146 CYTH-like_CthTTM-like Clostridium thermocellum (Ct 98.03
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.03
PRK14532188 adenylate kinase; Provisional 98.02
PRK03846198 adenylylsulfate kinase; Provisional 97.98
PRK00279215 adk adenylate kinase; Reviewed 97.98
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.97
PRK13947171 shikimate kinase; Provisional 97.96
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.95
PRK13948182 shikimate kinase; Provisional 97.93
PHA02530300 pseT polynucleotide kinase; Provisional 97.92
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.88
PRK00889175 adenylylsulfate kinase; Provisional 97.88
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.84
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.82
PRK08154309 anaerobic benzoate catabolism transcriptional regu 97.81
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.8
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.8
PRK14738206 gmk guanylate kinase; Provisional 97.79
PRK12338319 hypothetical protein; Provisional 97.79
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.75
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.75
PLN02772398 guanylate kinase 97.74
PRK00698205 tmk thymidylate kinase; Validated 97.74
PTZ00088229 adenylate kinase 1; Provisional 97.73
cd07756197 CYTH-like_Pase_CHAD Uncharacterized subgroup of th 97.64
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.62
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.61
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 97.59
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.58
cd07374174 CYTH-like_Pase CYTH-like (also known as triphospha 97.57
PRK12339197 2-phosphoglycerate kinase; Provisional 97.56
PRK14526211 adenylate kinase; Provisional 97.53
PLN02165334 adenylate isopentenyltransferase 97.52
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.5
PRK09825176 idnK D-gluconate kinase; Provisional 97.5
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 97.48
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 97.48
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 97.47
PLN02199303 shikimate kinase 97.45
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.4
PLN02840421 tRNA dimethylallyltransferase 97.36
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 97.35
PLN02842505 nucleotide kinase 97.33
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.32
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.31
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.3
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 97.19
PLN02674244 adenylate kinase 97.18
PHA00729226 NTP-binding motif containing protein 97.18
PRK13973213 thymidylate kinase; Provisional 97.14
PLN02459261 probable adenylate kinase 97.05
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.04
PRK07933213 thymidylate kinase; Validated 97.02
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.0
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 96.97
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 96.94
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 96.93
PRK04220301 2-phosphoglycerate kinase; Provisional 96.93
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 96.92
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.9
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 96.86
COG4639168 Predicted kinase [General function prediction only 96.85
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.82
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.79
PRK13974212 thymidylate kinase; Provisional 96.78
PLN02748468 tRNA dimethylallyltransferase 96.73
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 96.72
smart00382148 AAA ATPases associated with a variety of cellular 96.68
PRK14529223 adenylate kinase; Provisional 96.66
PF00004132 AAA: ATPase family associated with various cellula 96.66
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 96.55
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.52
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.46
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 96.36
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.34
PRK13976209 thymidylate kinase; Provisional 96.32
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.27
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 96.26
PRK10416318 signal recognition particle-docking protein FtsY; 96.23
TIGR00064272 ftsY signal recognition particle-docking protein F 96.2
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.13
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 96.11
PRK10867433 signal recognition particle protein; Provisional 96.07
PRK06761282 hypothetical protein; Provisional 96.06
PRK13975196 thymidylate kinase; Provisional 96.05
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.02
cd03115173 SRP The signal recognition particle (SRP) mediates 96.01
COG1855604 ATPase (PilT family) [General function prediction 95.91
PHA03132580 thymidine kinase; Provisional 95.88
PRK09435332 membrane ATPase/protein kinase; Provisional 95.87
PRK11545163 gntK gluconate kinase 1; Provisional 95.87
TIGR00959428 ffh signal recognition particle protein. This mode 95.8
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.78
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.77
PRK09087226 hypothetical protein; Validated 95.74
PRK12337475 2-phosphoglycerate kinase; Provisional 95.73
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.7
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.67
PF13173128 AAA_14: AAA domain 95.67
PRK13851344 type IV secretion system protein VirB11; Provision 95.64
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.63
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.63
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 95.62
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.56
TIGR00101199 ureG urease accessory protein UreG. This model rep 95.54
PF05729166 NACHT: NACHT domain 95.52
PRK10646153 ADP-binding protein; Provisional 95.46
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.45
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.44
PRK00771437 signal recognition particle protein Srp54; Provisi 95.42
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.41
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.32
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.3
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 95.25
cd03116159 MobB Molybdenum is an essential trace element in t 95.24
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.23
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.22
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 95.22
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 95.2
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.2
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 95.13
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 95.12
COG4619223 ABC-type uncharacterized transport system, ATPase 95.11
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 95.11
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.11
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.1
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.1
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.07
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.06
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.04
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 95.03
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 95.02
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 95.02
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.01
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.0
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.0
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.99
cd01394218 radB RadB. The archaeal protein radB shares simila 94.97
PRK13833323 conjugal transfer protein TrbB; Provisional 94.96
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 94.94
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.94
COG0802149 Predicted ATPase or kinase [General function predi 94.93
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.92
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.92
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.91
cd03269210 ABC_putative_ATPase This subfamily is involved in 94.9
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.9
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.88
PRK14974336 cell division protein FtsY; Provisional 94.87
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.87
PRK13768253 GTPase; Provisional 94.87
PF00005137 ABC_tran: ABC transporter This structure is on hol 94.86
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.86
KOG0707231 consensus Guanylate kinase [Nucleotide transport a 94.86
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.85
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 94.78
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.78
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.78
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.77
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.77
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.76
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.76
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.74
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 94.74
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 94.74
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.74
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.71
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 94.71
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.7
PRK11784345 tRNA 2-selenouridine synthase; Provisional 94.7
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.69
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.69
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 94.67
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.65
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 94.65
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 94.64
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.63
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.62
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.62
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.61
cd03234226 ABCG_White The White subfamily represents ABC tran 94.61
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.61
COG0645170 Predicted kinase [General function prediction only 94.6
PF1355562 AAA_29: P-loop containing region of AAA domain 94.59
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.55
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 94.52
PF1324576 AAA_19: Part of AAA domain 94.52
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 94.51
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.51
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.49
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 94.49
cd03114148 ArgK-like The function of this protein family is u 94.49
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.48
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.48
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 94.46
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.46
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 94.45
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 94.44
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.4
cd03246173 ABCC_Protease_Secretion This family represents the 94.4
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 94.4
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 94.39
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.38
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.37
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.36
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 94.35
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 94.34
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 94.34
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.32
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.32
PRK10908222 cell division protein FtsE; Provisional 94.31
PF13479213 AAA_24: AAA domain 94.31
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 94.31
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 94.3
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.3
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 94.3
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 94.3
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.3
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 94.29
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.28
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 94.28
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 94.28
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 94.27
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 94.26
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 94.26
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 94.25
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 94.25
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.23
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.23
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 94.23
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 94.22
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.21
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.2
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.2
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.2
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.2
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.19
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 94.18
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.18
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 94.17
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 94.16
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 94.16
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.16
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.15
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.15
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.15
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 94.15
PRK13764602 ATPase; Provisional 94.15
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 94.15
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.15
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.14
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 94.14
PRK14242253 phosphate transporter ATP-binding protein; Provisi 94.13
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.13
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 94.13
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 94.12
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 94.11
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 94.11
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 94.11
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 94.09
KOG1384348 consensus tRNA delta(2)-isopentenylpyrophosphate t 94.09
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 94.09
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.09
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 94.07
COG2954156 Uncharacterized protein conserved in bacteria [Fun 94.06
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 94.06
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 94.05
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 94.04
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.03
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 94.02
PRK14241258 phosphate transporter ATP-binding protein; Provisi 94.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 94.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 93.99
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 93.98
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.96
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 93.95
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 93.94
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.94
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.93
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 93.92
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.92
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 93.91
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 93.9
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 93.9
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 93.89
PLN02924220 thymidylate kinase 93.88
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 93.88
cd03216163 ABC_Carb_Monos_I This family represents the domain 93.88
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 93.88
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 93.88
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 93.87
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 93.87
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 93.84
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 93.83
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 93.82
PRK14239252 phosphate transporter ATP-binding protein; Provisi 93.82
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 93.82
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 93.82
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 93.82
KOG3062281 consensus RNA polymerase II elongator associated p 93.81
cd02034116 CooC The accessory protein CooC, which contains a 93.81
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 93.81
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.8
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.79
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 93.77
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.77
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 93.76
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 93.76
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 93.74
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.74
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 93.74
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 93.73
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 93.73
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.72
PRK14235267 phosphate transporter ATP-binding protein; Provisi 93.71
PRK14240250 phosphate transporter ATP-binding protein; Provisi 93.7
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.7
PRK14238271 phosphate transporter ATP-binding protein; Provisi 93.7
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 93.69
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 93.68
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 93.68
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 93.66
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 93.64
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 93.64
PRK09984262 phosphonate/organophosphate ester transporter subu 93.63
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 93.63
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 93.62
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 93.61
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 93.6
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.6
COG1660286 Predicted P-loop-containing kinase [General functi 93.58
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.57
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 93.56
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 93.56
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 93.55
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.55
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.54
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 93.54
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.52
COG3709192 Uncharacterized component of phosphonate metabolis 93.52
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.51
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 93.5
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 93.5
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 93.5
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 93.47
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 93.47
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.46
PRK14236272 phosphate transporter ATP-binding protein; Provisi 93.45
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 93.45
PRK14237267 phosphate transporter ATP-binding protein; Provisi 93.43
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 93.41
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 93.4
PRK09580248 sufC cysteine desulfurase ATPase component; Review 93.39
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 93.38
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 93.38
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.36
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.35
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 93.35
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 93.34
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 93.34
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 93.33
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 93.31
PRK14495452 putative molybdopterin-guanine dinucleotide biosyn 93.3
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 93.3
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 93.3
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 93.29
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 93.29
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 93.29
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 93.26
COG4618580 ArpD ABC-type protease/lipase transport system, AT 93.24
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.24
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 93.23
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 93.22
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.22
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 93.22
PRK10253265 iron-enterobactin transporter ATP-binding protein; 93.21
PRK03695248 vitamin B12-transporter ATPase; Provisional 93.21
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 93.2
PRK14243264 phosphate transporter ATP-binding protein; Provisi 93.18
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 93.17
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 93.17
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 93.16
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 93.16
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 93.16
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 93.14
PRK10436462 hypothetical protein; Provisional 93.12
PRK11153343 metN DL-methionine transporter ATP-binding subunit 93.11
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 93.1
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 93.09
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 93.09
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.08
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information 
Probab=100.00  E-value=4.9e-182  Score=1492.00  Aligned_cols=630  Identities=83%  Similarity=1.232  Sum_probs=612.4

Q ss_pred             CCCCCCCCCCCCCCCCcchHHHHHHHHhhcCCCceEecCCC-------------------------eEEEEeCCCCCcHH
Q 006667            1 MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIED-------------------------TLSFEKGPSGAGKT   55 (636)
Q Consensus         1 ~~~~~~~~~~~~~~~~~ll~~ql~~~~r~~~~~~~Iv~i~~-------------------------~IIgIsGgSGSGKT   55 (636)
                      ||||+ ++++||+||+|||||||++++||++++|+|+|+++                         .+|+|+||||||||
T Consensus         1 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~sfd~g~~~~ira~qlL~~~~~~riIIGIaGpSGSGKT   79 (656)
T PLN02318          1 MAQDT-SGAESPRRRHGLLKDQVQLVKRKDSDRYEIVPIQDPLSFEKGFFVVIRACQLLAQKNDGIILVGVAGPSGAGKT   79 (656)
T ss_pred             CCccc-ccCcCcccccchhHHhhhheeeccCCceEEEeCCCccccccchhhhhHHHHHHHhcCCCeEEEEEECCCCCcHH
Confidence            99999 78999999999999999999999999999999973                         48999999999999


Q ss_pred             HHHHHHHHhCCCcEEEEcccccCCcccccCCCCCcccccHHHHHHHHHhhhCCCceeeeeeeccCCcccCcceeecCCCc
Q 006667           56 VFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSR  135 (636)
Q Consensus        56 TLAkkLae~L~~v~VIsmDdY~~~~r~~dgnfD~P~afD~dlL~~~L~~Lk~Gk~I~iPvYDf~t~~R~~~eti~v~~~d  135 (636)
                      |||+.|+..++++.+|++|+|++......++||+|.++|++.+.++|..|++|+.+.+|.|||.++.+.+++.+.+++.+
T Consensus        80 TLAk~LaglLp~vgvIsmDdy~~~~~~i~~nfD~P~a~D~d~L~enL~~Lr~GksV~iPiYDf~t~~r~~~~~i~v~p~~  159 (656)
T PLN02318         80 VFTEKVLNFMPSIAVISMDNYNDSSRIIDGNFDDPRLTDYDTLLDNIHDLKAGKSVQVPIYDFKSSSRVGYRTLEVPSSR  159 (656)
T ss_pred             HHHHHHHhhCCCcEEEEEcceecchhhhCccCCChhhcchhHHHHHHHHHhCCCceecCccccccCcccCCceeecCCCc
Confidence            99999999998889999999986555556899999999999999999999999999999999999988765567788999


Q ss_pred             eEEEEehhhhhhcccCCccEEEEEeCChhhHHHHHHhhhhhhcCCCHHHHHHHHHhcCCcchhhhccCCcCCccEEEeCC
Q 006667          136 IVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK  215 (636)
Q Consensus       136 VIIVEGiyaL~~eLRdl~DLKIFVDad~D~RL~RRI~RDi~eRGrslEeVl~qyl~~VrP~~ekfIePtk~~ADIIIpN~  215 (636)
                      ||||||+|++++++++++|++|||++|.|.++.||+.||+.+||+++++++++|..+|+|+|.+||+|++++||+||.|+
T Consensus       160 VVIVEGIyaL~~~Lr~LlDlkIFVDtdvDirL~RRI~RD~~eRGrs~EsVi~q~~~~VkP~y~~FIeP~kk~ADIII~n~  239 (656)
T PLN02318        160 IVIIEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIVNK  239 (656)
T ss_pred             EEEEechhhccHhHHhhCCEEEEEcCCccHHHHHHHHHHHHHhCCCHHHHHHHHHHhhcchHHHHhCcchhcceEEEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCeeeecCCCcccHHHHHHHhcccccccccceeeeEecCCCCCcccccceEEeeecCCeEEEEEeeeecCCC
Q 006667          216 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSP  295 (636)
Q Consensus       216 f~p~~g~~n~v~iLKsa~~i~~d~I~~~L~~~~~~~~e~~~DIYLlpPt~df~~tdeaLRiR~~dg~~~Ltykgp~~d~~  295 (636)
                      |+|++|++|++||||+.+++.+++|+.+|.+....++++++||||+||++||++|++|||||++||+|+||||+|++|++
T Consensus       240 f~P~~g~~np~~Ilk~~~~~~~~~i~~~L~~~~~~~~~~~~DiYl~~P~~d~~~~~e~LRvR~~~Gk~~Ltyke~i~dgp  319 (656)
T PLN02318        240 FNPFSGFQNPTYILKSSRSVTVEQIKAVLSEDHTETTEETYDIYLLPPGEDPETCQSYLRMRNRDGKYSLMFEEWVTDEP  319 (656)
T ss_pred             CCCCCCCCCCeEEecCCccccHHHHHHHhhhccccccceeeEEEecCCCCCchhccceEEEEecCCEEEEEEecccccCC
Confidence            99999999999999999999999999999999889999999999999999999999999999999999999999999999


Q ss_pred             cccccceeEEEeeechhhhhhcCCeEEEEEEeeeeeeeeCCEEEEeecccccCcceEEEecccHHHHHHHHHHcCCCCCc
Q 006667          296 FIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSY  375 (636)
Q Consensus       296 fiikPR~efev~v~~~~gL~~LGy~~aa~V~R~re~y~~~~~~i~lD~ve~Lg~~FveIeg~~r~~v~~~~~~Lgl~G~~  375 (636)
                      |||.|+++|||+|++++||++|||+++|+|+|.|++|.+|+++|++|||||||++||||||.+|+.|.++|++|||+|+|
T Consensus       320 ~ii~pk~~fEv~v~~~~gL~aLGy~~~a~vkk~r~iy~~g~v~i~lD~ve~Lg~~FvqIeg~~r~~V~~~a~kLGl~g~~  399 (656)
T PLN02318        320 FIISPRITFEVSVRLLGGLMALGYTIATILKRSSHVFSDDKVCVKIDWLEQLNRKYVQVQGKDRLVVKDVAEQLGLEGSY  399 (656)
T ss_pred             eecCcceeEEEeeehHhHHHHcCCceEEEEEEEEEEEecCCEEEEeehhhccCCeeEEEehhHHHHHHHHHHHcCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchhHHHHHhhhccccccCCChhhhcccccCcccccCchhhhhhhhhhhhhhccccccccccccccccccccccccccc
Q 006667          376 VPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVN  455 (636)
Q Consensus       376 i~kSYLEli~lek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  455 (636)
                      ||+||||||||||+++++|+||||||+|||+|+++|+||||||+|||||||+|++++|||||||+||+||++||++++++
T Consensus       400 i~~SYlE~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  479 (656)
T PLN02318        400 IPRTYIEQIQLEKLVNEVMALPEDLKTKLSLDDDLVSSPKEALSRASADRRNKNLKSGLSHSYSTQRDKNLSKLTGLAVT  479 (656)
T ss_pred             ccccHHHHHHHHHhHHHHhhccHHhhhhcccccccccCcHHHhhhhhhhhhhhhcccCcccccccccccccccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCCcccccchhHHHHHHHHhhHhHhHHHHHHHHHHhhhcccccccCcccccccccccccCCCCCcceeecc
Q 006667          456 NRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTG  535 (636)
Q Consensus       456 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  535 (636)
                      +||||+|++++||++ |||+|+|||||||+|||||||||||||||||||+++|+||||||+|+|+|+||||||||||++|
T Consensus       480 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  558 (656)
T PLN02318        480 NRRFDERNSESPAAL-NQGAITQLSEQISSLNERMDEFTSRIEELNSKLSIKKNSPSQQNLALQAEACNGSAPTSYFVSG  558 (656)
T ss_pred             ccccCCCCCCCchhh-ccchHHHHHHhhcchhhhhHHHHHHHHHHhhccccccCChhhhhhhccccccCCCCcchhhhcc
Confidence            999999999999999 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCccccccccCCCCcccccccchhHHHHHHHhhhhHHHHHhHhhHHHHHHHhhhhcccccccCCCCceeeccccccce
Q 006667          536 LANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPL  615 (636)
Q Consensus       536 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  615 (636)
                      ++||+|||++||+|||||||++|+||||||..++|||||||||||||+|||||++|||++..  .+++.+.++++..+|+
T Consensus       559 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~  636 (656)
T PLN02318        559 LGNGSLTGSILPLSSSSSQLAKESPLMEEILGIARGQRQVMHQLDNLSNLLHESLGERSGRN--RRNSRLLNVDSSQLPL  636 (656)
T ss_pred             CCCcccccccccccccccccCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccc--hhhccccccCcccchH
Confidence            99999999999999999999999999999999999999999999999999999999999655  4566778899999999


Q ss_pred             eeeeeccceeeeeeccccc
Q 006667          616 ILTLAVGGLGLFLFKGLTF  634 (636)
Q Consensus       616 ~~~~~~~~~~~~~~~~~~~  634 (636)
                      +++||+||+|+|+|+++.+
T Consensus       637 ~~~~~~~~~~~~~~~~~~~  655 (656)
T PLN02318        637 ILSLAIGGIGIFLFKRLKN  655 (656)
T ss_pred             HHHHHHhhhhhhhhhhhhc
Confidence            9999999999999999865

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR00318 cyaB adenylyl cyclase CyaB, putative Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd07762 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the CYTH-like superfamily Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PF01928 CYTH: CYTH domain; InterPro: IPR008172 The CYTH domain is an ancient enzymatic domain that was present in the Last Universal Common Ancestor and was involved in nucleotide or organic phosphate metabolism [] Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>cd07758 ThTPase Thiamine Triphosphatase Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd07891 CYTH-like_CthTTM-like_1 CYTH-like Clostridium thermocellum TTM-like subgroup 1 Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>cd07761 CYTH-like_CthTTM-like Clostridium thermocellum (Cth)TTM and similar proteins, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>COG2954 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query636
3asy_A211 Ligand-Free Structure Of Uridine Kinase From Thermu 3e-14
1xrj_A261 Rapid Structure Determination Of Human Uridine-Cyti 6e-14
1udw_A252 Crystal Structure Of Human Uridine-cytidine Kinase 9e-14
2jeo_A245 Crystal Structure Of Human Uridine-Cytidine Kinase 9e-14
>pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211 Back     alignment and structure 
Iteration: 1

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 57/186 (30%), Positives = 93/186 (50%), Gaps = 15/186 (8%)
Query: 48  GPSGAGKTVFTEKVLNFM-PSIAVITMDNYNDS------SRIIDGNFDDPRLTDYDTLLE 100
           G + +GKT   + +   +   +A++ MD+Y            +  N+D P   D    LE
Sbjct: 13  GGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLE 72
Query: 101 NIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEK-LRPLIDLRVSV 159
           + + L  G  V++P+YDF++ +R   RT   P+  +VI+EGI  L  K LR L+DL+V V
Sbjct: 73  HAQALLRGLPVEMPVYDFRAYTRSPRRTPVRPAP-VVILEGILVLYPKELRDLMDLKVFV 131
Query: 160 TGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPF 219
                   ++R+ RD+   G+  E ++ Q  E V PM+  F+EP  + A + +       
Sbjct: 132 DADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPR----- 186
Query: 220 TGFQNP 225
            G QNP
Sbjct: 187 -GGQNP 191
>pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261 Back     alignment and structure
>pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252 Back     alignment and structure
>pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query636
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 1e-46
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 4e-43
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 2e-41
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 2e-37
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 4e-29
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 2e-21
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 1e-19
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 6e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 1e-12
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 3e-12
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 3e-06
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
 Score =  162 bits (413), Expect = 1e-46
 Identities = 57/189 (30%), Positives = 96/189 (50%), Gaps = 15/189 (7%)

Query: 48  GPSGAGKTVFTEKVLN-FMPSIAVITMDNY-NDSSRI-----IDGNFDDPRLTDYDTLLE 100
           G + +GKT   + +       +A++ MD+Y  D   +     +  N+D P   D    LE
Sbjct: 13  GGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLE 72

Query: 101 NIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALS-EKLRPLIDLRVSV 159
           + + L  G  V++P+YDF++ +R   R   V  + +VI+EGI  L  ++LR L+DL+V V
Sbjct: 73  HAQALLRGLPVEMPVYDFRAYTRSP-RRTPVRPAPVVILEGILVLYPKELRDLMDLKVFV 131

Query: 160 TGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPF 219
                   ++R+ RD+   G+  E ++ Q  E V PM+  F+EP  + A + I+      
Sbjct: 132 DADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADV-IVP----- 185

Query: 220 TGFQNPTYI 228
            G QNP  +
Sbjct: 186 RGGQNPVAL 194
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Length = 183 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query636
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.94
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.91
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.91
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.9
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.89
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 99.88
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.87
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.87
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.86
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.86
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.82
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 99.78
3ghx_A179 Adenylate cyclase CYAB; CYTH domain, antiparallel 99.78
1yem_A179 Hypothetical protein; structural genomics, southea 99.77
3n10_A179 Adenylate cyclase 2; CYTH domain, antiparallel bar 99.7
2dc4_A165 PH1012 protein, 165AA long hypothetical protein; d 99.68
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.61
2aca_A189 Putative adenylate cyclase; NESG, VPR19, Q87NV8, s 99.6
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.56
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.52
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 99.51
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.4
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.35
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.33
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.33
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.27
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.26
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 99.25
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 99.25
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.24
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.2
3bhd_A234 Thtpase, thiamine triphosphatase; hydrolase, struc 99.18
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 99.14
3r20_A233 Cytidylate kinase; structural genomics, seattle st 99.08
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.99
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.97
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.96
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.89
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.89
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.87
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.84
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.81
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.81
3tj7_A195 GBAA_1210 protein; structural genomics, adenosine 98.8
2gfg_A193 BH2851; antiparallel barrel, structural genomics, 98.77
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.76
3v85_A210 CYTH-like phosphatase; CYTH domain, hydrolase; HET 98.72
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.67
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.67
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 98.66
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.65
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.65
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.65
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.65
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.64
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.64
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.63
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.63
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.62
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.6
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.58
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.58
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.58
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.55
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.55
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.49
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.47
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.44
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.42
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.41
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.41
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.39
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.36
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.35
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.35
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.34
1via_A175 Shikimate kinase; structural genomics, transferase 98.34
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.31
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.28
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.28
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.26
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 98.26
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.24
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.21
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.21
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.21
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 98.2
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.2
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.18
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.15
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.13
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.12
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.11
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.11
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.1
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.1
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.07
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.07
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.07
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.02
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 98.01
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.99
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.96
2fbl_A153 Hypothetical protein NE1496; APC5855, PSI, protein 97.94
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.93
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.9
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.83
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.78
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.73
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.73
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.69
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 97.67
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.61
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.58
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 97.56
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.54
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.53
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 97.47
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 97.44
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.36
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.35
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.34
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 97.3
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 97.24
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.18
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.17
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 97.12
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.11
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.07
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.05
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.6
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.58
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.51
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.44
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.43
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.28
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.23
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.12
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.08
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 95.98
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.88
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.87
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.71
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.71
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.69
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.6
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 95.59
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.59
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.57
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.52
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.52
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.45
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.45
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.44
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.43
2og2_A359 Putative signal recognition particle receptor; nuc 95.41
3bos_A242 Putative DNA replication factor; P-loop containing 95.35
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.32
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.32
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.29
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.27
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.23
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.21
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.2
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 95.18
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.18
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.13
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.13
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 95.11
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.1
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.1
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.09
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.06
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.05
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.04
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.93
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.9
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.86
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.86
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 94.84
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.77
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.76
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.74
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.73
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.72
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 94.7
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.7
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.7
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.68
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 94.68
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.64
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.63
1kjw_A295 Postsynaptic density protein 95; protein-protein i 94.63
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.61
2xxa_A433 Signal recognition particle protein; protein trans 94.6
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.59
1g6h_A257 High-affinity branched-chain amino acid transport 94.55
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 94.55
2ghi_A260 Transport protein; multidrug resistance protein, M 94.52
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.5
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.47
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.46
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.43
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.42
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.42
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 94.41
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.39
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.37
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.36
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.35
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.31
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 94.31
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.3
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.3
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.28
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.26
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.26
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.25
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.23
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.21
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 94.2
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.19
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 94.17
3kta_A182 Chromosome segregation protein SMC; structural mai 94.17
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.15
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.14
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.12
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.11
2oap_1511 GSPE-2, type II secretion system protein; hexameri 94.11
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 94.08
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 94.08
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 94.02
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 93.98
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.97
1p9r_A418 General secretion pathway protein E; bacterial typ 93.96
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.71
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.7
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.69
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 93.61
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.59
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 93.58
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.58
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 93.53
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.5
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.47
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.45
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.35
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 93.32
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 93.31
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 93.31
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 93.3
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.28
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.2
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 93.16
2r62_A268 Cell division protease FTSH homolog; ATPase domain 93.15
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.09
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 93.03
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 93.02
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 93.01
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 93.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 92.95
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.9
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 92.9
2z43_A324 DNA repair and recombination protein RADA; archaea 92.86
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 92.86
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 92.82
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.82
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.78
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 92.77
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.74
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 92.74
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 92.66
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 92.64
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 92.62
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 92.62
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 92.57
2fna_A357 Conserved hypothetical protein; structural genomic 92.53
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.51
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.51
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 92.51
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.41
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 92.41
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.39
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 92.38
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 92.38
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 92.37
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 92.36
2ged_A193 SR-beta, signal recognition particle receptor beta 92.35
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 92.34
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 92.25
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 92.2
2xkx_A721 Disks large homolog 4; structural protein, scaffol 92.0
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 91.96
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 91.95
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 91.94
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 91.91
1u94_A356 RECA protein, recombinase A; homologous recombinat 91.88
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 91.83
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 91.74
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 91.64
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 91.6
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.55
2hf9_A226 Probable hydrogenase nickel incorporation protein 91.55
3co5_A143 Putative two-component system transcriptional RES 91.49
1tue_A212 Replication protein E1; helicase, replication, E1E 91.49
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 91.47
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.47
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 91.41
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 91.28
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 91.26
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 91.25
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 91.22
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 91.21
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 91.21
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 91.19
3end_A307 Light-independent protochlorophyllide reductase ir 91.18
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 91.17
2r44_A331 Uncharacterized protein; putative ATPase, structur 91.16
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.14
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 91.05
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 90.97
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.97
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 90.96
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 90.92
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 90.88
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 90.86
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 90.84
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 90.82
1ojl_A304 Transcriptional regulatory protein ZRAR; response 90.82
3pvs_A447 Replication-associated recombination protein A; ma 90.8
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 90.8
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 90.77
1xp8_A366 RECA protein, recombinase A; recombination, radior 90.72
2wji_A165 Ferrous iron transport protein B homolog; membrane 90.67
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 90.63
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 90.63
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 90.62
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 90.59
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 90.58
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.55
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 90.45
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 90.42
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 90.33
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 90.32
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 90.32
2qgz_A308 Helicase loader, putative primosome component; str 90.25
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.22
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 90.21
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 90.2
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 90.17
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 90.15
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.1
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 90.04
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 89.98
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 89.96
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 89.95
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 89.91
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 89.8
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 89.78
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 89.76
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 89.68
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 89.66
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 89.62
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 89.6
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 89.59
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 89.58
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 89.54
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 89.54
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 89.49
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 89.47
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 89.45
3fwy_A314 Light-independent protochlorophyllide reductase I 89.38
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 89.37
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 89.34
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 89.33
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 89.32
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 89.32
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 89.3
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 89.28
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 89.26
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.25
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 89.09
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 89.04
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 89.02
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 89.01
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 88.97
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 88.92
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 88.89
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 88.88
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 88.87
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 88.84
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 88.82
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 88.77
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 88.77
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 88.77
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 88.77
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 88.72
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 88.71
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 88.69
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 88.67
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 88.65
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 88.63
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 88.62
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 88.59
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 88.55
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 88.48
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 88.36
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 88.35
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 88.33
1nrj_B218 SR-beta, signal recognition particle receptor beta 88.31
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 88.22
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 88.21
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 88.17
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 88.09
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 88.09
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 88.01
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 87.98
3t1o_A198 Gliding protein MGLA; G domain containing protein, 87.89
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 87.87
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 87.75
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 87.72
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 87.71
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 87.67
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 87.56
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 87.56
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 87.51
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 87.49
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 87.42
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 87.38
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 87.37
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 87.33
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 87.27
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 87.27
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 87.25
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 87.25
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 87.22
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 87.01
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 86.99
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 86.98
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 86.98
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 86.95
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 86.95
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 86.94
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 86.92
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 86.84
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 86.81
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.79
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 86.69
3lxx_A239 GTPase IMAP family member 4; structural genomics c 86.56
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 86.56
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 86.55
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 86.52
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 86.48
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 86.47
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 86.47
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 86.44
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 86.42
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 86.4
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 86.36
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 86.33
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 86.26
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 86.19
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 86.18
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 86.08
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 86.04
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 85.98
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 85.96
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 85.86
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.83
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 85.83
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 85.81
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 85.78
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 85.71
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 85.68
4aby_A415 DNA repair protein RECN; hydrolase, double strand 85.67
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 85.65
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 85.61
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 85.6
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 85.56
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 85.45
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 85.44
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 85.43
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 85.4
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 85.36
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 85.31
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 85.3
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 85.3
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 85.24
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 85.21
1e69_A322 Chromosome segregation SMC protein; structural mai 85.18
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 85.16
3io5_A333 Recombination and repair protein; storage dimer, i 85.12
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 85.07
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 85.04
2fh5_B214 SR-beta, signal recognition particle receptor beta 84.99
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 84.98
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 84.95
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 84.92
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
Probab=99.94  E-value=1.2e-26  Score=242.80  Aligned_cols=174  Identities=19%  Similarity=0.199  Sum_probs=147.5

Q ss_pred             eEEEEeCCCCCcHHHHHHHHHHhCC------CcEEEEcccccCCccc-----ccCCCCCcccccHHHHHHHHHhhhCCC-
Q 006667           42 TLSFEKGPSGAGKTVFTEKVLNFMP------SIAVITMDNYNDSSRI-----IDGNFDDPRLTDYDTLLENIRGLKEGK-  109 (636)
Q Consensus        42 ~IIgIsGgSGSGKTTLAkkLae~L~------~v~VIsmDdY~~~~r~-----~dgnfD~P~afD~dlL~~~L~~Lk~Gk-  109 (636)
                      .+|+|+||+|||||||++.|...++      .+.++++|+|+.....     ...+|++|.+||++.+.+.|..+++|+ 
T Consensus        93 ~iigI~GpsGSGKSTl~~~L~~ll~~~~~~~~v~~i~~D~f~~~~~~l~~~~~~~~~g~P~~~D~~~l~~~L~~L~~g~~  172 (321)
T 3tqc_A           93 YIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQR  172 (321)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHTTCGGGTTSGGGBCHHHHHHHHHHHHTTCS
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHhcccCCCCeEEEEeecccccchhhhhhHHHHhhccCcccccHHHHHHHHHhhhcccc
Confidence            4778899999999999999998863      4889999999754321     112578899999999999999999999 


Q ss_pred             ceeeeeeeccCCcccCcceeecCCCceEEEEehhhhhhc-----------ccCCccEEEEEeCChhhHHHHHHhhhhhhc
Q 006667          110 AVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEK-----------LRPLIDLRVSVTGGVHFDLVKRVFRDIQRV  178 (636)
Q Consensus       110 ~I~iPvYDf~t~~R~~~eti~v~~~dVIIVEGiyaL~~e-----------LRdl~DLKIFVDad~D~RL~RRI~RDi~eR  178 (636)
                      .+.+|.||+..+.+.......+.+.+|||+||+++++..           +++++|.+|||++|.++|+.|++.||...|
T Consensus       173 ~v~~P~yd~~~~~r~~~~~~~v~~~dIVIvEGi~lL~~~~~~~~~~~~~~l~~~~D~~I~Vda~~d~~~~R~i~Rd~~~r  252 (321)
T 3tqc_A          173 NVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFW  252 (321)
T ss_dssp             SEEEEEEETTTTEEEEEEEEEECSCSEEEEECTTTTCCCCCSSSSSCCCCGGGGCSEEEEEECCHHHHHHHHHHHHHHHH
T ss_pred             ccccchhhhhccccccCceeeccCCCEEEEEccccccccccccccchhhhhhhhcCeEEEEECCHHHHHHHHHHhcchhh
Confidence            999999999999886544556788899999999999844           889999999999999999999999998876


Q ss_pred             C---------------CCHHHH----HHHHHhcCCcchhhhccCCcCCccEEEeCC
Q 006667          179 G---------------QEPEEI----IHQISETVYPMYKAFIEPDLQTAHIKIINK  215 (636)
Q Consensus       179 G---------------rslEeV----l~qyl~~VrP~~ekfIePtk~~ADIIIpN~  215 (636)
                      |               .+.+++    .++|....+|++++||+|++.+||+||+.+
T Consensus       253 ~~a~~~~~s~~~~y~~~s~~ea~~~a~~~w~~~~~pn~~~~I~ptr~~Adlil~~g  308 (321)
T 3tqc_A          253 RTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKA  308 (321)
T ss_dssp             HTGGGSTTSTTGGGGGSCHHHHHHHHHHHHHHTHHHHHHHHTGGGGGGCSEEEEEC
T ss_pred             hhhccChHHHHHHHhcCCHHHHHHHHHHHHHhccccCHHHhCccCccCceEEEecC
Confidence            5               455443    456777778999999999999999999843
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Back     alignment and structure
>3n10_A Adenylate cyclase 2; CYTH domain, antiparallel barrel, product complex, cyclic AM; HET: CMP; 1.60A {Yersinia pestis} PDB: 3n0z_A* 3n0y_A* 2fjt_A Back     alignment and structure
>2dc4_A PH1012 protein, 165AA long hypothetical protein; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2aca_A Putative adenylate cyclase; NESG, VPR19, Q87NV8, structural genomics, PSI, protein structure initiative; 2.25A {Vibrio parahaemolyticus} SCOP: d.63.1.2 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3bhd_A Thtpase, thiamine triphosphatase; hydrolase, structural genomics consortium, CYTH SGC; HET: MSE CIT; 1.50A {Homo sapiens} PDB: 2jmu_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3tj7_A GBAA_1210 protein; structural genomics, adenosine monophosphate, center for STR genomics of infectious diseases, csgid; HET: AMP; 2.10A {Bacillus anthracis} PDB: 3sy3_A* Back     alignment and structure
>2gfg_A BH2851; antiparallel barrel, structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, unknow function; 2.12A {Bacillus halodurans} Back     alignment and structure
>3v85_A CYTH-like phosphatase; CYTH domain, hydrolase; HET: CIT; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2fbl_A Hypothetical protein NE1496; APC5855, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.90A {Nitrosomonas europaea} SCOP: d.63.1.2 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 636
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 1e-28
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 4e-16
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 6e-14
d2acaa1174 d.63.1.2 (A:8-181) Putative adenylate cyclase VP17 5e-10
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 1e-08
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

 Score =  113 bits (285), Expect = 1e-28
 Identities = 28/196 (14%), Positives = 51/196 (26%), Gaps = 32/196 (16%)

Query: 48  GPSGAGKTVFTEKVLNFMP----SIAVITMDNYNDSSR--------------IIDGNFDD 89
           G SGAG +                   I  D ++  +R                  +   
Sbjct: 11  GSSGAGTSTVKHTFDQIFRREGVKAVSIEGDAFHRFNRADMKAELDRRYAAGDATFSHFS 70

Query: 90  PRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYR---------TLEVPSSRIVIIE 140
               +   L    R   E    +   Y    +                     S ++  E
Sbjct: 71  YEANELKELERVFREYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRDFDSDSHLLFYE 130

Query: 141 GIYAL----SEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPM 196
           G++         +  L DL++ V   ++ + ++++ RD    G   E +   I       
Sbjct: 131 GLHGAVVNSEVNIAGLADLKIGVVPVINLEWIQKIHRDRATRGYTTEAVTDVI-LRRMHA 189

Query: 197 YKAFIEPDLQTAHIKI 212
           Y   I P      I  
Sbjct: 190 YVHCIVPQFSQTDINF 205
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Length = 174 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query636
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 100.0
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 100.0
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.96
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.87
d1yema_163 Hypothetical protein PF0863 {Pyrococcus furiosus [ 99.72
d2acaa1174 Putative adenylate cyclase VP1760 {Vibrio parahaem 99.69
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.68
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.55
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.54
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.49
d2jmua1223 Thiamine-triphosphatase (ThTPase) {Mouse (Mus musc 99.31
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 99.02
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.86
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.78
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.74
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.74
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.73
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.73
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.71
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.64
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.58
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.58
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.56
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.55
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.48
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.47
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 98.45
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.43
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 98.42
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.4
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.39
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.39
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.27
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.24
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.17
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.16
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.14
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.13
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 98.09
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.07
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.04
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.01
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.99
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.98
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.92
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.87
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.87
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.78
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.74
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.73
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.71
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 97.56
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.56
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.53
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.53
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 97.46
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.37
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.3
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.27
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.23
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 97.14
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.06
d1vmaa2213 GTPase domain of the signal recognition particle r 96.98
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.91
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.87
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.82
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.76
d1okkd2207 GTPase domain of the signal recognition particle r 96.7
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.69
d2qy9a2211 GTPase domain of the signal recognition particle r 96.62
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.55
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.27
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.13
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.97
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.88
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.85
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.65
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.57
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.51
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.31
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.26
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.14
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.13
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.05
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.04
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.02
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.01
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.94
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.73
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.72
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.69
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.69
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.69
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.62
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.5
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.42
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.39
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.36
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.31
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.31
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.21
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.19
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.16
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.15
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.05
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.02
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.99
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 93.97
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.87
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.84
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.66
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.66
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.56
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.52
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.5
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.38
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.28
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.24
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.2
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.13
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.11
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.07
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.9
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.89
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.66
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.58
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.47
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 92.32
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.31
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.25
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 91.93
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.92
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 91.87
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.69
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.63
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 91.4
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 91.24
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 91.18
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.09
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.04
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.83
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.76
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 90.71
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.63
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.37
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.96
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.86
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.71
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.66
d2fbla1150 Hypothetical protein NE1496 {Nitrosomonas europaea 89.42
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.36
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 89.23
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 88.87
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.87
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 88.73
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.73
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 88.7
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 88.63
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 88.59
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.58
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.51
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 88.32
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.17
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.87
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.83
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.78
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.6
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.51
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 87.4
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.15
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 87.09
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.0
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 86.95
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 86.58
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 86.43
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 86.15
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.94
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.93
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 85.92
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.68
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.65
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 85.61
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 85.35
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.21
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.2
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 85.16
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.14
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 85.09
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.09
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.04
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 84.81
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.47
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 84.42
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.4
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 84.38
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.35
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 84.34
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.22
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 83.93
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.89
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.83
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 83.79
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 83.74
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 83.48
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.14
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 83.0
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 82.78
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 82.77
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 82.74
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 82.28
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 82.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 82.24
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 81.88
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 81.76
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 81.63
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 81.62
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 80.62
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 80.31
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.3
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 80.3
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.13
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.5e-34  Score=274.40  Aligned_cols=193  Identities=27%  Similarity=0.465  Sum_probs=168.5

Q ss_pred             CeEEEEeCCCCCcHHHHHHHHHHhCC---------CcEEEEcccccCCcc------c--ccCCCCCcccccHHHHHHHHH
Q 006667           41 DTLSFEKGPSGAGKTVFTEKVLNFMP---------SIAVITMDNYNDSSR------I--IDGNFDDPRLTDYDTLLENIR  103 (636)
Q Consensus        41 ~~IIgIsGgSGSGKTTLAkkLae~L~---------~v~VIsmDdY~~~~r------~--~dgnfD~P~afD~dlL~~~L~  103 (636)
                      +-||||+||+||||||||+.|++.|+         .+.+|++|+||....      .  ...+|++|.++|++.|.+++.
T Consensus         2 P~iIgI~G~~gSGKSTla~~L~~~l~~~~~~~~~~~~~vi~~D~yy~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   81 (213)
T d1uj2a_           2 PFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLK   81 (213)
T ss_dssp             CEEEEEECSTTSSHHHHHHHHHHHTTGGGSCGGGCSEEEEEGGGGBCCCCHHHHHHHHTTCSCTTSGGGBCHHHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHhchhccccCCCceEEEeccccccccchhhhhhhhhcccccCCcHHHHHHHHHhhhh
Confidence            34899999999999999999999985         368999999976421      1  235799999999999999999


Q ss_pred             hhhCCCceeeeeeeccCCcccCcceeecCCCceEEEEehhhhh-hcccCCccEEEEEeCChhhHHHHHHhhhhhhcCCCH
Q 006667          104 GLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALS-EKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEP  182 (636)
Q Consensus       104 ~Lk~Gk~I~iPvYDf~t~~R~~~eti~v~~~dVIIVEGiyaL~-~eLRdl~DLKIFVDad~D~RL~RRI~RDi~eRGrsl  182 (636)
                      .+++|..+..|.|++..+.+.. ......+.+++|+||+++++ ..+++++|++|||++|.++|+.||+.||...||++.
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~iiveg~~~l~~~~l~~~~D~~i~v~~~~~~~~~R~~~Rd~~~rg~~~  160 (213)
T d1uj2a_          82 EITEGKTVQIPVYDFVSHSRKE-ETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDL  160 (213)
T ss_dssp             HHHTTCCEEEEEEETTTTEEEE-EEEEECCCSEEEEECTTTTSSHHHHHHCSEEEEEECCHHHHHHHHHHHHHHHSCCCH
T ss_pred             hhhcCCcccccccccccccccC-ceEEecccceEEecchhhhccHHHHhhhheeeeecCCHHHHHHHHHHHHHHHcCCCH
Confidence            9999999999999999988764 34456788999999999988 689999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCcchhhhccCCcCCccEEEeCCCCCCCCCCCCeeeecCCCcccHHHHHHHhc
Q 006667          183 EEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMS  245 (636)
Q Consensus       183 EeVl~qyl~~VrP~~ekfIePtk~~ADIIIpN~f~p~~g~~n~v~iLKsa~~i~~d~I~~~L~  245 (636)
                      ++++++|...++|+|++||+|++++||+||+|+.+      +.+     +++.++++|+.+|.
T Consensus       161 e~~~~~~~~~~~~~~~~~i~p~k~~ADlIi~~~~d------~~~-----~i~~i~~~I~~ll~  212 (213)
T d1uj2a_         161 EQILSQYITFVKPAFEEFCLPTKKYADVIIPRGAD------NLV-----AINLIVQHIQDILN  212 (213)
T ss_dssp             HHHHHHHHHTHHHHHHHHTGGGGGGCSEEEETGGG------CHH-----HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhHHHHHHHhhhhHhcCCEEEeCCCc------cHH-----HHHHHHHHHHHHhC
Confidence            99999999999999999999999999999987643      222     45778888887774
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure