Citrus Sinensis ID: 006955


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620----
MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
cccccccHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHcHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccc
cccccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEccc
MRNARIQEAQNLfdkmpqrdtVTWNVMIRGYFKNGFLDNAMCLfnqmperdmftYNTVIAGLMqsdnvqgakevfdgmevrdVVTWNSMISGYVCNGLIDEALRvfhgmplkdvVSWNLVIGALVNCQRMDLAESYFkemgardvaSWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYlekypysniasWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGlgendlgeeGLKFFVQMkesgpspdnatfTSVLTIcsdlptldlGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLefssvpihdiiswnSIICGLAYHGYAEKALELFERmrltdfkpdditfVGVLSACsyaglvdqgRYYFDcmknkyflqprsahYTCVVDLLGRFGLIDEAMNLLNEIRadgievspTVWGALLGAcrihnnikvgeiagervmelepnnsgvYLILTEMYLSCGRREDAKRIFAQMKengvkkepgcswiqindgghvflsgdsshpkfHRLRYLLNLLHTEIEREILFDAYY
MRNARIQEAqnlfdkmpqrdtVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMkengvkkepgcSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFglgendlgeeglKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
******************RDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQM*********ATFTSVLTICSDLPTLDLGRQIHAQAIKIAR************MYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAY*
MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
**NARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIAGLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIEREILFDAYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query624 2.2.26 [Sep-21-2011]
Q9SY02781 Pentatricopeptide repeat- yes no 0.955 0.763 0.390 1e-139
Q56XI1705 Pentatricopeptide repeat- no no 0.921 0.815 0.358 1e-118
Q9FXB9704 Pentatricopeptide repeat- no no 0.903 0.801 0.357 1e-116
O64766627 Pentatricopeptide repeat- no no 0.935 0.931 0.335 1e-110
Q9C8L6717 Pentatricopeptide repeat- no no 0.979 0.852 0.319 1e-103
Q9SIT7697 Pentatricopeptide repeat- no no 0.937 0.839 0.342 1e-103
P0C7R0761 Pentatricopeptide repeat- no no 0.940 0.771 0.332 1e-98
Q9SHZ8786 Pentatricopeptide repeat- no no 0.942 0.748 0.346 9e-98
O04590656 Pentatricopeptide repeat- no no 0.875 0.832 0.334 1e-97
Q9FHF9697 Pentatricopeptide repeat- no no 0.866 0.776 0.347 5e-95
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function desciption
 Score =  495 bits (1274), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/599 (39%), Positives = 366/599 (61%), Gaps = 3/599 (0%)

Query: 1   MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIA 60
           MR  R  EA  +F +MP+  +V++N MI GY +NG  + A  LF++MPERD+ ++N +I 
Sbjct: 75  MRTGRCNEALRVFKRMPRWSSVSYNGMISGYLRNGEFELARKLFDEMPERDLVSWNVMIK 134

Query: 61  GLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLV 120
           G +++ N+  A+E+F+ M  RDV +WN+M+SGY  NG +D+A  VF  MP K+ VSWN +
Sbjct: 135 GYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQNGCVDDARSVFDRMPEKNDVSWNAL 194

Query: 121 IGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWN 180
           + A V   +M+ A   FK      + SW  ++ G V++ +IVEAR+ FD M  +DV +WN
Sbjct: 195 LSAYVQNSKMEEACMLFKSRENWALVSWNCLLGGFVKKKKIVEARQFFDSMNVRDVVSWN 254

Query: 181 LMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKT 240
            +I GY  +G +  A  LF +   +D+ +W  +++G + +R ++ A   F +MPE  E +
Sbjct: 255 TIITGYAQSGKIDEARQLFDESPVQDVFTWTAMVSGYIQNRMVEEARELFDKMPERNEVS 314

Query: 241 WNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDV 300
           WN++++  ++   ++ A    +  P  N+++W  +I GY + G++  A  +F+ M  RD 
Sbjct: 315 WNAMLAGYVQGERMEMAKELFDVMPCRNVSTWNTMITGYAQCGKISEAKNLFDKMPKRDP 374

Query: 301 TVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQ 360
             W  MI G  ++    E L+ FVQM+  G   + ++F+S L+ C+D+  L+LG+Q+H +
Sbjct: 375 VSWAAMIAGYSQSGHSFEALRLFVQMEREGGRLNRSSFSSALSTCADVVALELGKQLHGR 434

Query: 361 AIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKA 420
            +K        V NA++ MY +CG+I+ A   F  +   DI+SWN++I G + HG+ E A
Sbjct: 435 LVKGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKDIVSWNTMIAGYSRHGFGEVA 494

Query: 421 LELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVD 480
           L  FE M+    KPDD T V VLSACS+ GLVD+GR YF  M   Y + P S HY C+VD
Sbjct: 495 LRFFESMKREGLKPDDATMVAVLSACSHTGLVDKGRQYFYTMTQDYGVMPNSQHYACMVD 554

Query: 481 LLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNN 540
           LLGR GL+++A NL+  +     E    +WG LLGA R+H N ++ E A +++  +EP N
Sbjct: 555 LLGRAGLLEDAHNLMKNM---PFEPDAAIWGTLLGASRVHGNTELAETAADKIFAMEPEN 611

Query: 541 SGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPK 599
           SG+Y++L+ +Y S GR  D  ++  +M++ GVKK PG SWI+I +  H F  GD  HP+
Sbjct: 612 SGMYVLLSNLYASSGRWGDVGKLRVRMRDKGVKKVPGYSWIEIQNKTHTFSVGDEFHPE 670





Arabidopsis thaliana (taxid: 3702)
>sp|Q56XI1|PPR25_ARATH Pentatricopeptide repeat-containing protein At1g09410 OS=Arabidopsis thaliana GN=PCMP-H18 PE=2 SV=2 Back     alignment and function description
>sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protein At1g56690, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H69 PE=2 SV=1 Back     alignment and function description
>sp|O64766|PP185_ARATH Pentatricopeptide repeat-containing protein At2g35030, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E15 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8L6|PPR80_ARATH Pentatricopeptide repeat-containing protein At1g53600, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E63 PE=2 SV=2 Back     alignment and function description
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function description
>sp|P0C7R0|PPR69_ARATH Pentatricopeptide repeat-containing protein At1g32415, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E56 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=3 SV=1 Back     alignment and function description
>sp|O04590|PPR88_ARATH Pentatricopeptide repeat-containing protein At1g62260, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E10 PE=2 SV=1 Back     alignment and function description
>sp|Q9FHF9|PP419_ARATH Pentatricopeptide repeat-containing protein At5g46460, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H49 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query624
359477774691 PREDICTED: pentatricopeptide repeat-cont 0.908 0.820 0.655 0.0
147859671 833 hypothetical protein VITISV_026574 [Viti 0.972 0.728 0.646 0.0
449433223675 PREDICTED: pentatricopeptide repeat-cont 0.915 0.845 0.605 0.0
359491499 766 PREDICTED: pentatricopeptide repeat-cont 0.983 0.801 0.397 1e-143
357521591 980 Pentatricopeptide repeat-containing prot 0.983 0.626 0.401 1e-143
92870988 766 Tetratricopeptide-like helical [Medicago 0.983 0.801 0.401 1e-143
449497589 776 PREDICTED: pentatricopeptide repeat-cont 0.982 0.789 0.377 1e-141
449439555 776 PREDICTED: pentatricopeptide repeat-cont 0.982 0.789 0.376 1e-141
356511263 763 PREDICTED: pentatricopeptide repeat-cont 0.983 0.804 0.393 1e-139
297809863 776 pentatricopeptide repeat-containing prot 0.955 0.768 0.390 1e-138
>gi|359477774|ref|XP_002282129.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/619 (65%), Positives = 500/619 (80%)

Query: 1   MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIA 60
           MRN   +EAQ LFD+MPQR+TVT+N MIRGYF+NG     + LF++MPERD+F+YNT+IA
Sbjct: 52  MRNGFTEEAQMLFDEMPQRNTVTYNAMIRGYFQNGHFGEGVSLFDEMPERDIFSYNTMIA 111

Query: 61  GLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLV 120
           GLM+  ++ GA E+F  M  RDVV+WNSMISGYV NGLI EALRVF GM LKDVVSWNLV
Sbjct: 112 GLMKFGDINGASEIFQKMPFRDVVSWNSMISGYVSNGLIGEALRVFSGMVLKDVVSWNLV 171

Query: 121 IGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWN 180
           I  LV   ++DLAE +FKEMG RD+ASWT M++GL   GRIVEAR LF+ MP +DV+AWN
Sbjct: 172 IAGLVGVGKVDLAEEFFKEMGTRDIASWTTMISGLASAGRIVEARGLFEDMPVRDVRAWN 231

Query: 181 LMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKT 240
            MIAGY++NGC+ + E LFQKM  RD  SW ++INGLV ++RI  A+  F +MP+ C ++
Sbjct: 232 TMIAGYIENGCIEIGEVLFQKMPQRDFRSWNEMINGLVRNQRIQDAMRLFVEMPQKCRRS 291

Query: 241 WNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDV 300
           WNSI+  LIRNGL+KEAH++LEK P+S+  SWTN+IVGYFE GEV +A+ +FELM  RD 
Sbjct: 292 WNSIVFGLIRNGLIKEAHAFLEKSPFSDTVSWTNLIVGYFETGEVDTAVSIFELMPARDA 351

Query: 301 TVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQ 360
           T WNV+I+GLGEND GEEGLKFFV+MKE GP PD ATFTSVLTICSDLPTL LGRQIHAQ
Sbjct: 352 TAWNVIIWGLGENDHGEEGLKFFVKMKEGGPFPDEATFTSVLTICSDLPTLHLGRQIHAQ 411

Query: 361 AIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKA 420
             K   N F  VSNAM+T+YARCGN  SALL FS++  HD ISWNSIICGLA++G   +A
Sbjct: 412 VTKTGFNYFVAVSNAMVTLYARCGNSNSALLLFSAMRSHDFISWNSIICGLAHNGNGVEA 471

Query: 421 LELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVD 480
           +E+FE+MR  D KP+ ITFVGVLSACS+AGLVDQG+YYFD MK K  L+P   HYTC+VD
Sbjct: 472 IEVFEKMRSIDIKPNHITFVGVLSACSHAGLVDQGKYYFDFMKYKCCLEPTIEHYTCIVD 531

Query: 481 LLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNN 540
           LLGRFGLIDEAM+ L ++ A+G+EV  +VWGA+LGACRIH N++VGEIAGER++E+EP+N
Sbjct: 532 LLGRFGLIDEAMSFLRQMEANGVEVPASVWGAVLGACRIHKNMQVGEIAGERILEIEPHN 591

Query: 541 SGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKF 600
           SGVY+IL EMYLS G+REDA+R++ +M+E GVKK+P CSW+++N  GHVFLSGDSSHP+F
Sbjct: 592 SGVYIILAEMYLSSGKREDAERVWVRMREKGVKKQPACSWMEVNGSGHVFLSGDSSHPQF 651

Query: 601 HRLRYLLNLLHTEIEREIL 619
            R+  +L LLH E+E  IL
Sbjct: 652 SRVCGVLGLLHMEMEIGIL 670




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147859671|emb|CAN83112.1| hypothetical protein VITISV_026574 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449433223|ref|XP_004134397.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cucumis sativus] gi|449487596|ref|XP_004157705.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359491499|ref|XP_003634283.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357521591|ref|XP_003631084.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355525106|gb|AET05560.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|92870988|gb|ABE80149.1| Tetratricopeptide-like helical [Medicago truncatula] Back     alignment and taxonomy information
>gi|449497589|ref|XP_004160443.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439555|ref|XP_004137551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356511263|ref|XP_003524346.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Glycine max] Back     alignment and taxonomy information
>gi|297809863|ref|XP_002872815.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297318652|gb|EFH49074.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query624
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.955 0.763 0.385 5.5e-125
TAIR|locus:2012295705 AT1G09410 [Arabidopsis thalian 0.937 0.829 0.355 9.2e-107
TAIR|locus:2027554704 AT1G56690 [Arabidopsis thalian 0.900 0.798 0.358 5.8e-105
TAIR|locus:2044797627 AT2G35030 [Arabidopsis thalian 0.891 0.886 0.337 1.3e-98
TAIR|locus:2054131697 SLO2 "AT2G13600" [Arabidopsis 0.934 0.836 0.338 5e-92
TAIR|locus:2151501697 AT5G46460 [Arabidopsis thalian 0.871 0.780 0.350 1.8e-87
TAIR|locus:505006163761 AT1G32415 "AT1G32415" [Arabido 0.940 0.771 0.339 1.3e-86
TAIR|locus:2055919786 AT2G22070 "AT2G22070" [Arabido 0.919 0.730 0.337 2.7e-84
TAIR|locus:2018092656 MEF9 "AT1G62260" [Arabidopsis 0.899 0.855 0.326 7.2e-84
TAIR|locus:2131631804 AT4G35130 "AT4G35130" [Arabido 0.862 0.669 0.295 4e-81
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1228 (437.3 bits), Expect = 5.5e-125, P = 5.5e-125
 Identities = 231/599 (38%), Positives = 361/599 (60%)

Query:     1 MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMPERDMFTYNTVIA 60
             MR  R  EA  +F +MP+  +V++N MI GY +NG  + A  LF++MPERD+ ++N +I 
Sbjct:    75 MRTGRCNEALRVFKRMPRWSSVSYNGMISGYLRNGEFELARKLFDEMPERDLVSWNVMIK 134

Query:    61 GLMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLV 120
             G +++ N+  A+E+F+ M  RDV +WN+M+SGY  NG +D+A  VF  MP K+ VSWN +
Sbjct:   135 GYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQNGCVDDARSVFDRMPEKNDVSWNAL 194

Query:   121 IGALVNCQRMDLAESYFKEMGARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWN 180
             + A V   +M+ A   FK      + SW  ++ G V++ +IVEAR+ FD M  +DV +WN
Sbjct:   195 LSAYVQNSKMEEACMLFKSRENWALVSWNCLLGGFVKKKKIVEARQFFDSMNVRDVVSWN 254

Query:   181 LMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETCEKT 240
              +I GY  +G +  A  LF +   +D+ +W  +++G + +R ++ A   F +MPE  E +
Sbjct:   255 TIITGYAQSGKIDEARQLFDESPVQDVFTWTAMVSGYIQNRMVEEARELFDKMPERNEVS 314

Query:   241 WNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDV 300
             WN++++  ++   ++ A    +  P  N+++W  +I GY + G++  A  +F+ M  RD 
Sbjct:   315 WNAMLAGYVQGERMEMAKELFDVMPCRNVSTWNTMITGYAQCGKISEAKNLFDKMPKRDP 374

Query:   301 TVWNVMIFXXXXXXXXXXXXKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQ 360
               W  MI             + FVQM+  G   + ++F+S L+ C+D+  L+LG+Q+H +
Sbjct:   375 VSWAAMIAGYSQSGHSFEALRLFVQMEREGGRLNRSSFSSALSTCADVVALELGKQLHGR 434

Query:   361 AIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKA 420
              +K        V NA++ MY +CG+I+ A   F  +   DI+SWN++I G + HG+ E A
Sbjct:   435 LVKGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKDIVSWNTMIAGYSRHGFGEVA 494

Query:   421 LELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVD 480
             L  FE M+    KPDD T V VLSACS+ GLVD+GR YF  M   Y + P S HY C+VD
Sbjct:   495 LRFFESMKREGLKPDDATMVAVLSACSHTGLVDKGRQYFYTMTQDYGVMPNSQHYACMVD 554

Query:   481 LLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNN 540
             LLGR GL+++A NL+  +     E    +WG LLGA R+H N ++ E A +++  +EP N
Sbjct:   555 LLGRAGLLEDAHNLMKNMP---FEPDAAIWGTLLGASRVHGNTELAETAADKIFAMEPEN 611

Query:   541 SGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPK 599
             SG+Y++L+ +Y S GR  D  ++  +M++ GVKK PG SWI+I +  H F  GD  HP+
Sbjct:   612 SGMYVLLSNLYASSGRWGDVGKLRVRMRDKGVKKVPGYSWIEIQNKTHTFSVGDEFHPE 670


GO:0005739 "mitochondrion" evidence=ISM
TAIR|locus:2012295 AT1G09410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027554 AT1G56690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044797 AT2G35030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151501 AT5G46460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006163 AT1G32415 "AT1G32415" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055919 AT2G22070 "AT2G22070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018092 MEF9 "AT1G62260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131631 AT4G35130 "AT4G35130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query624
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-118
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-88
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-53
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-46
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 9e-28
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-17
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 0.001
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  372 bits (956), Expect = e-118
 Identities = 205/654 (31%), Positives = 325/654 (49%), Gaps = 75/654 (11%)

Query: 1   MRNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQM----PERDMFTY- 55
           +R   +  A  +F KMP+RD  +WNV++ GY K G+ D A+CL+++M       D++T+ 
Sbjct: 132 VRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFP 191

Query: 56  ----------------------------------NTVIAGLMQSDNVQGAKEVFDGMEVR 81
                                             N +I   ++  +V  A+ VFD M  R
Sbjct: 192 CVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRR 251

Query: 82  DVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMG 141
           D ++WN+MISGY  NG   E L +F  M  +  V  +L+    V      L +       
Sbjct: 252 DCISWNAMISGYFENGECLEGLELFFTM-RELSVDPDLMTITSVISACELLGDERL---- 306

Query: 142 ARDVASWTIMVNGLVREGRIVEARKLFDKMPAKDVQAWNLMIAGYLDNGCVGVAEDLFQK 201
            R++  + +              +  F    A DV   N +I  YL  G  G AE +F +
Sbjct: 307 GREMHGYVV--------------KTGF----AVDVSVCNSLIQMYLSLGSWGEAEKVFSR 348

Query: 202 MHDRDLTSWKQLINGLVNSRRIDAAISYFKQMPETC----EKTWNSIISVLIRNGLVK-- 255
           M  +D  SW  +I+G   +   D A+  +  M +      E T  S++S     G +   
Sbjct: 349 METKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVG 408

Query: 256 -EAHSYLEKYPY-SNIASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGEN 313
            + H   E+    S +     +I  Y +   +  A++VF  +  +DV  W  +I GL  N
Sbjct: 409 VKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLN 468

Query: 314 DLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVS 373
           +   E L FF QM  +   P++ T  + L+ C+ +  L  G++IHA  ++        + 
Sbjct: 469 NRCFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLP 527

Query: 374 NAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFK 433
           NA++ +Y RCG +  A  +F+S    D++SWN ++ G   HG    A+ELF RM  +   
Sbjct: 528 NALLDLYVRCGRMNYAWNQFNSHE-KDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVN 586

Query: 434 PDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMN 493
           PD++TF+ +L ACS +G+V QG  YF  M+ KY + P   HY CVVDLLGR G + EA N
Sbjct: 587 PDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYN 646

Query: 494 LLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLS 553
            +N++    I   P VWGALL ACRIH ++++GE+A + + EL+PN+ G Y++L  +Y  
Sbjct: 647 FINKMP---ITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYAD 703

Query: 554 CGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLL 607
            G+ ++  R+   M+ENG+  +PGCSW+++    H FL+ D SHP+   +  +L
Sbjct: 704 AGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVL 757


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 624
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.88
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG2076895 consensus RNA polymerase III transcription factor 99.77
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.75
KOG2003840 consensus TPR repeat-containing protein [General f 99.74
KOG2076895 consensus RNA polymerase III transcription factor 99.67
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.67
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.63
KOG2003840 consensus TPR repeat-containing protein [General f 99.63
KOG0547606 consensus Translocase of outer mitochondrial membr 99.62
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.6
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.59
KOG1915677 consensus Cell cycle control protein (crooked neck 99.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.57
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
KOG1915677 consensus Cell cycle control protein (crooked neck 99.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.52
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.51
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.5
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.5
KOG1126638 consensus DNA-binding cell division cycle control 99.49
KOG1126638 consensus DNA-binding cell division cycle control 99.49
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.47
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.46
KOG0547606 consensus Translocase of outer mitochondrial membr 99.41
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.41
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
KOG2376652 consensus Signal recognition particle, subunit Srp 99.39
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.37
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.36
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.34
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.32
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.29
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.27
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.26
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.25
KOG2376652 consensus Signal recognition particle, subunit Srp 99.23
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.22
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.21
KOG1129478 consensus TPR repeat-containing protein [General f 99.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.2
PRK12370553 invasion protein regulator; Provisional 99.19
PRK12370553 invasion protein regulator; Provisional 99.18
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.18
PF1304150 PPR_2: PPR repeat family 99.18
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.16
PF1304150 PPR_2: PPR repeat family 99.15
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.15
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.13
PRK11189296 lipoprotein NlpI; Provisional 99.13
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.13
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.12
KOG1129478 consensus TPR repeat-containing protein [General f 99.09
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.06
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.06
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.03
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.03
PRK11189296 lipoprotein NlpI; Provisional 99.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.98
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.97
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.96
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.96
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.95
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.95
KOG1125579 consensus TPR repeat-containing protein [General f 98.95
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.94
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.86
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.83
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.82
PRK10370198 formate-dependent nitrite reductase complex subuni 98.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.8
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.8
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.8
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.74
PRK15359144 type III secretion system chaperone protein SscB; 98.69
PRK15359144 type III secretion system chaperone protein SscB; 98.69
PRK04841903 transcriptional regulator MalT; Provisional 98.68
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.59
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.58
PRK10370198 formate-dependent nitrite reductase complex subuni 98.53
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.53
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.52
KOG1125579 consensus TPR repeat-containing protein [General f 98.52
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.5
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.49
PRK04841903 transcriptional regulator MalT; Provisional 98.49
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.43
KOG1128777 consensus Uncharacterized conserved protein, conta 98.42
PF1285434 PPR_1: PPR repeat 98.41
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.41
PLN02789320 farnesyltranstransferase 98.4
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.4
PLN02789320 farnesyltranstransferase 98.4
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.36
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.34
PF1285434 PPR_1: PPR repeat 98.34
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.32
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.31
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.3
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.23
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.22
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.22
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.18
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.17
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.14
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.13
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.09
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.08
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.07
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.04
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.04
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.03
KOG0553304 consensus TPR repeat-containing protein [General f 98.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.01
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.97
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.93
KOG20411189 consensus WD40 repeat protein [General function pr 97.92
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.89
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.89
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.88
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.87
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.84
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.83
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.83
KOG0553304 consensus TPR repeat-containing protein [General f 97.81
COG4700251 Uncharacterized protein conserved in bacteria cont 97.8
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.78
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.77
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.75
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.74
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.72
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.7
PF12688120 TPR_5: Tetratrico peptide repeat 97.7
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.65
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.63
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.61
PF1337173 TPR_9: Tetratricopeptide repeat 97.59
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.58
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.58
COG3898531 Uncharacterized membrane-bound protein [Function u 97.58
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.54
PRK15331165 chaperone protein SicA; Provisional 97.54
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.54
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.54
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.45
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.42
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.42
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.42
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.41
KOG20411189 consensus WD40 repeat protein [General function pr 97.37
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.37
COG3898531 Uncharacterized membrane-bound protein [Function u 97.35
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.35
COG4700251 Uncharacterized protein conserved in bacteria cont 97.31
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.27
PRK10803263 tol-pal system protein YbgF; Provisional 97.26
PF1343134 TPR_17: Tetratricopeptide repeat 97.26
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.25
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.25
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.2
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.17
PF12688120 TPR_5: Tetratrico peptide repeat 97.15
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.14
PF1337173 TPR_9: Tetratricopeptide repeat 97.13
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.07
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.95
PF1342844 TPR_14: Tetratricopeptide repeat 96.93
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.93
PRK11619 644 lytic murein transglycosylase; Provisional 96.92
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.92
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.88
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.84
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.8
PRK10803263 tol-pal system protein YbgF; Provisional 96.76
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.74
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.72
PRK11906458 transcriptional regulator; Provisional 96.71
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.7
KOG1258577 consensus mRNA processing protein [RNA processing 96.69
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.66
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.64
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.63
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.6
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.56
PRK09687280 putative lyase; Provisional 96.35
PRK11906458 transcriptional regulator; Provisional 96.32
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.3
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.21
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.19
KOG1585308 consensus Protein required for fusion of vesicles 96.11
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.08
PRK09687280 putative lyase; Provisional 96.03
PRK15331165 chaperone protein SicA; Provisional 96.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.97
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.96
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.92
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.9
PF13512142 TPR_18: Tetratricopeptide repeat 95.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.83
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.83
KOG4555175 consensus TPR repeat-containing protein [Function 95.79
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.79
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.76
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.59
PF13512142 TPR_18: Tetratricopeptide repeat 95.56
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.55
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.54
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.47
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.43
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.41
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.29
KOG1258577 consensus mRNA processing protein [RNA processing 95.08
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.08
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.0
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.89
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.89
KOG4234271 consensus TPR repeat-containing protein [General f 94.83
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.77
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.74
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.72
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 94.57
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.56
KOG4555175 consensus TPR repeat-containing protein [Function 94.54
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.47
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.4
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.18
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.1
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.02
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.02
PRK11619644 lytic murein transglycosylase; Provisional 94.0
smart00299140 CLH Clathrin heavy chain repeat homology. 93.86
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 93.83
smart00299140 CLH Clathrin heavy chain repeat homology. 93.81
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.64
KOG1585308 consensus Protein required for fusion of vesicles 93.48
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.47
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.45
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.32
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.02
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.85
PF1342844 TPR_14: Tetratricopeptide repeat 92.81
COG3629280 DnrI DNA-binding transcriptional activator of the 92.73
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.69
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 92.6
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.57
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 92.42
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.34
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 92.07
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 92.02
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.87
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 91.81
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.75
COG3629280 DnrI DNA-binding transcriptional activator of the 91.7
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.36
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.35
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.98
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.93
KOG3941406 consensus Intermediate in Toll signal transduction 90.87
KOG4234271 consensus TPR repeat-containing protein [General f 90.85
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.82
KOG3941 406 consensus Intermediate in Toll signal transduction 90.79
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 90.53
TIGR02270410 conserved hypothetical protein. Members are found 90.48
KOG4648 536 consensus Uncharacterized conserved protein, conta 90.45
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.28
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.21
PF1343134 TPR_17: Tetratricopeptide repeat 90.18
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.05
TIGR02270410 conserved hypothetical protein. Members are found 89.85
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.4
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.3
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.17
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.53
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.48
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.46
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 88.44
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.16
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 87.82
KOG1941 518 consensus Acetylcholine receptor-associated protei 87.79
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.16
COG2976207 Uncharacterized protein conserved in bacteria [Fun 87.16
PRK10941269 hypothetical protein; Provisional 86.83
KOG1550552 consensus Extracellular protein SEL-1 and related 86.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.66
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.02
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.99
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.6
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 85.48
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.29
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.26
KOG1586288 consensus Protein required for fusion of vesicles 84.84
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.73
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.56
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.05
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 83.95
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.73
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.7
KOG4570418 consensus Uncharacterized conserved protein [Funct 83.17
KOG2300629 consensus Uncharacterized conserved protein [Funct 83.1
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 83.08
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.06
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 82.38
COG4455273 ImpE Protein of avirulence locus involved in tempe 82.27
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.22
COG3947361 Response regulator containing CheY-like receiver a 81.87
PRK12798421 chemotaxis protein; Reviewed 81.8
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 80.75
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.51
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.36
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 80.29
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.9e-88  Score=735.35  Aligned_cols=612  Identities=33%  Similarity=0.581  Sum_probs=593.3

Q ss_pred             CCCChhHHHHHHhhCCCCCcchHHHHHHHHHhcCChHHHHHHHhhCC----CCCcchHHHHHHHHHcCCChhhHHHHHhc
Q 006955            2 RNARIQEAQNLFDKMPQRDTVTWNVMIRGYFKNGFLDNAMCLFNQMP----ERDMFTYNTVIAGLMQSDNVQGAKEVFDG   77 (624)
Q Consensus         2 ~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~----~~~~~~~~~l~~~~~~~~~~~~A~~~~~~   77 (624)
                      |.|+++.|.++|++|++||..+|+.++.+|++.|++++|+.+|++|.    .||..+|+.++.+|++.+++..+.+++..
T Consensus       133 ~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~  212 (857)
T PLN03077        133 RFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAH  212 (857)
T ss_pred             hCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHH
Confidence            68999999999999999999999999999999999999999999996    69999999999999999999999998888


Q ss_pred             CC----CCCchhHHHHHHHHHhCCChhHHHHHhccCCCCCcccHHHHHHHHHcCCChHHHHHHHHhccc----CChhHHH
Q 006955           78 ME----VRDVVTWNSMISGYVCNGLIDEALRVFHGMPLKDVVSWNLVIGALVNCQRMDLAESYFKEMGA----RDVASWT  149 (624)
Q Consensus        78 ~~----~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~----~~~~~~~  149 (624)
                      |.    .||..+|++|+.+|++.|+++.|.++|++|.+||+.+|+.++.+|++.|++++|.++|++|.+    ||..+|+
T Consensus       213 ~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~  292 (857)
T PLN03077        213 VVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTIT  292 (857)
T ss_pred             HHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHH
Confidence            76    789999999999999999999999999999999999999999999999999999999999974    8999999


Q ss_pred             HHHHHHHhCCChHHHHHHhccCC----CCChhHHHHHHHHHHHcCChhHHHHHHHHcccCCcccHHHHHHHHHcCCCHHH
Q 006955          150 IMVNGLVREGRIVEARKLFDKMP----AKDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTSWKQLINGLVNSRRIDA  225 (624)
Q Consensus       150 ~l~~~~~~~g~~~~a~~~~~~~~----~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  225 (624)
                      .++.+|++.|+.+.|.+++..+.    .+|..+|+.|+.+|++.|++++|.++|++|..+|..+|+.++.+|.+.|++++
T Consensus       293 ~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~  372 (857)
T PLN03077        293 SVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDK  372 (857)
T ss_pred             HHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHH
Confidence            99999999999999999999887    57999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhCCC----CCcchHHHHHHHHHhcCChHHHHHHHhhcC----CCCcchhhHHHHHHHhcCChHHHHHHHhhcCC
Q 006955          226 AISYFKQMPE----TCEKTWNSIISVLIRNGLVKEAHSYLEKYP----YSNIASWTNVIVGYFEMGEVGSAIKVFELMTT  297 (624)
Q Consensus       226 A~~~~~~~~~----~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~----~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  297 (624)
                      |+++|++|.+    ||..||+.++.+|++.|+++.+.++++.+.    .++..++++|+++|+++|++++|.++|++|.+
T Consensus       373 A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~  452 (857)
T PLN03077        373 ALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPE  452 (857)
T ss_pred             HHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCC
Confidence            9999999964    999999999999999999999999999988    77888999999999999999999999999999


Q ss_pred             CCceehhhhhhHhhcCCCchHHHHHHHHhHHcCCCCCHHHHHHHHHHHcCCCCcHHHHHHHHHHHHhCCCCCcchhHHHH
Q 006955          298 RDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMI  377 (624)
Q Consensus       298 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~  377 (624)
                      +|+.+|+.+|.+|++.|+.++|+.+|++|.. +++||..||+.++.+|++.|+++.+.+++..+.+.|+.++..++++|+
T Consensus       453 ~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi  531 (857)
T PLN03077        453 KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALL  531 (857)
T ss_pred             CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHH
Confidence            9999999999999999999999999999986 599999999999999999999999999999999999999999999999


Q ss_pred             HHhHhhCCHHHHHHHhccCCCCCchhHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCChhhHHHHHHHhcccChHHHHHH
Q 006955          378 TMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSACSYAGLVDQGRY  457 (624)
Q Consensus       378 ~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~  457 (624)
                      ++|+++|++++|.++|+.+ .+|..+||++|.+|+++|+.++|+++|++|.+.|+.||..||+.++.+|.+.|++++|.+
T Consensus       532 ~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~  610 (857)
T PLN03077        532 DLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLE  610 (857)
T ss_pred             HHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHH
Confidence            9999999999999999999 899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhhcCCCCCcchHHHHHHHhhccCChHHHHHHHHHcccCCCCcCHHHHHHHHHHHHhcCChHHHHHHHHHHHccC
Q 006955          458 YFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVSPTVWGALLGACRIHNNIKVGEIAGERVMELE  537 (624)
Q Consensus       458 ~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~  537 (624)
                      +|+.|.+.+|+.|+..+|+.++++|++.|++++|.+++++|.   ++||..+|++|+.+|..+|+.+.++...+++.++.
T Consensus       611 ~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~---~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~  687 (857)
T PLN03077        611 YFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMP---ITPDPAVWGALLNACRIHRHVELGELAAQHIFELD  687 (857)
T ss_pred             HHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCC---CCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhC
Confidence            999999778999999999999999999999999999999997   79999999999999999999999999999999999


Q ss_pred             CCCCchHHHHHHHHHhcCChHHHHHHHHHHHHCCCccCCceeEEEEcCeEEEEeeCCCCCcchHHHHHHHHHHHHHHHHh
Q 006955          538 PNNSGVYLILTEMYLSCGRREDAKRIFAQMKENGVKKEPGCSWIQINDGGHVFLSGDSSHPKFHRLRYLLNLLHTEIERE  617 (624)
Q Consensus       538 p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  617 (624)
                      |+++..|..|+++|...|+|++|.++.+.|++.|++++||+|||++++.+|.|.++|.+||+..+||..+.++..+++..
T Consensus       688 p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~  767 (857)
T PLN03077        688 PNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKAS  767 (857)
T ss_pred             CCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999875


Q ss_pred             h
Q 006955          618 I  618 (624)
Q Consensus       618 ~  618 (624)
                      +
T Consensus       768 g  768 (857)
T PLN03077        768 G  768 (857)
T ss_pred             C
Confidence            4



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query624
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 66.4 bits (161), Expect = 2e-11
 Identities = 80/598 (13%), Positives = 165/598 (27%), Gaps = 182/598 (30%)

Query: 5   RIQEAQNLFDKMPQRDTVTWNVMIRGYFKN--GFLDNAMCLFNQMPERDMFTYNTVIAGL 62
            +     LF  +  +        +    +    FL + +    + P      Y       
Sbjct: 60  AVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIE----- 114

Query: 63  MQSDNVQGAKEVFDGMEV-RDVVTWNSMISGYVCNGLIDEALR--------VFHGMP--- 110
            Q D +    +VF    V R                 + +AL         +  G+    
Sbjct: 115 -QRDRLYNDNQVFAKYNVSRLQPYLK-----------LRQALLELRPAKNVLIDGVLGSG 162

Query: 111 --------LKDV---------VSWNLVIGALVNCQRMDLAESYFKEMGARDVASWTIMVN 153
                                + W L +    NC   +      +++  +   +WT   +
Sbjct: 163 KTWVALDVCLSYKVQCKMDFKIFW-LNLK---NCNSPETVLEMLQKLLYQIDPNWTSRSD 218

Query: 154 GLVREGRIVEA-----RKLFDKMPAK-------DVQAWNLMIAGYLDNGCVGVAEDLFQK 201
                   + +     R+L    P +       +V   N       +  C          
Sbjct: 219 HSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNV--QNAKAWNAFNLSC---------- 266

Query: 202 MHDRDL--TSWKQLINGLVNSRRI-------------DAAISYF--------KQMPETCE 238
              + L  T +KQ+ + L  +                D   S          + +P    
Sbjct: 267 ---KILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323

Query: 239 KTWN----SIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVI---VGYFEMGEVGS---A 288
            T N    SII+  IR+GL     +  + + + N    T +I   +   E  E       
Sbjct: 324 TT-NPRRLSIIAESIRDGL-----ATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDR 377

Query: 289 IKVFELMTTRDV--------TVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTS 340
           + VF                 +W  +I       + +      V+ +     P  +T + 
Sbjct: 378 LSVFP----PSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQ-----PKESTIS- 427

Query: 341 VLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIH- 399
                  +P++ L        +K+       +  +++  Y    NI         +P + 
Sbjct: 428 -------IPSIYL-------ELKVKLENEYALHRSIVDHY----NIPKTFDSDDLIPPYL 469

Query: 400 DIISWNSIICGLAYHGYAEKALELFERMR--LTDFKPDDITFVGV------LSACSYAGL 451
           D          + +H    +  E     R    DF+     F+         +  +   +
Sbjct: 470 D----QYFYSHIGHHLKNIEHPERMTLFRMVFLDFR-----FLEQKIRHDSTAWNASGSI 520

Query: 452 VD---QGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEVS 506
           ++   Q ++Y      K ++      Y  +V+ +  F L     NL+     D + ++
Sbjct: 521 LNTLQQLKFY------KPYICDNDPKYERLVNAILDF-LPKIEENLICSKYTDLLRIA 571


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query624
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.83
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.59
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.59
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.59
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.55
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.54
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.47
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.46
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.46
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.46
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.46
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.37
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.26
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.25
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.25
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.21
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.16
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.14
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.13
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.1
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.09
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.08
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.07
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.01
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.0
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.99
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.98
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.98
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.97
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.96
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.96
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.95
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.91
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.88
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.88
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.87
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.86
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.86
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.83
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.81
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.81
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.79
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.75
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.75
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.75
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.72
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.7
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.67
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.66
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.66
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.65
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.64
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.56
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.55
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.55
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.53
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.52
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.5
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.48
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.48
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.47
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.45
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.44
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.43
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.43
3k9i_A117 BH0479 protein; putative protein binding protein, 98.38
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.37
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.37
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.36
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.36
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.33
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.3
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.28
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.26
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.26
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.25
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.23
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.22
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.21
3k9i_A117 BH0479 protein; putative protein binding protein, 98.2
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.15
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.13
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.12
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.11
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.1
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.04
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.03
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.01
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.0
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 98.0
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.99
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.96
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.96
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.94
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.92
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.87
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.86
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.75
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.73
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.71
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.66
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.64
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.61
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.51
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.48
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.33
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 97.3
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.3
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.3
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.2
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.19
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.05
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.99
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.81
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.64
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.41
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.34
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.28
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.23
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.22
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.2
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.19
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.08
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.95
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.95
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.84
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.8
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.74
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.64
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.34
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.53
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.17
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 94.09
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.48
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.65
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.98
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 91.87
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 91.87
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.28
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.88
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 90.58
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.45
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.73
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.37
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.68
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 88.55
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.24
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 85.38
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 84.99
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.96
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.63
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 84.13
2uwj_G115 Type III export protein PSCG; virulence, chaperone 83.76
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 83.72
2p58_C116 Putative type III secretion protein YSCG; type III 82.99
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.07
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 80.05
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.8e-39  Score=344.59  Aligned_cols=473  Identities=10%  Similarity=0.007  Sum_probs=269.3

Q ss_pred             HHcCCChhhHHHHHhcCCCCCchhHHHHHHHHHhCCChhHHHHHhccCCC--CCcccHHHHHHHHHcCCChHHHHHHHHh
Q 006955           62 LMQSDNVQGAKEVFDGMEVRDVVTWNSMISGYVCNGLIDEALRVFHGMPL--KDVVSWNLVIGALVNCQRMDLAESYFKE  139 (624)
Q Consensus        62 ~~~~~~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~a~~~~~~  139 (624)
                      +...|.+..+...+..+..++...|+.++..+.+.|++++|+.+|+++..  |+..++..++.+|.+.|++++|..++++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~  142 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTK  142 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHH
Confidence            44566677777777777778888999999999999999999999998874  8888888899999999999999999998


Q ss_pred             cc--cCChhHHHHHHHHHHhCCChHHHHHHhccCCCC-------------------ChhHHHHHHHHHHHcCChhHHHHH
Q 006955          140 MG--ARDVASWTIMVNGLVREGRIVEARKLFDKMPAK-------------------DVQAWNLMIAGYLDNGCVGVAEDL  198 (624)
Q Consensus       140 ~~--~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~-------------------~~~~~~~l~~~~~~~g~~~~A~~~  198 (624)
                      +.  .+++.+++.++.+|.+.|++++|.++|+++...                   +..+|+.++.+|.+.|++++|.++
T Consensus       143 ~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~  222 (597)
T 2xpi_A          143 EDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKEC  222 (597)
T ss_dssp             TCGGGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             HhccccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHH
Confidence            84  468889999999999999999999999965543                   367888888888888888888888


Q ss_pred             HHHcccCCcc---cHHHHHHHHHcCCCHHHHHHH---hhhCCCC----CcchHHHHHHHHHhcCChHHHHHHHhhcCC--
Q 006955          199 FQKMHDRDLT---SWKQLINGLVNSRRIDAAISY---FKQMPET----CEKTWNSIISVLIRNGLVKEAHSYLEKYPY--  266 (624)
Q Consensus       199 ~~~~~~~~~~---~~~~l~~~~~~~~~~~~A~~~---~~~~~~~----~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~--  266 (624)
                      |+++.+.++.   .+..+...+...+..+.+...   +..+...    ...+|..++..|.+.|++++|..+|+++..  
T Consensus       223 ~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~  302 (597)
T 2xpi_A          223 YKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLE  302 (597)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGG
T ss_pred             HHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCC
Confidence            8888764433   333343333322222211110   1111111    111233334444455555555555555542  


Q ss_pred             CCcchhhHHHHHHHhcCChHHHHHHHhhcCC---CCceehhhhhhHhhcCCCchHHHHHHHHhHHcCCCCCHHHHHHHHH
Q 006955          267 SNIASWTNVIVGYFEMGEVGSAIKVFELMTT---RDVTVWNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLT  343 (624)
Q Consensus       267 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~  343 (624)
                      ++..+++.++.+|.+.|++++|..+|+++..   .+..+|+.++.++...|++++|..+++++.+.. +.+..++..+..
T Consensus       303 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~  381 (597)
T 2xpi_A          303 KSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGI  381 (597)
T ss_dssp             GCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHH
Confidence            4444555555555555555555555554431   234445555555555555555555555554321 223444444444


Q ss_pred             HHcCCCCcHHHHHHHHHHHHhCCCCCcchhHHHHHHhHhhCCHHHHHHHhccCCCCCchhHHHHHHHHHHcCChHHHHHH
Q 006955          344 ICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQSALLEFSSVPIHDIISWNSIICGLAYHGYAEKALEL  423 (624)
Q Consensus       344 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~  423 (624)
                      .+.+.|++++|..+|+.+.+..                                +.+..+|+.++.+|.+.|++++|+++
T Consensus       382 ~~~~~g~~~~A~~~~~~~~~~~--------------------------------~~~~~~~~~l~~~~~~~g~~~~A~~~  429 (597)
T 2xpi_A          382 YYLCVNKISEARRYFSKSSTMD--------------------------------PQFGPAWIGFAHSFAIEGEHDQAISA  429 (597)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHC--------------------------------TTCHHHHHHHHHHHHHHTCHHHHHHH
T ss_pred             HHHHhccHHHHHHHHHHHHHhC--------------------------------CCCHHHHHHHHHHHHHcCCHHHHHHH
Confidence            4444444444444444444321                                22344555555555555555555555


Q ss_pred             HHHHHHCCCCCChhhHHHHHHHhcccChHHHHHHHHHHhhhhcCCCCCcchHHHHHHHhhccCChHHHHHHHHHcccC--
Q 006955          424 FERMRLTDFKPDDITFVGVLSACSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRAD--  501 (624)
Q Consensus       424 ~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--  501 (624)
                      |+++.+.+ +++..++..++.+|.+.|++++|.++|+++.+..  +.++.+|+.++..|.+.|++++|.++|+++.+.  
T Consensus       430 ~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~  506 (597)
T 2xpi_A          430 YTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF--QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVK  506 (597)
T ss_dssp             HHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhh
Confidence            55555531 2244555555555555555555555555555421  124555555555555556666655555555443  


Q ss_pred             --CCCcC--HHHHHHHHHHHHhcCChHHHHHHHHHHHccCCCCCchHHHHHHHHHhcCChHHHHHHHHHHHHC
Q 006955          502 --GIEVS--PTVWGALLGACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMYLSCGRREDAKRIFAQMKEN  570 (624)
Q Consensus       502 --g~~p~--~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~  570 (624)
                        +..|+  ..+|..++.+|...|++++|...++++.+..|.++.+|..++.+|...|++++|.+.++++.+.
T Consensus       507 ~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~  579 (597)
T 2xpi_A          507 KTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAI  579 (597)
T ss_dssp             HSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             ccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc
Confidence              33444  4555555555555566666666666555555555555556666666666666666655555543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 624
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.6 bits (109), Expect = 5e-06
 Identities = 36/409 (8%), Positives = 103/409 (25%), Gaps = 42/409 (10%)

Query: 153 NGLVREGRIVEARKLFDKMPAKD---VQAWNLMIAGYLDNGCVGVAEDLFQKMHDRDLTS 209
           +   + G    A +   ++  ++        L+ + +     +  +         ++   
Sbjct: 7   HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL 66

Query: 210 WKQLINGLVNSRRIDAAISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNI 269
            +   N             Y ++               L  + +    +         ++
Sbjct: 67  AEAYSN---------LGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDM 117

Query: 270 ASWTNVIVGYFEMGEVGSAIKVFELMTTRDVTVWNVMIFGLGENDLGEEGLKFFVQMKES 329
                  V   +       ++       + +                         +K  
Sbjct: 118 EGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAK---------------ACYLKAI 162

Query: 330 GPSPDNATFTSVLTIC-SDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYARCGNIQS 388
              P+ A   S L    +    + L      +A+ +  N      N +  +         
Sbjct: 163 ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYIN-LGNVLKEARIFDR 221

Query: 389 ALLEF---SSVPIHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPDDITFVGVLSA 445
           A+  +    S+  +  +   ++ C     G  + A++ +   R  + +P        L A
Sbjct: 222 AVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYR--RAIELQPHFPDAYCNL-A 278

Query: 446 CSYAGLVDQGRYYFDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEV 505
            +                        +     + ++    G I+EA+ L  +     +EV
Sbjct: 279 NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKA----LEV 334

Query: 506 SPTVWGALLG---ACRIHNNIKVGEIAGERVMELEPNNSGVYLILTEMY 551
            P    A        +    ++   +  +  + + P  +  Y  +    
Sbjct: 335 FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTL 383


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query624
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.09
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.95
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.95
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.7
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.61
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.55
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.52
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.52
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.46
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.46
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.19
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.12
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.12
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.11
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.07
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.01
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.01
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.0
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.97
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.97
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.76
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.67
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.66
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.55
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.54
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.51
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.24
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.16
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.05
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.41
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.18
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.13
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.9
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 91.51
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.29
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.57
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 82.83
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=4.3e-21  Score=188.78  Aligned_cols=369  Identities=10%  Similarity=0.102  Sum_probs=248.8

Q ss_pred             HHHHHhCCChHHHHHHhccCCC---CChhHHHHHHHHHHHcCChhHHHHHHHHcccC---CcccHHHHHHHHHcCCCHHH
Q 006955          152 VNGLVREGRIVEARKLFDKMPA---KDVQAWNLMIAGYLDNGCVGVAEDLFQKMHDR---DLTSWKQLINGLVNSRRIDA  225 (624)
Q Consensus       152 ~~~~~~~g~~~~a~~~~~~~~~---~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~---~~~~~~~l~~~~~~~~~~~~  225 (624)
                      ...+.+.|++++|++.++++.+   .++.++..+...|.+.|++++|+..|+++.+.   +..++..+..+|...|++++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhccccc
Confidence            4455566666666666666542   24556666666666666666666666666542   22345555555555555555


Q ss_pred             HHHHhhhCCCCCcchHHHHHHHHHhcCChHHHHHHHhhcCCCCcchhhHHHHHHHhcCChHHHHHHHhhc---CCCCcee
Q 006955          226 AISYFKQMPETCEKTWNSIISVLIRNGLVKEAHSYLEKYPYSNIASWTNVIVGYFEMGEVGSAIKVFELM---TTRDVTV  302 (624)
Q Consensus       226 A~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~---~~~~~~~  302 (624)
                      |++.+....+.+                            +.+..............+....+.......   .......
T Consensus        86 A~~~~~~~~~~~----------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  137 (388)
T d1w3ba_          86 AIEHYRHALRLK----------------------------PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCV  137 (388)
T ss_dssp             HHHHHHHHHHHC----------------------------TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHH
T ss_pred             cccccccccccc----------------------------cccccccccccccccccccccccccccccccccccccccc
Confidence            555555544311                            111111222222222222222222222211   1122233


Q ss_pred             hhhhhhHhhcCCCchHHHHHHHHhHHcCCCCCHHHHHHHHHHHcCCCCcHHHHHHHHHHHHhCCCCCcchhHHHHHHhHh
Q 006955          303 WNVMIFGLGENDLGEEGLKFFVQMKESGPSPDNATFTSVLTICSDLPTLDLGRQIHAQAIKIARNQFTTVSNAMITMYAR  382 (624)
Q Consensus       303 ~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~  382 (624)
                      ...........+....+...+.+..... +-+...+..+...+...|+.+.|...+....+.. +.+...+..+...+..
T Consensus       138 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~  215 (388)
T d1w3ba_         138 RSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKE  215 (388)
T ss_dssp             HHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHT
T ss_pred             cccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhc
Confidence            3334444455556666666666555442 2334555566666777777777777777766653 3344566667777888


Q ss_pred             hCCHHHHHHHhccCC---CCCchhHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCC-hhhHHHHHHHhcccChHHHHHHH
Q 006955          383 CGNIQSALLEFSSVP---IHDIISWNSIICGLAYHGYAEKALELFERMRLTDFKPD-DITFVGVLSACSYAGLVDQGRYY  458 (624)
Q Consensus       383 ~g~~~~A~~~~~~~~---~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~g~~p~-~~~~~~ll~~~~~~g~~~~a~~~  458 (624)
                      .|++++|+..+++..   +.+...+..+...+...|++++|+..|++..+  +.|+ ..++..+...+...|++++|.+.
T Consensus       216 ~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~  293 (388)
T d1w3ba_         216 ARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSVAEAEDC  293 (388)
T ss_dssp             TTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSCHHHHHHH
T ss_pred             cccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHH
Confidence            888888888777655   44566788888899999999999999999988  4555 46788888899999999999999


Q ss_pred             HHHhhhhcCCCCCcchHHHHHHHhhccCChHHHHHHHHHcccCCCCc-CHHHHHHHHHHHHhcCChHHHHHHHHHHHccC
Q 006955          459 FDCMKNKYFLQPRSAHYTCVVDLLGRFGLIDEAMNLLNEIRADGIEV-SPTVWGALLGACRIHNNIKVGEIAGERVMELE  537 (624)
Q Consensus       459 ~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p-~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~  537 (624)
                      ++.....  .+.+...+..+...+...|++++|++.+++..+  +.| ++.++..+..++...|++++|...++++++++
T Consensus       294 ~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~  369 (388)
T d1w3ba_         294 YNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALE--VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRIS  369 (388)
T ss_dssp             HHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTT--SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTC
T ss_pred             HHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC
Confidence            9998874  334778888999999999999999999999887  455 57788899999999999999999999999999


Q ss_pred             CCCCchHHHHHHHHHhcCC
Q 006955          538 PNNSGVYLILTEMYLSCGR  556 (624)
Q Consensus       538 p~~~~~~~~l~~~~~~~g~  556 (624)
                      |.++.++..|+.+|.+.||
T Consensus       370 P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         370 PTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TTCHHHHHHHHHHHHHTCC
T ss_pred             CCCHHHHHHHHHHHHHcCC
Confidence            9999999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure