Citrus Sinensis ID: 006969

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---
MAATTAAAAFFTNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQLPAKDSVERTSVSA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHcccccccccccccEEEEccccHHcHHHHHHHHHHcccccEEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEcccccHHccccHHHHHHHHEEEcccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccEEEEEEEEEEEcccccEEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEEEEEccccccEEEEEEEEEEEcccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccccccHHHHcccccccccccccHHcccccHcccHHcccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHccccccccccccEHHHHHHHcHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEcHcccccccHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccEEEcccHHHHcccccccccEccccEEEEEcHHHcccEcccccEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccEEEEEEEEEEEccccccEEEEEEEcccccEEEEcccccccHHHHHHHHHHHHccccEEEEEEEEEEccccccEEEEEEEEEEcccEEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MAATTAAAAFftnrqptfissspktkanASQLffhcnnskpffkttiscslqkpppslypritatrpeyipnripdpnyvrVFDTTlrdgeqspgatltskEKLDIARQLAKLGVDIIeagfpaaskedFEAVRTIAKEVGnavdaesgyvpvicglsrcneRDIKTAWEAVKYakrprihtfiatsgihmehKLRKTKQQVVEIARSMVKFARslgcddvefspedagrsdRKFLYEILGEVIKVGattlnipdtvgitmptEFGKLIADIkantpgieNVVISTHcqndlglstANTIAGACAGARQVEVTINGigeragnaSLEEVVMAFKCRgehilgglytgiNTRHIVMASKMVEEytglhvqphkaivganafahesgihqdgmlkhkgtyeiispediglersseaGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDangeehvacstgtgpvdsayKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEksqlsthastgetvqrtfsgtgagMDIVVSSVKAYIGALNKMlgfkdqlpakdsvertsvsa
MAATTAAaafftnrqptfisssPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATrpeyipnripdpNYVRVFDTTLrdgeqspgatltskeklDIARQLAKLGVDIIEAGfpaaskedfEAVRTIAKEvgnavdaesgyvPVICGLSRCNERDIKTAWEavkyakrprIHTFiatsgihmehklRKTKQQVVEIARSMVKFarslgcddvefspedagrsdRKFLYEILGEVIkvgattlnipdtvgITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACStgtgpvdsAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKsqlsthastgetvqrtfsgtgaGMDIVVSSVKAYIGALNKMlgfkdqlpakdsvertsvsa
MaattaaaafftNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQLPAKDSVERTSVSA
******************************QLFFHCNNSKPFFKTTISCSLQ****SLYPRITATRPEYIPNRIPDPNYVRVFDTTL****************LDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFS*******DRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRG****************RTFSGTGAGMDIVVSSVKAYIGALNKMLGFK****************
****************************************************************************PNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNK*********************
MAATTAAAAFFTNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHME*********VVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEK************VQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQLPA***********
*****************************************************************RPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQLPA***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATTAAAAFFTNRQPTFISSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQLPAKDSVERTSVSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query623 2.2.26 [Sep-21-2011]
Q9C550631 2-isopropylmalate synthas yes no 0.903 0.892 0.827 0.0
Q9LPR4631 2-isopropylmalate synthas no no 0.974 0.961 0.793 0.0
O04973589 2-isopropylmalate synthas N/A no 0.897 0.949 0.737 0.0
O04974612 2-isopropylmalate synthas N/A no 0.956 0.973 0.712 0.0
Q39891565 Probable 2-isopropylmalat no no 0.890 0.982 0.683 0.0
Q9FG67506 Methylthioalkylmalate syn no no 0.696 0.857 0.632 1e-167
Q9FN52503 Methylthioalkylmalate syn no no 0.711 0.880 0.603 1e-165
Q8VX04506 Methylthioalkylmalate syn no no 0.691 0.851 0.624 1e-164
B7JYP4536 2-isopropylmalate synthas yes no 0.817 0.949 0.532 1e-155
B7KJX8536 2-isopropylmalate synthas yes no 0.837 0.973 0.532 1e-154
>sp|Q9C550|LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=IPMS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/567 (82%), Positives = 526/567 (92%), Gaps = 4/567 (0%)

Query: 43  FKTTISCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKE 102
           F+ + S S   P P   PR    RP YIPNRI DPNYVR+FDTTLRDGEQSPGATLTSKE
Sbjct: 53  FRVSYSLSASSPLPPHAPR---RRPNYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKE 109

Query: 103 KLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNE 162
           KLDIARQLAKLGVDIIEAGFPAASK+DFEAV+TIA+ VGN VD E+GYVPVICGLSRCN+
Sbjct: 110 KLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAETVGNTVD-ENGYVPVICGLSRCNK 168

Query: 163 RDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVE 222
           +DI+TAWEAVKYAKRPRIHTFIATS IH+++KL+K+K++V+EIAR+MV+FARSLGC+DVE
Sbjct: 169 KDIETAWEAVKYAKRPRIHTFIATSDIHLKYKLKKSKEEVIEIARNMVRFARSLGCEDVE 228

Query: 223 FSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENV 282
           FSPEDAGRS+R++LYEILGEVIK GATTLNIPDTVGIT+P+EFG+LIADIKANTPGI+NV
Sbjct: 229 FSPEDAGRSEREYLYEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNV 288

Query: 283 VISTHCQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILG 342
           +ISTHCQNDLGLSTANT++GA +GARQVEVTINGIGERAGNASLEEVVMA KCRG+H+LG
Sbjct: 289 IISTHCQNDLGLSTANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLG 348

Query: 343 GLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIIS 402
           GL+TGI+TRHIVM SKMVEEYTG+  QPHKAIVGANAFAHESGIHQDGMLKHKGTYEI+S
Sbjct: 349 GLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMS 408

Query: 403 PEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTD 462
           PE+IGLERS++AGIVLGKLSGRHALKDRL ELGY L+D QL  +FW FKAVAEQKKRVTD
Sbjct: 409 PEEIGLERSNDAGIVLGKLSGRHALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTD 468

Query: 463 ADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSA 522
           ADLIALVSDE+FQPE VWKLLDMQ+TCGTLGLST+TVKL D++G+EHVACS GTGPVD+A
Sbjct: 469 ADLIALVSDEVFQPEAVWKLLDMQITCGTLGLSTSTVKLADSDGKEHVACSVGTGPVDAA 528

Query: 523 YKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGT 582
           YKAVDLIVKEPATLLEYSMNAVT GIDAIATTRVLIRG+ +  ST+A TGE+V+RTFSGT
Sbjct: 529 YKAVDLIVKEPATLLEYSMNAVTEGIDAIATTRVLIRGDNNYSSTNAVTGESVERTFSGT 588

Query: 583 GAGMDIVVSSVKAYIGALNKMLGFKDQ 609
           GAGMDIVVSSVKAY+GALNKMLGFK+ 
Sbjct: 589 GAGMDIVVSSVKAYVGALNKMLGFKEH 615
Catalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3-hydroxy-4-methylpentanoate (2-isopropylmalate). Involved in Leu biosynthesis, but do not participate in the chain elongation of glucosinolates.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 3EC: .EC: 1EC: 3
>sp|Q9LPR4|LEU11_ARATH 2-isopropylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=IPMS1 PE=1 SV=2 Back     alignment and function description
>sp|O04973|LEU1A_SOLPN 2-isopropylmalate synthase A OS=Solanum pennellii GN=IPMSA PE=2 SV=1 Back     alignment and function description
>sp|O04974|LEU1B_SOLPN 2-isopropylmalate synthase B OS=Solanum pennellii GN=IPMSB PE=2 SV=1 Back     alignment and function description
>sp|Q39891|LEU1_SOYBN Probable 2-isopropylmalate synthase OS=Glycine max GN=GMN56 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG67|MAM1_ARATH Methylthioalkylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana GN=MAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FN52|MAM3_ARATH Methylthioalkylmalate synthase 3, chloroplastic OS=Arabidopsis thaliana GN=MAM3 PE=1 SV=1 Back     alignment and function description
>sp|Q8VX04|MAM2_ARATH Methylthioalkylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=MAM2 PE=2 SV=1 Back     alignment and function description
>sp|B7JYP4|LEU1_CYAP8 2-isopropylmalate synthase OS=Cyanothece sp. (strain PCC 8801) GN=leuA PE=3 SV=1 Back     alignment and function description
>sp|B7KJX8|LEU1_CYAP7 2-isopropylmalate synthase OS=Cyanothece sp. (strain PCC 7424) GN=leuA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query623
255579410632 isopropylmalate synthase, putative [Rici 0.894 0.881 0.869 0.0
224083783558 predicted protein [Populus trichocarpa] 0.894 0.998 0.864 0.0
75707983623 2-isopropylmalate synthase 1 [Brassica i 0.967 0.967 0.791 0.0
449516089639 PREDICTED: 2-isopropylmalate synthase 2, 0.908 0.885 0.833 0.0
58743500623 Putative 2-isopropylmalate synthase [Bra 0.967 0.967 0.788 0.0
15221125631 2-isopropylmalate synthase 2 [Arabidopsi 0.903 0.892 0.827 0.0
297844800630 hypothetical protein ARALYDRAFT_472070 [ 0.924 0.914 0.823 0.0
42562149631 2-isopropylmalate synthase [Arabidopsis 0.974 0.961 0.793 0.0
449463448633 PREDICTED: 2-isopropylmalate synthase 2, 0.908 0.894 0.826 0.0
171921096672 2-isopropylmalate synthase [Brassica ole 0.874 0.811 0.853 0.0
>gi|255579410|ref|XP_002530549.1| isopropylmalate synthase, putative [Ricinus communis] gi|223529911|gb|EEF31840.1| isopropylmalate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1010 bits (2611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/560 (86%), Positives = 522/560 (93%), Gaps = 3/560 (0%)

Query: 66  RPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAA 125
           RPEYIP+ IPDP+YVR+FDTTLRDGEQSPGATLTSKEKLDIARQL+KLGVDIIEAGFPAA
Sbjct: 74  RPEYIPSHIPDPSYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLSKLGVDIIEAGFPAA 133

Query: 126 SKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIA 185
           SK+DFEAV+TIAKEVGNAVD E GYVPVICGLSRCNE+DI+TAWEAVKYAKRPRIHTFIA
Sbjct: 134 SKDDFEAVKTIAKEVGNAVD-EDGYVPVICGLSRCNEKDIRTAWEAVKYAKRPRIHTFIA 192

Query: 186 TSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIK 245
           TS IHME+KLRK+K++VVEIARSMVKFARSLGCDDVEFSPEDAGRSDR+FLY ILGEVIK
Sbjct: 193 TSAIHMEYKLRKSKEEVVEIARSMVKFARSLGCDDVEFSPEDAGRSDREFLYHILGEVIK 252

Query: 246 VGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACA 305
            GATTLNIPDTVGIT+P+EFG+LIADIKANTPGI+ V+ISTHCQNDLGLSTANT+AGA A
Sbjct: 253 AGATTLNIPDTVGITLPSEFGQLIADIKANTPGIDKVIISTHCQNDLGLSTANTLAGAYA 312

Query: 306 GARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTG 365
           GARQVEVTINGIGERAGNASLEEVVMA KCRGEHILGGLYTGIN R I MASKMVEEYTG
Sbjct: 313 GARQVEVTINGIGERAGNASLEEVVMAIKCRGEHILGGLYTGINPRQITMASKMVEEYTG 372

Query: 366 LHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRH 425
           LH+QPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERS++AGIVLGKLSGRH
Sbjct: 373 LHLQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSNDAGIVLGKLSGRH 432

Query: 426 ALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDM 485
           ALKDRLKELGYELNDEQLGTIFW FKAVAE KKRVTDADLIALVSDE+FQPE+VWKL D+
Sbjct: 433 ALKDRLKELGYELNDEQLGTIFWRFKAVAETKKRVTDADLIALVSDEVFQPEIVWKLGDL 492

Query: 486 QVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVT 545
           QVTCGTLGLSTATVKL++A+GEEH+ACS G+GPVD+ YKAVDLIVKEP  LLEYSMNAVT
Sbjct: 493 QVTCGTLGLSTATVKLINADGEEHIACSVGSGPVDAGYKAVDLIVKEPVELLEYSMNAVT 552

Query: 546 AGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLG 605
            GIDAIATTRVLIR E +  STHA TGE  QRTFSG+GAGMDIVVSSVKAY+GALNKML 
Sbjct: 553 EGIDAIATTRVLIRREDNHTSTHALTGEPFQRTFSGSGAGMDIVVSSVKAYVGALNKMLA 612

Query: 606 FKDQLPAK--DSVERTSVSA 623
            K Q   K   S +RT VSA
Sbjct: 613 LKQQFLTKRVSSTDRTPVSA 632

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224083783|ref|XP_002307122.1| predicted protein [Populus trichocarpa] gi|222856571|gb|EEE94118.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|75707983|gb|ABA26446.1| 2-isopropylmalate synthase 1 [Brassica insularis] Back     alignment and taxonomy information
>gi|449516089|ref|XP_004165080.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|58743500|gb|AAW81741.1| Putative 2-isopropylmalate synthase [Brassica oleracea] Back     alignment and taxonomy information
>gi|15221125|ref|NP_177544.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana] gi|75168891|sp|Q9C550.1|LEU12_ARATH RecName: Full=2-isopropylmalate synthase 2, chloroplastic; AltName: Full=2-isopropylmalate synthase 1; AltName: Full=Methylthioalkylmalate synthase-like 3; Flags: Precursor gi|12325154|gb|AAG52530.1|AC016662_24 putative 2-isopropylmalate synthase; 30920-27612 [Arabidopsis thaliana] gi|12330687|gb|AAG52882.1|AF327647_1 2-isopropylmalate synthase [Arabidopsis thaliana] gi|16323111|gb|AAL15290.1| At1g74040/F2P9_9 [Arabidopsis thaliana] gi|23463041|gb|AAN33190.1| At1g74040/F2P9_9 [Arabidopsis thaliana] gi|332197419|gb|AEE35540.1| 2-isopropylmalate synthase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297844800|ref|XP_002890281.1| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. lyrata] gi|297336123|gb|EFH66540.1| hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42562149|ref|NP_173285.2| 2-isopropylmalate synthase [Arabidopsis thaliana] gi|322510044|sp|Q9LPR4.2|LEU11_ARATH RecName: Full=2-isopropylmalate synthase 1, chloroplastic; AltName: Full=Methylthioalkylmalate synthase-like 4; Flags: Precursor gi|332191602|gb|AEE29723.1| 2-isopropylmalate synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449463448|ref|XP_004149446.1| PREDICTED: 2-isopropylmalate synthase 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|171921096|gb|ACB59195.1| 2-isopropylmalate synthase [Brassica oleracea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query623
TAIR|locus:2014179631 MAML-4 "methylthioalkylmalate 0.972 0.960 0.795 1.7e-256
TAIR|locus:2031586631 IMS1 "2-isopropylmalate syntha 0.926 0.914 0.811 1.4e-254
TAIR|locus:2181151506 MAM1 "methylthioalkylmalate sy 0.653 0.804 0.665 7.9e-149
TAIR|locus:2178317503 IMS2 "2-isopropylmalate syntha 0.690 0.854 0.619 8.1e-147
TIGR_CMR|DET_0830505 DET_0830 "2-isopropylmalate sy 0.762 0.940 0.529 7.6e-128
TIGR_CMR|GSU_1906512 GSU_1906 "2-isopropylmalate sy 0.764 0.929 0.512 2e-120
TIGR_CMR|CHY_0521509 CHY_0521 "2-isopropylmalate sy 0.757 0.927 0.518 9.8e-119
TIGR_CMR|SPO_0422524 SPO_0422 "2-isopropylmalate sy 0.828 0.984 0.475 1.2e-113
TIGR_CMR|SO_4236522 SO_4236 "2-isopropylmalate syn 0.735 0.877 0.460 5.6e-100
UNIPROTKB|Q9KP83516 leuA "2-isopropylmalate syntha 0.764 0.922 0.456 6.4e-99
TAIR|locus:2014179 MAML-4 "methylthioalkylmalate synthase-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2469 (874.2 bits), Expect = 1.7e-256, P = 1.7e-256
 Identities = 485/610 (79%), Positives = 539/610 (88%)

Query:    16 PTFISS-SPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSLYPRITAT-RPEYIPNR 73
             PTF S  +P + +   Q   H + S       +SCS+  P P L P      RPEYIPNR
Sbjct:    24 PTFSSKPTPISSSFRFQPSHHRSISLRSQTLRLSCSISDPSP-LPPHTPRRPRPEYIPNR 82

Query:    74 IPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAV 133
             I DPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK+DFEAV
Sbjct:    83 ISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAV 142

Query:   134 RTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEH 193
             +TIA+ VGN VD E+GYVPVICGLSRCN++DI+ AW+AVKYAKRPRIHTFIATS IH+E+
Sbjct:   143 KTIAETVGNTVD-ENGYVPVICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSDIHLEY 201

Query:   194 KLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNI 253
             KL+KTK +V+EIARSMV+FARSLGC+DVEFSPEDAGRS+R++LYEILGEVIK GATTLNI
Sbjct:   202 KLKKTKAEVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREYLYEILGEVIKAGATTLNI 261

Query:   254 PDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQVEVT 313
             PDTVGIT+P+EFG+LI D+KANTPGIENVVISTHCQNDLGLSTANT++GA AGARQ+EVT
Sbjct:   262 PDTVGITLPSEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGARQMEVT 321

Query:   314 INGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKA 373
             INGIGERAGNASLEEVVMA KCRG+H+LGGL+TGI+TRHIVM SKMVEEYTG+  QPHKA
Sbjct:   322 INGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKA 381

Query:   374 IVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKE 433
             IVGANAFAHESGIHQDGMLKHKGTYEII PE+IGLERS++AGIVLGKLSGRHALKDRL E
Sbjct:   382 IVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALKDRLTE 441

Query:   434 LGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLG 493
             LGY+L+DEQL TIFW FK VAEQKKRVTDAD+IALVSDE+FQPE VWKLLD+Q+TCGTLG
Sbjct:   442 LGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQPEAVWKLLDIQITCGTLG 501

Query:   494 LSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIAT 553
             LSTATVKL DA+G+EHVACS GTGPVDSAYKAVDLIVKEPATLLEYSMNAVT GIDAIAT
Sbjct:   502 LSTATVKLADADGKEHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIAT 561

Query:   554 TRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFKDQLPAK 613
             TRVLIRG     ST+A TGE VQRTFSGTGAGMDIVVSSVKAY+GALNKM+ FK+    K
Sbjct:   562 TRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDFKENSATK 621

Query:   614 DSVERTSVSA 623
                ++  V+A
Sbjct:   622 IPSQKNRVAA 631
GO:0003824 "catalytic activity" evidence=IEA
GO:0003852 "2-isopropylmalate synthase activity" evidence=IEA;IDA
GO:0009098 "leucine biosynthetic process" evidence=IEA;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0019752 "carboxylic acid metabolic process" evidence=IEA
GO:0046912 "transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer" evidence=IEA
GO:0009570 "chloroplast stroma" evidence=IDA
TAIR|locus:2031586 IMS1 "2-isopropylmalate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181151 MAM1 "methylthioalkylmalate synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178317 IMS2 "2-isopropylmalate synthase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0830 DET_0830 "2-isopropylmalate synthase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1906 GSU_1906 "2-isopropylmalate synthase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0521 CHY_0521 "2-isopropylmalate synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0422 SPO_0422 "2-isopropylmalate synthase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4236 SO_4236 "2-isopropylmalate synthase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KP83 leuA "2-isopropylmalate synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7JYP4LEU1_CYAP82, ., 3, ., 3, ., 1, 30.53220.81700.9496yesno
A2BRP4LEU1_PROMS2, ., 3, ., 3, ., 1, 30.52170.77680.8864yesno
Q112U2LEU1_TRIEI2, ., 3, ., 3, ., 1, 30.53060.81210.9353yesno
O67862LEU1_AQUAE2, ., 3, ., 3, ., 1, 30.52310.81210.9730yesno
Q3AEQ5LEU1_CARHZ2, ., 3, ., 3, ., 1, 30.50090.79610.9744yesno
B0JGK2LEU1_MICAN2, ., 3, ., 3, ., 1, 30.52230.80890.9455yesno
Q47BI0LEU1_DECAR2, ., 3, ., 3, ., 1, 30.48050.81700.9922yesno
Q7V121LEU1_PROMP2, ., 3, ., 3, ., 1, 30.52160.77360.8827yesno
Q7VBG1LEU1_PROMA2, ., 3, ., 3, ., 1, 30.50370.81050.9421yesno
B1XLQ9LEU1_SYNP22, ., 3, ., 3, ., 1, 30.53100.79930.9343yesno
Q3AIA2LEU1_SYNSC2, ., 3, ., 3, ., 1, 30.50450.82980.9574yesno
Q8DJ32LEU1_THEEB2, ., 3, ., 3, ., 1, 30.53100.82020.9551yesno
A8G5D5LEU1_PROM22, ., 3, ., 3, ., 1, 30.51970.77680.8864yesno
Q3SHE7LEU1_THIDA2, ., 3, ., 3, ., 1, 30.51710.78970.9628yesno
Q46K01LEU1_PROMT2, ., 3, ., 3, ., 1, 30.50740.81050.9369yesno
B1WQQ4LEU1_CYAA52, ., 3, ., 3, ., 1, 30.53710.81050.9404yesno
Q3MBA3LEU1_ANAVT2, ., 3, ., 3, ., 1, 30.52790.80730.9472yesno
A5GM47LEU1_SYNPW2, ., 3, ., 3, ., 1, 30.52380.77840.8981yesno
Q7NI93LEU1_GLOVI2, ., 3, ., 3, ., 1, 30.52730.79930.9256yesno
Q0AGN5LEU1_NITEC2, ., 3, ., 3, ., 1, 30.51050.78970.9647yesno
Q9C550LEU12_ARATH2, ., 3, ., 3, ., 1, 30.82710.90360.8922yesno
Q9LPR4LEU11_ARATH2, ., 3, ., 3, ., 1, 30.79310.97430.9619nono
A4J181LEU1_DESRM2, ., 3, ., 3, ., 1, 30.51130.79930.9861yesno
P48576LEU1_SYNY32, ., 3, ., 3, ., 1, 30.54220.80250.9380N/Ano
P48575LEU1_NOSS12, ., 3, ., 3, ., 1, 30.52790.80730.9472yesno
Q0IBI3LEU1_SYNS32, ., 3, ., 3, ., 1, 30.51980.77840.8981yesno
B0TCR1LEU1_HELMI2, ., 3, ., 3, ., 1, 30.50830.80890.9843yesno
B1H0A7LEU1_UNCTG2, ., 3, ., 3, ., 1, 30.47420.81700.9864yesno
O04973LEU1A_SOLPN2, ., 3, ., 3, ., 1, 30.73730.89720.9490N/Ano
A5GRZ0LEU1_SYNR32, ., 3, ., 3, ., 1, 30.52970.77840.9031yesno
B7KJX8LEU1_CYAP72, ., 3, ., 3, ., 1, 30.53230.83780.9738yesno
O04974LEU1B_SOLPN2, ., 3, ., 3, ., 1, 30.71230.95660.9738N/Ano
A2BX52LEU1_PROM52, ., 3, ., 3, ., 1, 30.51070.78490.8956yesno
A9BB43LEU1_PROM42, ., 3, ., 3, ., 1, 30.50.81380.9458yesno
Q31AF9LEU1_PROM92, ., 3, ., 3, ., 1, 30.51580.77680.8864yesno
Q7TUV5LEU1_PROMM2, ., 3, ., 3, ., 1, 30.51580.77840.8981yesno
Q3AYY2LEU1_SYNS92, ., 3, ., 3, ., 1, 30.53370.77840.8981yesno
P94907LEU1_MICAE2, ., 3, ., 3, ., 1, 30.51860.80890.9455yesno
A2C859LEU1_PROM32, ., 3, ., 3, ., 1, 30.51190.77840.8981yesno
Q7U892LEU1_SYNPX2, ., 3, ., 3, ., 1, 30.50820.82180.9481yesno
A3PDH0LEU1_PROM02, ., 3, ., 3, ., 1, 30.50370.80890.9230yesno
A2C3L7LEU1_PROM12, ., 3, ., 3, ., 1, 30.50740.81050.9369yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.30.983
3rd Layer2.3.3.130.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
PLN02321632 PLN02321, PLN02321, 2-isopropylmalate synthase 0.0
PRK00915513 PRK00915, PRK00915, 2-isopropylmalate synthase; Va 0.0
PLN03228503 PLN03228, PLN03228, methylthioalkylmalate synthase 0.0
TIGR00973494 TIGR00973, leuA_bact, 2-isopropylmalate synthase, 0.0
cd07940268 cd07940, DRE_TIM_IPMS, 2-isopropylmalate synthase 1e-167
COG0119409 COG0119, LeuA, Isopropylmalate/homocitrate/citrama 1e-156
PRK09389488 PRK09389, PRK09389, (R)-citramalate synthase; Prov 1e-156
PRK11858378 PRK11858, aksA, trans-homoaconitate synthase; Revi 1e-146
TIGR02090363 TIGR02090, LEU1_arch, isopropylmalate/citramalate/ 1e-137
TIGR02660365 TIGR02660, nifV_homocitr, homocitrate synthase Nif 1e-98
pfam00682236 pfam00682, HMGL-like, HMGL-like 9e-88
cd03174265 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyas 5e-87
cd07939259 cd07939, DRE_TIM_NifV, Streptomyces rubellomurinus 6e-71
PRK12344524 PRK12344, PRK12344, putative alpha-isopropylmalate 5e-58
TIGR02146344 TIGR02146, LysS_fung_arch, homocitrate synthase 1e-54
TIGR00977526 TIGR00977, LeuA_rel, 2-isopropylmalate synthase/ho 4e-50
pfam08502131 pfam08502, LeuA_dimer, LeuA allosteric (dimerisati 9e-42
cd07945280 cd07945, DRE_TIM_CMS, Leptospira interrogans citra 1e-39
TIGR00970564 TIGR00970, leuA_yeast, 2-isopropylmalate synthase, 2e-37
cd07948262 cd07948, DRE_TIM_HCS, Saccharomyces cerevisiae hom 3e-37
cd07942284 cd07942, DRE_TIM_LeuA, Mycobacterium tuberculosis 8e-35
cd07941273 cd07941, DRE_TIM_LeuA3, Desulfobacterium autotroph 2e-34
smart00917131 smart00917, LeuA_dimer, LeuA allosteric (dimerisat 2e-34
PRK03739552 PRK03739, PRK03739, 2-isopropylmalate synthase; Va 1e-32
cd07947279 cd07947, DRE_TIM_Re_CS, Clostridium kluyveri Re-ci 3e-18
PRK14847333 PRK14847, PRK14847, hypothetical protein; Provisio 4e-18
cd07943263 cd07943, DRE_TIM_HOA, 4-hydroxy-2-oxovalerate aldo 1e-15
TIGR03217333 TIGR03217, 4OH_2_O_val_ald, 4-hydroxy-2-oxovalerat 5e-14
PRK08195337 PRK08195, PRK08195, 4-hyroxy-2-oxovalerate/4-hydro 1e-11
cd07944266 cd07944, DRE_TIM_HOA_like, 4-hydroxy-2-oxovalerate 2e-10
cd07938274 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl- 2e-08
COG5016472 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltr 4e-05
PRK12581468 PRK12581, PRK12581, oxaloacetate decarboxylase; Pr 4e-04
cd07937275 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase an 4e-04
PRK11780217 PRK11780, PRK11780, isoprenoid biosynthesis protei 0.004
>gnl|CDD|215182 PLN02321, PLN02321, 2-isopropylmalate synthase Back     alignment and domain information 
 Score = 1072 bits (2773), Expect = 0.0
 Identities = 472/625 (75%), Positives = 521/625 (83%), Gaps = 6/625 (0%)

Query: 2   AATTAAAAFFTNRQPTFI---SSSPKTKANASQLFFHCNNSKPFFKTTISCSLQKPPPSL 58
           ++ TAA+   +    T     SS+   +  A         ++     + + S     PS 
Sbjct: 8   SSATAASPAKSLSAFTPAPTRSSASSARFPAFLARP--AAARSPSLASRASSALAASPSR 65

Query: 59  YPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII 118
                  RPEYIPNRI DPNYVR+FDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII
Sbjct: 66  PQVARRPRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDII 125

Query: 119 EAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRP 178
           EAGFP AS +D EAV+TIAKEVGN VD E GYVPVICGLSRCN++DI  AWEAVK+AKRP
Sbjct: 126 EAGFPIASPDDLEAVKTIAKEVGNEVD-EDGYVPVICGLSRCNKKDIDAAWEAVKHAKRP 184

Query: 179 RIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYE 238
           RIHTFIATS IHMEHKLRKT  +VVEIAR MVK+ARSLGC+DVEFSPEDAGRSD +FLY 
Sbjct: 185 RIHTFIATSEIHMEHKLRKTPDEVVEIARDMVKYARSLGCEDVEFSPEDAGRSDPEFLYR 244

Query: 239 ILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTAN 298
           ILGEVIK GATTLNIPDTVG T+P+EFG+LIADIKANTPGIENV+ISTHCQNDLGLSTAN
Sbjct: 245 ILGEVIKAGATTLNIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTHCQNDLGLSTAN 304

Query: 299 TIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASK 358
           T+AGA AGARQVEVTINGIGERAGNASLEEVVMA KCRG+  LGGLYTGIN  HI   SK
Sbjct: 305 TLAGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDEQLGGLYTGINPVHITPTSK 364

Query: 359 MVEEYTGLHVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVL 418
           MV EYTG+ VQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGL R ++AGIVL
Sbjct: 365 MVSEYTGMQVQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLFRGNDAGIVL 424

Query: 419 GKLSGRHALKDRLKELGYELNDEQLGTIFWHFKAVAEQKKRVTDADLIALVSDEIFQPEV 478
           GKLSGRHALK RLKELGYEL+D++L  +F  FKAVAE+KK VTD DLIALVSDE+FQPEV
Sbjct: 425 GKLSGRHALKSRLKELGYELDDDELDDVFKRFKAVAEKKKGVTDEDLIALVSDEVFQPEV 484

Query: 479 VWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVDLIVKEPATLLE 538
           VWKLLD+QVTCGTLGLSTATVKL+  +G EH+ACS GTGPVD+AYKAVDLIVKEP TLLE
Sbjct: 485 VWKLLDLQVTCGTLGLSTATVKLIGPDGVEHIACSVGTGPVDAAYKAVDLIVKEPVTLLE 544

Query: 539 YSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIG 598
           YSMNAVT GIDAIATTRV+IRGE S  STHA TGE+VQRTFSG+GA MDIVVSSV+AY+ 
Sbjct: 545 YSMNAVTEGIDAIATTRVVIRGENSYSSTHAQTGESVQRTFSGSGADMDIVVSSVRAYVS 604

Query: 599 ALNKMLGFKDQLPAKDSVERTSVSA 623
           ALNKMLGFK+   AK + ER++   
Sbjct: 605 ALNKMLGFKEASKAKSASERSTSVV 629

Length = 632
>gnl|CDD|234864 PRK00915, PRK00915, 2-isopropylmalate synthase; Validated Back     alignment and domain information
>gnl|CDD|178767 PLN03228, PLN03228, methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>gnl|CDD|130046 TIGR00973, leuA_bact, 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>gnl|CDD|163678 cd07940, DRE_TIM_IPMS, 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|223197 COG0119, LeuA, Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236493 PRK09389, PRK09389, (R)-citramalate synthase; Provisional Back     alignment and domain information
>gnl|CDD|183341 PRK11858, aksA, trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|233719 TIGR02090, LEU1_arch, isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>gnl|CDD|233965 TIGR02660, nifV_homocitr, homocitrate synthase NifV Back     alignment and domain information
>gnl|CDD|201390 pfam00682, HMGL-like, HMGL-like Back     alignment and domain information
>gnl|CDD|163674 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyase superfamily Back     alignment and domain information
>gnl|CDD|163677 cd07939, DRE_TIM_NifV, Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|237068 PRK12344, PRK12344, putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>gnl|CDD|162728 TIGR02146, LysS_fung_arch, homocitrate synthase Back     alignment and domain information
>gnl|CDD|130050 TIGR00977, LeuA_rel, 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>gnl|CDD|219870 pfam08502, LeuA_dimer, LeuA allosteric (dimerisation) domain Back     alignment and domain information
>gnl|CDD|163683 cd07945, DRE_TIM_CMS, Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|233216 TIGR00970, leuA_yeast, 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>gnl|CDD|163685 cd07948, DRE_TIM_HCS, Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|163680 cd07942, DRE_TIM_LeuA, Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|163679 cd07941, DRE_TIM_LeuA3, Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|214910 smart00917, LeuA_dimer, LeuA allosteric (dimerisation) domain Back     alignment and domain information
>gnl|CDD|235154 PRK03739, PRK03739, 2-isopropylmalate synthase; Validated Back     alignment and domain information
>gnl|CDD|163684 cd07947, DRE_TIM_Re_CS, Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|184849 PRK14847, PRK14847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|163681 cd07943, DRE_TIM_HOA, 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|132261 TIGR03217, 4OH_2_O_val_ald, 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>gnl|CDD|181282 PRK08195, PRK08195, 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>gnl|CDD|163682 cd07944, DRE_TIM_HOA_like, 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|163676 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|227349 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|79056 PRK12581, PRK12581, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|163675 cd07937, DRE_TIM_PC_TC_5S, Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>gnl|CDD|236980 PRK11780, PRK11780, isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 623
PLN02321632 2-isopropylmalate synthase 100.0
TIGR00973494 leuA_bact 2-isopropylmalate synthase, bacterial ty 100.0
PRK00915513 2-isopropylmalate synthase; Validated 100.0
PRK09389488 (R)-citramalate synthase; Provisional 100.0
PRK03739552 2-isopropylmalate synthase; Validated 100.0
TIGR00970564 leuA_yeast 2-isopropylmalate synthase, yeast type. 100.0
TIGR00977526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 100.0
KOG2367560 consensus Alpha-isopropylmalate synthase/homocitra 100.0
PRK12344524 putative alpha-isopropylmalate/homocitrate synthas 100.0
PLN03228503 methylthioalkylmalate synthase; Provisional 100.0
COG0119409 LeuA Isopropylmalate/homocitrate/citramalate synth 100.0
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 100.0
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 100.0
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 100.0
PRK14847333 hypothetical protein; Provisional 100.0
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 100.0
cd07942284 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and 100.0
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 100.0
PLN02746347 hydroxymethylglutaryl-CoA lyase 100.0
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 100.0
TIGR02146344 LysS_fung_arch homocitrate synthase. This model in 100.0
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 100.0
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 100.0
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 100.0
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 100.0
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 100.0
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 100.0
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 100.0
PF00682237 HMGL-like: HMGL-like of this family is not conserv 100.0
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 100.0
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 100.0
PRK14040593 oxaloacetate decarboxylase; Provisional 100.0
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 100.0
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 100.0
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 100.0
PRK09282592 pyruvate carboxylase subunit B; Validated 100.0
PRK12330499 oxaloacetate decarboxylase; Provisional 100.0
PRK12331448 oxaloacetate decarboxylase; Provisional 100.0
PRK14041467 oxaloacetate decarboxylase; Provisional 100.0
PRK12581468 oxaloacetate decarboxylase; Provisional 100.0
PRK129991146 pyruvate carboxylase; Reviewed 100.0
PRK14042596 pyruvate carboxylase subunit B; Provisional 100.0
KOG2368316 consensus Hydroxymethylglutaryl-CoA lyase [Energy 100.0
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 100.0
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 100.0
PF08502133 LeuA_dimer: LeuA allosteric (dimerisation) domain; 99.97
COG10381149 PycA Pyruvate carboxylase [Energy production and c 99.85
TIGR02146344 LysS_fung_arch homocitrate synthase. This model in 99.73
KOG03691176 consensus Pyruvate carboxylase [Energy production 99.72
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 98.44
PLN02591250 tryptophan synthase 97.96
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.96
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 97.95
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 97.88
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.88
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 97.84
PRK08445348 hypothetical protein; Provisional 97.77
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 97.75
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.7
PRK07360371 FO synthase subunit 2; Reviewed 97.32
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 97.26
PRK08444353 hypothetical protein; Provisional 97.25
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.22
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.21
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 97.03
PRK05926370 hypothetical protein; Provisional 96.99
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 96.99
PRK07094323 biotin synthase; Provisional 96.92
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 96.89
PLN02389379 biotin synthase 96.87
PRK15108345 biotin synthase; Provisional 96.84
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 96.74
PRK06256336 biotin synthase; Validated 96.6
PRK05927350 hypothetical protein; Provisional 96.6
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 96.59
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.49
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.37
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 96.27
PRK08508279 biotin synthase; Provisional 96.24
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav 96.11
PRK09613469 thiH thiamine biosynthesis protein ThiH; Reviewed 96.09
PRK06245336 cofG FO synthase subunit 1; Reviewed 95.86
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 95.76
PRK05301378 pyrroloquinoline quinone biosynthesis protein PqqE 95.7
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 95.67
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.67
PRK09234843 fbiC FO synthase; Reviewed 95.64
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 95.64
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 95.57
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 95.51
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 95.49
TIGR02109358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 95.46
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 95.46
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 95.43
PRK09856275 fructoselysine 3-epimerase; Provisional 95.43
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 95.42
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 95.37
PRK09997258 hydroxypyruvate isomerase; Provisional 95.35
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 95.34
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.32
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 95.28
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 95.18
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.09
PTZ00413398 lipoate synthase; Provisional 94.99
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 94.99
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 94.96
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 94.95
PRK13210284 putative L-xylulose 5-phosphate 3-epimerase; Revie 94.92
TIGR01496257 DHPS dihydropteroate synthase. This model represen 94.91
PRK06801286 hypothetical protein; Provisional 94.82
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 94.77
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 94.77
PRK06267350 hypothetical protein; Provisional 94.73
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM 94.7
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 94.69
PRK12928290 lipoyl synthase; Provisional 94.63
PRK00507221 deoxyribose-phosphate aldolase; Provisional 94.59
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.57
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.42
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 94.4
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 94.4
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 94.26
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 94.23
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 94.21
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 94.16
PRK07709285 fructose-bisphosphate aldolase; Provisional 94.15
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 94.11
PRK01060281 endonuclease IV; Provisional 94.09
PLN02951373 Molybderin biosynthesis protein CNX2 93.81
PRK07315293 fructose-bisphosphate aldolase; Provisional 93.8
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 93.76
PRK09989258 hypothetical protein; Provisional 93.69
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 93.61
PRK11613282 folP dihydropteroate synthase; Provisional 93.49
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 93.32
PLN02428349 lipoic acid synthase 93.31
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 93.29
TIGR03581236 EF_0839 conserved hypothetical protein EF_0839/AHA 93.21
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 93.11
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related 93.03
PRK08185283 hypothetical protein; Provisional 92.99
TIGR01496257 DHPS dihydropteroate synthase. This model represen 92.97
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 92.96
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 92.87
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coen 92.77
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 92.68
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 92.64
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 92.62
cd00423258 Pterin_binding Pterin binding enzymes. This family 92.5
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 92.48
TIGR03586327 PseI pseudaminic acid synthase. 92.45
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 92.45
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 92.44
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 92.4
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 92.35
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 92.35
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 92.29
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 92.29
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 92.27
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 92.27
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 92.26
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 92.18
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 92.14
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 92.14
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 92.08
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 92.04
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 92.02
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 91.99
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 91.94
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 91.92
PRK08610286 fructose-bisphosphate aldolase; Reviewed 91.83
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 91.83
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 91.77
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 91.75
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 91.74
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 91.72
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 91.71
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 91.71
TIGR00284499 dihydropteroate synthase-related protein. This pro 91.7
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 91.7
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 91.65
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 91.43
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 91.42
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 91.31
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 91.18
TIGR00587274 nfo apurinic endonuclease (APN1). All proteins in 91.15
TIGR01290442 nifB nitrogenase cofactor biosynthesis protein Nif 91.15
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 91.0
TIGR00538455 hemN oxygen-independent coproporphyrinogen III oxi 90.91
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 90.84
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 90.83
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 90.78
COG1082274 IolE Sugar phosphate isomerases/epimerases [Carboh 90.78
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 90.72
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 90.69
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 90.66
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 90.65
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 90.6
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 90.44
PRK15452443 putative protease; Provisional 90.44
PRK13753279 dihydropteroate synthase; Provisional 90.42
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 90.41
TIGR00510302 lipA lipoate synthase. The family shows strong seq 90.4
PRK03170292 dihydrodipicolinate synthase; Provisional 90.4
PRK05481289 lipoyl synthase; Provisional 90.36
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 90.21
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 90.21
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 90.2
COG0826347 Collagenase and related proteases [Posttranslation 90.18
PRK09234 843 fbiC FO synthase; Reviewed 90.15
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 90.08
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 89.96
PRK13347453 coproporphyrinogen III oxidase; Provisional 89.93
PRK10481224 hypothetical protein; Provisional 89.89
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 89.8
COG1856275 Uncharacterized homolog of biotin synthetase [Func 89.79
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 89.76
PRK09249453 coproporphyrinogen III oxidase; Provisional 89.73
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 89.67
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 89.66
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 89.57
PRK08446350 coproporphyrinogen III oxidase; Provisional 89.52
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 89.49
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 89.41
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 89.36
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 89.36
PRK15108345 biotin synthase; Provisional 89.34
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 89.3
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 89.29
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 89.23
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 89.18
PRK04165450 acetyl-CoA decarbonylase/synthase complex subunit 89.17
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 89.13
PRK03170292 dihydrodipicolinate synthase; Provisional 89.04
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 88.9
PLN02417280 dihydrodipicolinate synthase 88.62
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 88.58
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 88.58
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.57
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 88.49
COG0821361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 88.43
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 88.28
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 88.26
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 88.26
COG3623287 SgaU Putative L-xylulose-5-phosphate 3-epimerase [ 88.2
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 88.18
COG2100414 Predicted Fe-S oxidoreductase [General function pr 88.04
TIGR00284499 dihydropteroate synthase-related protein. This pro 88.01
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 88.0
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 87.7
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 87.69
PRK05660378 HemN family oxidoreductase; Provisional 87.69
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 87.69
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 87.65
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 87.64
PRK06852304 aldolase; Validated 87.53
TIGR02631382 xylA_Arthro xylose isomerase, Arthrobacter type. T 87.51
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 87.49
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 87.44
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 87.36
PRK05835307 fructose-bisphosphate aldolase; Provisional 87.23
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 87.16
COG1244358 Predicted Fe-S oxidoreductase [General function pr 87.12
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 87.09
TIGR03586327 PseI pseudaminic acid synthase. 86.91
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 86.81
PRK10605362 N-ethylmaleimide reductase; Provisional 86.7
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 86.69
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 86.69
PRK04147293 N-acetylneuraminate lyase; Provisional 86.67
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 86.63
PRK05628375 coproporphyrinogen III oxidase; Validated 86.59
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 86.57
PLN02424332 ketopantoate hydroxymethyltransferase 86.54
PRK05799374 coproporphyrinogen III oxidase; Provisional 86.37
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 86.25
PRK07226267 fructose-bisphosphate aldolase; Provisional 86.24
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 86.14
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 85.94
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 85.9
PRK07084321 fructose-bisphosphate aldolase; Provisional 85.89
PLN02623581 pyruvate kinase 85.88
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 85.84
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 85.82
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 85.79
PLN03033290 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 85.73
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 85.72
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 85.62
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 85.55
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 85.47
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 85.37
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 85.36
PRK13745412 anaerobic sulfatase-maturase; Provisional 85.22
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 85.09
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 85.09
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 85.03
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 84.99
PRK06806281 fructose-bisphosphate aldolase; Provisional 84.82
PRK08208430 coproporphyrinogen III oxidase; Validated 84.77
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 84.6
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 84.55
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 84.54
PRK08508279 biotin synthase; Provisional 84.37
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 84.3
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 84.26
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 84.18
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 84.14
PLN02433345 uroporphyrinogen decarboxylase 84.12
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 84.08
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 84.07
PRK08227264 autoinducer 2 aldolase; Validated 83.75
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 83.68
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 83.62
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 83.59
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 83.37
PRK00694606 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 83.32
PRK12677384 xylose isomerase; Provisional 83.24
PRK05581220 ribulose-phosphate 3-epimerase; Validated 83.23
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 83.22
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 83.16
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 83.12
TIGR01464338 hemE uroporphyrinogen decarboxylase. This model re 83.12
PRK07379400 coproporphyrinogen III oxidase; Provisional 82.99
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 82.98
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 82.94
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 82.92
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 82.91
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 82.75
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 82.58
PRK06096284 molybdenum transport protein ModD; Provisional 82.54
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 82.46
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 82.42
TIGR01334277 modD putative molybdenum utilization protein ModD. 82.39
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 82.39
PRK07094323 biotin synthase; Provisional 82.37
PRK05904353 coproporphyrinogen III oxidase; Provisional 82.34
cd03309321 CmuC_like CmuC_like. Proteins similar to the putat 82.32
COG1879322 RbsB ABC-type sugar transport system, periplasmic 82.22
PF00682237 HMGL-like: HMGL-like of this family is not conserv 82.06
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 82.06
PLN02334229 ribulose-phosphate 3-epimerase 82.03
PRK06801286 hypothetical protein; Provisional 81.98
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 81.81
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 81.78
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 81.77
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 81.72
COG0535347 Predicted Fe-S oxidoreductases [General function p 81.71
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 81.49
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 81.49
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 81.32
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 81.32
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 81.22
TIGR03822321 AblA_like_2 lysine-2,3-aminomutase-related protein 81.14
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 81.04
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 80.99
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 80.64
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 80.62
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 80.6
COG1856275 Uncharacterized homolog of biotin synthetase [Func 80.46
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 80.33
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 80.26
PRK01008372 queuine tRNA-ribosyltransferase; Provisional 80.11
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 80.09
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 80.04
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information 
Probab=100.00  E-value=8e-135  Score=1136.14  Aligned_cols=566  Identities=82%  Similarity=1.204  Sum_probs=528.4

Q ss_pred             ccccCCCCCCCCccccccCCCCCCCCCCCCCceEEEeCCCcccCCCCCCCCCHHHHHHHHHHHhHcCCCEEEEecCCCCh
Q 006969           48 SCSLQKPPPSLYPRITATRPEYIPNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASK  127 (623)
Q Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~I~DtTLRDG~Q~~g~~~t~e~Kl~Ia~~L~~~Gvd~IEvGfP~~s~  127 (623)
                      .|.....++......++.||+|+|+.+++|++|+|+|||||||+|++|..|++++|++|+++|+++|||+||+|||.+||
T Consensus        55 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~I~DtTLRDGeQ~~g~~~s~eeKl~Ia~~L~~lGVd~IEvGfP~~Sp  134 (632)
T PLN02321         55 ASSALAASPSRPQVARRPRPEYIPNRIDDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPIASP  134 (632)
T ss_pred             hhhccCCCcccccccccCCcccccccCCCCCceEEEECCCCccccCCCCCCCHHHHHHHHHHHHHcCCCEEEEeCcCCCc
Confidence            44444555555666788999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHhccccccCCCccceEEeecccchhhHHHHHHHHhcCCCCEEEEEecCCHHHHHHHhCCCHHHHHHHHH
Q 006969          128 EDFEAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIAR  207 (623)
Q Consensus       128 ~d~e~v~~i~~~~~~~~~~~~~l~~~i~~~~r~~~~dI~~a~eal~~a~~~~v~i~~~~Sd~h~~~~l~~t~ee~l~~~~  207 (623)
                      +|+++++.|++.+.+.+..+ +++++|++|+|++.+||+++++++++++.++||+|+++||+|+++++++|++|+++++.
T Consensus       135 ~D~e~vr~i~~~~~~~v~~~-~~v~~i~a~~ra~~~dId~A~~al~~a~~~~I~i~~stSd~h~~~~l~~t~ee~l~~~~  213 (632)
T PLN02321        135 DDLEAVKTIAKEVGNEVDED-GYVPVICGLSRCNKKDIDAAWEAVKHAKRPRIHTFIATSEIHMEHKLRKTPDEVVEIAR  213 (632)
T ss_pred             cHHHHHHHHHHhcccCCCcc-ccceeeeeehhccHHhHHHHHHHhcCCCCCEEEEEEcCCHHHHHHHhCCCHHHHHHHHH
Confidence            99999999988655544433 67899999999999999999999888888899999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCeEEEcccCCCCCCHHHHHHHHHHHHHcCCcEEeecCcccccCHHHHHHHHHHHHHhCCCCcceeEEEe
Q 006969          208 SMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTH  287 (623)
Q Consensus       208 ~~v~~ak~~G~~~V~f~~eda~r~d~e~l~~~~~~~~~aGa~~I~l~DTvG~~~P~~v~~li~~l~~~~~~~~~v~i~~H  287 (623)
                      ++|+|||++|+..|+|++||++|+|++|++++++++.++||++|+||||+|+++|++++++|+.+++++|+.++++|++|
T Consensus       214 ~~V~~Ak~~G~~~v~fs~EDa~rtd~d~l~~~~~~a~~aGa~~I~L~DTvG~~~P~~v~~li~~l~~~~~~~~~v~i~vH  293 (632)
T PLN02321        214 DMVKYARSLGCEDVEFSPEDAGRSDPEFLYRILGEVIKAGATTLNIPDTVGYTLPSEFGQLIADIKANTPGIENVIISTH  293 (632)
T ss_pred             HHHHHHHHcCCceEEEecccCCCCCHHHHHHHHHHHHHcCCCEEEecccccCCCHHHHHHHHHHHHHhcCCCCCceEEEE
Confidence            99999999998669999999999999999999999999999999999999999999999999999999987666889999


Q ss_pred             ecCCcchHHHHHHHHHHhCCCEEEeccCCccCccCcccHHHHHHHHHhcccccccccccCCChhHHHHHHHHHHHHhCCC
Q 006969          288 CQNDLGLSTANTIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLH  367 (623)
Q Consensus       288 ~HND~GlAvANslaAv~aGA~~Vd~Tv~GlGERaGNa~lEevv~~L~~~~~~~~~G~~t~idl~~L~~~s~~v~~~~g~~  367 (623)
                      ||||+|||+||+++|+++||++||+|+||||||+||++||+|+++|+.+++..++|+.+++|+++|+++|++|++++|++
T Consensus       294 ~HND~GlAvANslaAv~AGA~~Vd~TinGlGERaGNa~LEevv~~L~~~~~~~~~g~~tgidl~~L~~~s~~V~~~~g~~  373 (632)
T PLN02321        294 CQNDLGLSTANTLAGAHAGARQVEVTINGIGERAGNASLEEVVMAIKCRGDEQLGGLYTGINPVHITPTSKMVSEYTGMQ  373 (632)
T ss_pred             eCCCCCHHHHHHHHHHHhCCCEEEEecccccccccCccHHHHHHHHHhccCccccCcccccCHHHHHHHHHHHHHHhCcC
Confidence            99999999999999999999999999999999999999999999999876533468999999999999999999999999


Q ss_pred             CCCCCcccCcchhhcccccccccccccCCccccCCCcccCCcccccceEeeeccccHHHHHHHHHHcCCCCCHHHHHHHH
Q 006969          368 VQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLKELGYELNDEQLGTIF  447 (623)
Q Consensus       368 i~~~~pivG~~aF~h~sGiH~dgi~k~~~~Ye~~~Pe~vG~~r~~~~~i~lg~~SG~~~i~~~l~~lG~~l~~~~~~~~~  447 (623)
                      +++|+||||+|||+|||||||||++|||.+||||+||+||++|.++.+|+|||||||++|+++|+++||+++++++.+++
T Consensus       374 v~~~kPiVG~naFaheSGIH~dgvlk~~~tYe~i~Pe~VG~~r~~~~~i~lgk~SGr~~v~~~L~~lG~~l~~~~~~~~~  453 (632)
T PLN02321        374 VQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLFRGNDAGIVLGKLSGRHALKSRLKELGYELDDDELDDVF  453 (632)
T ss_pred             CCCCcccccccceehhcCccHHHHccCcccccccCHHHhCCcccccceecccccccHHHHHHHHHHhCCCCCHHHHHHHH
Confidence            99999999999999999999999999999999999999998887778899999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCcCCHHHHHHHHHHHhcCCcceeEEeeEEEEeccCCeeEEEEEEEccCCeEEEEEEEecCHHHHHHHHHH
Q 006969          448 WHFKAVAEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGTLGLSTATVKLMDANGEEHVACSTGTGPVDSAYKAVD  527 (623)
Q Consensus       448 ~~iK~lad~~~~v~d~dl~~L~~~~~~~~~~~~~L~~~~v~~g~~~~~~AtV~l~~~~G~~~~~~a~G~GPVdA~~~AL~  527 (623)
                      ++||+++++++.++++||+.|+++.+...++.|+|.+|+|.++....++|+|++..+||++++.+++|||||||+++||+
T Consensus       454 ~~vk~la~~~~~v~d~dl~~l~~~~~~~~~~~~~l~~~~v~~~~~~~~~a~v~l~~~~g~~~~~~a~G~GPvdA~~~Al~  533 (632)
T PLN02321        454 KRFKAVAEKKKGVTDEDLIALVSDEVFQPEVVWKLLDLQVTCGTLGLSTATVKLIGPDGVEHIACSVGTGPVDAAYKAVD  533 (632)
T ss_pred             HHHHHHHHhcCCCCHHHHHHHHHHHhccCCCceEEEEEEEEECCCCCcEEEEEEEeeCCEEEEEEEEecCHHHHHHHHHH
Confidence            99999999999999999999999998877789999999999998888999999975689999999999999999999999


Q ss_pred             HhhCCCceeeeeEEeecCCCCCceEEEEEEEEeccCCcccccCCCcccCceEEEEEecccHHHHHHHHHHHHHHhhhccc
Q 006969          528 LIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEKSQLSTHASTGETVQRTFSGTGAGMDIVVSSVKAYIGALNKMLGFK  607 (623)
Q Consensus       528 ~~~~~~v~L~dY~v~av~~G~dA~a~~~V~i~~~~~~~~~~~~~g~~~~~~~~g~G~~~DIi~AS~~A~i~A~N~l~~~~  607 (623)
                      ++++.+++|.||+++++++|+||+|+|+|.|+.++..+.+|++.|+..++.|||+|+|+||++|||+||++|+||++.++
T Consensus       534 ~~~~~~~~L~dY~v~~v~~g~da~a~v~V~i~~~~~~~~~~~~~~~~~~~~~~g~G~~~Dii~AS~~A~~~a~n~~~~~~  613 (632)
T PLN02321        534 LIVKEPVTLLEYSMNAVTEGIDAIATTRVVIRGENSYSSTHAQTGESVQRTFSGSGADMDIVVSSVRAYVSALNKMLGFK  613 (632)
T ss_pred             HhhCCCCEEEEEEEEccCCCCCceEEEEEEEEECCCcccccccccccCCCEEEEEEeCcCHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999765455677777765689999999999999999999999999999876


Q ss_pred             ccCCcCC
Q 006969          608 DQLPAKD  614 (623)
Q Consensus       608 ~~~~~~~  614 (623)
                      .....+.
T Consensus       614 ~~~~~~~  620 (632)
T PLN02321        614 EASKAKS  620 (632)
T ss_pred             hhhcccc
Confidence            6654444

>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK03739 2-isopropylmalate synthase; Validated Back     alignment and domain information
>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>KOG2367 consensus Alpha-isopropylmalate synthase/homocitrate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK14847 hypothetical protein; Provisional Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>KOG2368 consensus Hydroxymethylglutaryl-CoA lyase [Energy production and conversion; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PF08502 LeuA_dimer: LeuA allosteric (dimerisation) domain; InterPro: IPR013709 This is the C-terminal regulatory (R) domain of alpha-isopropylmalate synthase, which catalyses the first committed step in the leucine biosynthetic pathway [] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK09989 hypothetical protein; Provisional Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>TIGR03581 EF_0839 conserved hypothetical protein EF_0839/AHA_3917 Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00587 nfo apurinic endonuclease (APN1) Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>TIGR02631 xylA_Arthro xylose isomerase, Arthrobacter type Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated Back     alignment and domain information
>PRK12677 xylose isomerase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>TIGR01464 hemE uroporphyrinogen decarboxylase Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd03309 CmuC_like CmuC_like Back     alignment and domain information
>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK01008 queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
3rmj_A370 Crystal Structure Of Truncated Alpha-Isopropylmalat 1e-110
3eeg_A325 Crystal Structure Of A 2-Isopropylmalate Synthase F 9e-87
3ewb_X293 Crystal Structure Of N-Terminal Domain Of Putative 2e-67
3ivt_A423 Homocitrate Synthase Lys4 Bound To 2-Og Length = 42 5e-35
3ivs_A423 Homocitrate Synthase Lys4 Length = 423 4e-34
2ztj_A382 Crystal Structure Of Homocitrate Synthase From Ther 3e-27
3a9i_A376 Crystal Structure Of Homocitrate Synthase From Ther 3e-27
3ble_A337 Crystal Structure Of The Catalytic Domain Of Licms 6e-26
3hps_A644 Crystal Structure Of Mycobacterium Tuberculosis Leu 1e-24
3fig_A646 Crystal Structure Of Leucine-bound Leua From Mycoba 1e-24
1sr9_A644 Crystal Structure Of Leua From Mycobacterium Tuberc 2e-22
3u6w_A427 Truncated M. Tuberculosis Leua (1-425) Complexed Wi 8e-21
3hpx_A425 Crystal Structure Of Mycobacterium Tuberculosis Leu 8e-21
2cw6_A298 Crystal Structure Of Human Hmg-Coa Lyase: Insights 2e-04
1ydo_A307 Crystal Structure Of The Bacillis Subtilis Hmg-Coa 5e-04
>pdb|3RMJ|A Chain A, Crystal Structure Of Truncated Alpha-Isopropylmalate Synthase From Neisseria Meningitidis Length = 370 Back     alignment and structure 
Iteration: 1

 Score =  395 bits (1015), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/382 (56%), Positives = 264/382 (69%), Gaps = 16/382 (4%)
Query: 71  PNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDF 130
           P  +   N V +FDTTLRDGEQSPGA +T +EK+ +ARQL KLGVDIIEAGF AAS  DF
Sbjct: 4   PFTMTQTNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDF 63
Query: 131 EAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIH 190
           EAV  IAK +  +          +C LSR  ERDI+ A EAV  A + RIHTFIATS IH
Sbjct: 64  EAVNAIAKTITKST---------VCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIH 114
Query: 191 MEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATT 250
           ME+KL+   +QV+E A   VK AR    DDVEFS EDA RS+  FL EI G VI+ GATT
Sbjct: 115 MEYKLKMKPKQVIEAAVKAVKIAREY-TDDVEFSCEDALRSEIDFLAEICGAVIEAGATT 173
Query: 251 LNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQV 310
           +NIPDTVG ++P +  +   ++ A TP    VV S HC NDLGL+ AN++A    GARQV
Sbjct: 174 INIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQV 233
Query: 311 EVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQP 370
           E T+NG+GERAGNAS+EE+VMA K R  H L GL TGI+T  IV +SK+V   TG  VQP
Sbjct: 234 ECTVNGLGERAGNASVEEIVMALKVR--HDLFGLETGIDTTQIVPSSKLVSTITGYPVQP 291
Query: 371 HKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDR 430
           +KAIVGANAF+HESGIHQDG+LKH+ TYEI+S E +G   +    + LGKLSGR+A K +
Sbjct: 292 NKAIVGANAFSHESGIHQDGVLKHRETYEIMSAESVGWATNR---LSLGKLSGRNAFKTK 348
Query: 431 LKELGYEL-NDEQLGTIFWHFK 451
           L +LG EL ++E L   F  FK
Sbjct: 349 LADLGIELESEEALNAAFARFK 370
>pdb|3EEG|A Chain A, Crystal Structure Of A 2-Isopropylmalate Synthase From Cytophaga Hutchinsonii Length = 325 Back     alignment and structure
>pdb|3EWB|X Chain X, Crystal Structure Of N-Terminal Domain Of Putative 2- Isopropylmalate Synthase From Listeria Monocytogenes Length = 293 Back     alignment and structure
>pdb|3IVT|A Chain A, Homocitrate Synthase Lys4 Bound To 2-Og Length = 423 Back     alignment and structure
>pdb|3IVS|A Chain A, Homocitrate Synthase Lys4 Length = 423 Back     alignment and structure
>pdb|2ZTJ|A Chain A, Crystal Structure Of Homocitrate Synthase From Thermus Thermophilus Complexed With Alpha-Ketoglutarate Length = 382 Back     alignment and structure
>pdb|3A9I|A Chain A, Crystal Structure Of Homocitrate Synthase From Thermus Thermophilus Complexed With Lys Length = 376 Back     alignment and structure
>pdb|3BLE|A Chain A, Crystal Structure Of The Catalytic Domain Of Licms In Complexed With Malonate Length = 337 Back     alignment and structure
>pdb|3HPS|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Leua Complexed With Ketoisocaproate (Kic) Length = 644 Back     alignment and structure
>pdb|3FIG|A Chain A, Crystal Structure Of Leucine-bound Leua From Mycobacterium Tuberculosis Length = 646 Back     alignment and structure
>pdb|1SR9|A Chain A, Crystal Structure Of Leua From Mycobacterium Tuberculosis Length = 644 Back     alignment and structure
>pdb|3U6W|A Chain A, Truncated M. Tuberculosis Leua (1-425) Complexed With Kiv Length = 427 Back     alignment and structure
>pdb|3HPX|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Leua Active Site Domain 1-425 (Truncation Mutant Delta:426-644) Length = 425 Back     alignment and structure
>pdb|2CW6|A Chain A, Crystal Structure Of Human Hmg-Coa Lyase: Insights Into Catalysis And The Molecular Basis For Hydroxymethylglutaric Aciduria Length = 298 Back     alignment and structure
>pdb|1YDO|A Chain A, Crystal Structure Of The Bacillis Subtilis Hmg-Coa Lyase, Northeast Structural Genomics Target Sr181. Length = 307 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 0.0
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 0.0
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 0.0
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 0.0
3ble_A337 Citramalate synthase from leptospira interrogans; 0.0
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 0.0
3hq1_A644 2-isopropylmalate synthase; LEUA, mycobacterium tu 0.0
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 1e-127
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 9e-85
3f6g_B127 Alpha-isopropylmalate synthase; licmsc, allosteric 2e-27
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 1e-11
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 3e-11
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 5e-11
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 3e-04
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 3e-04
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 5e-04
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Length = 370 Back     alignment and structure
 Score =  689 bits (1781), Expect = 0.0
 Identities = 215/382 (56%), Positives = 262/382 (68%), Gaps = 16/382 (4%)

Query: 71  PNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDF 130
           P  +   N V +FDTTLRDGEQSPGA +T +EK+ +ARQL KLGVDIIEAGF AAS  DF
Sbjct: 4   PFTMTQTNRVIIFDTTLRDGEQSPGAAMTKEEKIRVARQLEKLGVDIIEAGFAAASPGDF 63

Query: 131 EAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIH 190
           EAV  IAK +             +C LSR  ERDI+ A EAV  A + RIHTFIATS IH
Sbjct: 64  EAVNAIAKTITK---------STVCSLSRAIERDIRQAGEAVAPAPKKRIHTFIATSPIH 114

Query: 191 MEHKLRKTKQQVVEIARSMVKFARSLGCDDVEFSPEDAGRSDRKFLYEILGEVIKVGATT 250
           ME+KL+   +QV+E A   VK AR    DDVEFS EDA RS+  FL EI G VI+ GATT
Sbjct: 115 MEYKLKMKPKQVIEAAVKAVKIAREY-TDDVEFSCEDALRSEIDFLAEICGAVIEAGATT 173

Query: 251 LNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGARQV 310
           +NIPDTVG ++P +  +   ++ A TP    VV S HC NDLGL+ AN++A    GARQV
Sbjct: 174 INIPDTVGYSIPYKTEEFFRELIAKTPNGGKVVWSAHCHNDLGLAVANSLAALKGGARQV 233

Query: 311 EVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQP 370
           E T+NG+GERAGNAS+EE+VMA K R +    GL TGI+T  IV +SK+V   TG  VQP
Sbjct: 234 ECTVNGLGERAGNASVEEIVMALKVRHDLF--GLETGIDTTQIVPSSKLVSTITGYPVQP 291

Query: 371 HKAIVGANAFAHESGIHQDGMLKHKGTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDR 430
           +KAIVGANAF+HESGIHQDG+LKH+ TYEI+S E +G   +    + LGKLSGR+A K +
Sbjct: 292 NKAIVGANAFSHESGIHQDGVLKHRETYEIMSAESVGWATNR---LSLGKLSGRNAFKTK 348

Query: 431 LKELGYEL-NDEQLGTIFWHFK 451
           L +LG EL ++E L   F  FK
Sbjct: 349 LADLGIELESEEALNAAFARFK 370
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Length = 423 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Length = 325 Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Length = 382 Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Length = 337 Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Length = 293 Back     alignment and structure
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Length = 644 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Length = 345 Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Length = 320 Back     alignment and structure
>3f6g_B Alpha-isopropylmalate synthase; licmsc, allosteric regulation, feedback inhibition, selectivity, specificity, transferase; 2.00A {Leptospira interrogans} PDB: 3f6h_A Length = 127 Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Length = 307 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Length = 298 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Length = 295 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Length = 302 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Length = 539 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Length = 464 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query623
3hq1_A644 2-isopropylmalate synthase; LEUA, mycobacterium tu 100.0
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 100.0
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 100.0
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 100.0
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 100.0
3ble_A337 Citramalate synthase from leptospira interrogans; 100.0
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 100.0
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 100.0
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 100.0
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 100.0
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 100.0
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 100.0
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 100.0
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 100.0
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 100.0
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 100.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 100.0
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 100.0
3f6g_B127 Alpha-isopropylmalate synthase; licmsc, allosteric 99.95
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.8
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.32
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.13
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.13
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 98.07
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.85
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.6
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.32
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 97.25
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 96.89
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 96.84
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 96.07
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 95.97
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 95.67
3qxb_A316 Putative xylose isomerase; structural genomics, jo 95.65
3ngf_A269 AP endonuclease, family 2; structural genomics, se 95.5
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 95.46
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 95.36
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 95.35
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 95.32
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 95.27
3lmz_A257 Putative sugar isomerase; structural genomics, joi 95.12
2qw5_A335 Xylose isomerase-like TIM barrel; putative sugar p 95.11
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 95.1
3oa3_A288 Aldolase; structural genomics, seattle structural 95.1
3kws_A287 Putative sugar isomerase; structural genomics, joi 95.03
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 95.02
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 94.92
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 94.9
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 94.77
2qul_A290 D-tagatose 3-epimerase; beta/alpha barrel, isomera 94.72
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 94.72
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 94.62
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 94.5
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 94.41
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 94.38
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 94.23
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 94.1
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 94.1
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 93.97
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 93.93
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 93.9
1ujp_A271 Tryptophan synthase alpha chain; riken structural 93.87
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 93.85
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 93.82
1k77_A260 EC1530, hypothetical protein YGBM; TIM barrel, str 93.78
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 93.73
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 93.73
3obe_A305 Sugar phosphate isomerase/epimerase; structural ge 93.7
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 93.66
3txv_A450 Probable tagatose 6-phosphate kinase; structural g 93.62
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 93.58
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 93.48
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 93.33
3oa3_A288 Aldolase; structural genomics, seattle structural 93.31
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 93.16
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 93.09
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 92.92
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 92.9
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 92.83
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 92.76
2zvr_A290 Uncharacterized protein TM_0416; hyperthermophIle, 92.76
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 92.73
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 92.71
2hk0_A309 D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00 92.65
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 92.64
2x7v_A287 Probable endonuclease 4; DNA repair protein, metal 92.57
3m0z_A249 Putative aldolase; MCSG, PSI-2, structural genomic 92.52
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 92.49
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 92.48
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 92.38
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.36
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 92.07
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 91.94
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 91.91
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 91.86
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 91.83
3aal_A303 Probable endonuclease 4; endoiv, DNA repair, base 91.8
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 91.72
3dx5_A286 Uncharacterized protein ASBF; beta-alpha barrel, p 91.7
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 91.63
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 91.54
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 91.42
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 91.28
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 91.2
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 91.15
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 91.15
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 91.15
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 91.07
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 91.0
1yx1_A264 Hypothetical protein PA2260; structural genomics, 90.89
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 90.87
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 90.87
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 90.6
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 90.57
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 90.56
3bdk_A386 D-mannonate dehydratase; xylose isomerase-like TIM 90.51
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 90.49
1bxb_A387 Xylose isomerase; xylose metabolism; 2.20A {Thermu 90.39
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 90.29
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 90.26
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 90.21
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 90.19
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 90.18
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 90.07
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 90.06
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 90.02
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 90.01
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 90.01
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 89.97
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 89.94
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 89.9
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 89.86
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 89.82
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 89.78
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 89.77
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 89.77
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 89.72
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 89.65
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 89.53
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 89.51
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 89.47
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 89.44
2q02_A272 Putative cytoplasmic protein; structural genomics, 89.41
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 89.36
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 89.35
3m6y_A275 4-hydroxy-2-oxoglutarate aldolase; structural geno 89.34
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 89.29
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 89.23
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 89.2
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 89.18
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 89.16
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 89.13
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 89.11
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 89.06
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 89.04
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 88.96
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 88.9
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 88.88
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 88.86
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 88.78
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 88.75
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 88.74
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 88.7
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 88.65
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 88.63
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 88.61
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 88.59
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 88.59
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 88.57
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 88.44
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 88.41
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 88.23
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 88.16
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 88.07
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 87.96
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 87.9
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 87.87
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 87.86
1tz9_A367 Mannonate dehydratase; alpha-beta protein, structu 87.86
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 87.69
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 87.66
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, gl 87.52
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 87.37
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 87.29
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 87.22
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 87.17
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 87.12
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 87.04
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 87.02
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 86.93
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 86.87
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 86.58
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 86.57
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 86.51
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 86.51
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 86.44
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 86.44
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 86.35
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 86.2
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 86.15
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 86.04
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 86.02
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 85.99
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 85.96
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 85.93
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 85.87
1xim_A393 D-xylose isomerase; isomerase(intramolecular oxido 85.77
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 85.76
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 85.75
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 85.67
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 85.55
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 85.53
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 85.5
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 85.39
3ayv_A254 Putative uncharacterized protein TTHB071; structur 85.35
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 85.3
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 85.21
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 85.12
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 85.06
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 84.99
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 84.97
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 84.95
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 84.95
3l6u_A293 ABC-type sugar transport system periplasmic compo; 84.91
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 84.8
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 84.63
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 84.62
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 84.53
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 84.42
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 84.29
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 84.29
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 84.25
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 84.23
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 84.12
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 84.1
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 84.06
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 83.93
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 83.59
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 83.33
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 82.96
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 82.69
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 82.67
2yx0_A342 Radical SAM enzyme; predicted tRNA modification en 82.56
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 82.55
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 82.55
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 82.53
3khd_A520 Pyruvate kinase; malaria, structural genomics, str 82.46
3mcm_A442 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 82.44
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 82.36
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 82.34
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 82.34
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 82.27
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 82.21
3eol_A433 Isocitrate lyase; seattle structural center for in 82.17
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 82.09
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 82.08
4drs_A526 Pyruvate kinase; glycolysis, allosteric EN transfe 81.93
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 81.82
3lmz_A257 Putative sugar isomerase; structural genomics, joi 81.39
2zds_A340 Putative DNA-binding protein; TIM-barrel fold, str 81.36
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 81.24
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 80.97
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 80.72
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 80.69
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetyla 80.65
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 80.43
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 80.39
3u0h_A281 Xylose isomerase domain protein; structural genomi 80.18
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 80.06
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Back     alignment and structure
Probab=100.00  E-value=2.7e-117  Score=993.27  Aligned_cols=511  Identities=25%  Similarity=0.334  Sum_probs=445.9

Q ss_pred             CceEEEeCCCcccCCCCCCCCCHHHHHHHHHHHhHcCCCEEEEecCCCChhHHHHHHHHHHHhccccccCCCccceEEee
Q 006969           78 NYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGL  157 (623)
Q Consensus        78 ~~v~I~DtTLRDG~Q~~g~~~t~e~Kl~Ia~~L~~~Gvd~IEvGfP~~s~~d~e~v~~i~~~~~~~~~~~~~l~~~i~~~  157 (623)
                      +.++|+|||||||+|+++..|++++|++|+++|+++||++||+|||+++|+|+++++.|++...  ..+    .+.+++|
T Consensus        70 ~~p~i~DtTLRDGeQ~~g~~~s~eeKl~Ia~~L~~lGVd~IEaGfP~asp~D~e~v~~i~~~~l--~~~----~~~i~aL  143 (644)
T 3hq1_A           70 RAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPSASQTDFDFVREIIEQGA--IPD----DVTIQVL  143 (644)
T ss_dssp             SCCEEEECCCCCCGGGCSSCCCHHHHHHHHHHHHHHTCSEEEEECTTTCHHHHHHHHHHHHTTC--SCT----TCEEEEE
T ss_pred             CCCEEEECCCCccccCCCCCCCHHHHHHHHHHHHHcCCCEEEEeCCCCChhHHHHHHHHHhcCC--CCC----CeEEEEE
Confidence            5589999999999999999999999999999999999999999999999999999999988521  011    2589999


Q ss_pred             cccchhhHHHHHHHHhcCCCCEEEEEecCCHHHHHHHhCCCHHHHHHHHHHHHHHHHHcCCC------eEEEcccCCCCC
Q 006969          158 SRCNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLGCD------DVEFSPEDAGRS  231 (623)
Q Consensus       158 ~r~~~~dI~~a~eal~~a~~~~v~i~~~~Sd~h~~~~l~~t~ee~l~~~~~~v~~ak~~G~~------~V~f~~eda~r~  231 (623)
                      +|+++.||+++++++++++.++||+|+++||+|++++||+|++|+++++.++|+++++++..      .|+|++||++|+
T Consensus       144 ~r~~~~did~a~eal~~a~~~~Vhif~stSd~h~~~~l~~s~eevle~~~~~v~~a~~~~~~~~~~~~~v~fs~Edasrt  223 (644)
T 3hq1_A          144 TQCRPELIERTFQACSGAPRAIVHFYNSTSILQRRVVFRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGT  223 (644)
T ss_dssp             EESCHHHHHHHHHHHTTCSEEEEEEEEECCHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHSCSSEEEEEEEEETGGGS
T ss_pred             ecCCHhhHHHHHHHHhcCCCCEEEEEecCCHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhhhccCceEEEEEcCcccCCC
Confidence            99999999999999999999999999999999999999999999999999999988877532      278999999999


Q ss_pred             CHHHHHHHHHHHHHc---CCc---EEeecCcccccCHHHHHHHHHHHHHhCCCCcceeEEEeecCCcchHHHHHHHHHHh
Q 006969          232 DRKFLYEILGEVIKV---GAT---TLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACA  305 (623)
Q Consensus       232 d~e~l~~~~~~~~~a---Ga~---~I~l~DTvG~~~P~~v~~li~~l~~~~~~~~~v~i~~H~HND~GlAvANslaAv~a  305 (623)
                      +++|++++++++.++   |++   +|+||||+|+++|.+++++|+++++++|..++++|++|||||+|||+||+++|+++
T Consensus       224 d~dfl~ev~~aa~eaG~~Gad~~~~I~LpDTvG~~tP~~~~~li~~l~~~v~~~~~v~l~vH~HND~GlAvANslaAv~A  303 (644)
T 3hq1_A          224 ELEYAKQVCDAVGEVIAPTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDRGTAVAAAELGFAA  303 (644)
T ss_dssp             CHHHHHHHHHHHHHHHCCCSSSCEEEEEEESSCCSCHHHHHHHHHHHHHHSTTGGGEEEEEEEBCTTSCHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHhcCCCCCceeEEEecCCCcccCHHHHHHHHHHHHHhcccccCceEEEecCCCCCcHHHHHHHHHHh
Confidence            999999999999986   577   89999999999999999999999999987667999999999999999999999999


Q ss_pred             CCCEEEeccCCccCccCcccHHHHHHHHHhcccccccccccCCChhHHHHHHHHHHHHhCCCCCCCCcccCcchhhcccc
Q 006969          306 GARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGANAFAHESG  385 (623)
Q Consensus       306 GA~~Vd~Tv~GlGERaGNa~lEevv~~L~~~~~~~~~G~~t~idl~~L~~~s~~v~~~~g~~i~~~~pivG~~aF~h~sG  385 (623)
                      ||++||+|+||+|||+||++||+|+++|+.      +|+++++|+++|.+++++|++++|+++++|+||||+|||+||||
T Consensus       304 GA~~Vdgti~G~GERaGNa~LE~lv~~L~~------~Gi~tgidl~~L~~is~~ve~~~g~~v~~~kpiVG~~aFah~SG  377 (644)
T 3hq1_A          304 GADRIEGCLFGNGERTGNVCLVTLGLNLFS------RGVDPQIDFSNIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSG  377 (644)
T ss_dssp             TCCEEEEBGGGCSSTTCBCBHHHHHHHHHT------TTCCCSSCCTTHHHHHHHHHHHHSCCCCTTCTTTSTTTTEECCH
T ss_pred             CCCEEEecCCCCCccccCccHHHHHHHHHh------cccCCccCHHHHHHHHHHHHHHhCCCCCCCcccccccceeeccc
Confidence            999999999999999999999999999985      47899999999999999999999999999999999999999999


Q ss_pred             cccccccccC--------------------CccccCCCcccCCcccccceEeeeccccHHHHHHHHH-HcCCCCCHH---
Q 006969          386 IHQDGMLKHK--------------------GTYEIISPEDIGLERSSEAGIVLGKLSGRHALKDRLK-ELGYELNDE---  441 (623)
Q Consensus       386 iH~dgi~k~~--------------------~~Ye~~~Pe~vG~~r~~~~~i~lg~~SG~~~i~~~l~-~lG~~l~~~---  441 (623)
                      |||||++|++                    .+||||+|++||++|+  ..|+|||||||++|+++|+ ++||+++++   
T Consensus       378 iHqdailK~~~~~~~~~~~~~~~~~~~~w~~tYe~idPe~VG~~~~--~vi~v~~~SGk~~v~~~l~~~lG~~l~~~~~~  455 (644)
T 3hq1_A          378 SHQDAINKGLDAMKLDADAADCDVDDMLWQVPYLPIDPRDVGRTYE--AVIRVNSQSGKGGVAYIMKTDHGLSLPRRLQI  455 (644)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCCGGGSCCCCTTCSSCGGGGTCCCE--ECC-------CCCHHHHHHHHHCCCCCHHHHH
T ss_pred             ccHHHHhcCchhhhhhhhcccccccccccccccccCCHHHcCCcce--eEEeccCcCCHHHHHHHHHHhcCCCCChHHHH
Confidence            9999999997                    4999999999998763  3577999999999999998 799999985   


Q ss_pred             HHHHHHHHHHHH-HHhcCcCCHHHHHHHHHHHhcCCcceeEEeeEEEEecc--CCeeEEEEEEEccCCeEEEEEEEecCH
Q 006969          442 QLGTIFWHFKAV-AEQKKRVTDADLIALVSDEIFQPEVVWKLLDMQVTCGT--LGLSTATVKLMDANGEEHVACSTGTGP  518 (623)
Q Consensus       442 ~~~~~~~~iK~l-ad~~~~v~d~dl~~L~~~~~~~~~~~~~L~~~~v~~g~--~~~~~AtV~l~~~~G~~~~~~a~G~GP  518 (623)
                      ++.+++++++++ +++|++++++||+.|+.++|......|+|.++++.++.  .+.++|+|+|. ++|++++.+++||||
T Consensus       456 ~~~~~~~~~~d~~~~~g~ev~~~dl~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~v~l~-~~g~~~~~~a~GnGP  534 (644)
T 3hq1_A          456 EFSQVIQKIAEGTAGEGGEVSPKEMWDAFAEEYLAPVRPLERIRQHVDAADDDGGTTSITATVK-INGVETEISGSGNGP  534 (644)
T ss_dssp             HHHHHHHHC---------CCCHHHHHHHHHHHHTSCCSSEEEEEEEEECCSSTTCCEEEEEEEE-ETTEEEEEEEEESSH
T ss_pred             HHHHHHHHHHHhhhccCCcccHHHHHHHHHHHhccCCCceEEEEEEEEEeecCCCceEEEEEEE-ECCEEEEEEEecCCh
Confidence            566667777766 34678899999999999988766667999999998764  34689999997 799999999999999


Q ss_pred             HHHHHHHHHHhhCCCceeeeeEEeecCCCCCceEEEEEEEEecc---------CC------c-ccccCCCc--------c
Q 006969          519 VDSAYKAVDLIVKEPATLLEYSMNAVTAGIDAIATTRVLIRGEK---------SQ------L-STHASTGE--------T  574 (623)
Q Consensus       519 VdA~~~AL~~~~~~~v~L~dY~v~av~~G~dA~a~~~V~i~~~~---------~~------~-~~~~~~g~--------~  574 (623)
                      |||+++||+++ +.+++|.||++|++++|+||+|+++|+++.++         +.      + ...++.|+        .
T Consensus       535 VdA~~~Al~~~-~~~~~l~~y~~~a~~~G~da~a~~~v~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~  613 (644)
T 3hq1_A          535 LAAFVHALADV-GFDVAVLDYYEHAMSAGDDAQAAAYVEASVTIASPAQPGEAGRHASDPVTIASPAQPGEAGRHASDPV  613 (644)
T ss_dssp             HHHHHHHHHTT-TCEEEEEEEEEEESSSSTTCCEEEEEEEEEEC------------------------------------
T ss_pred             HHHHHHHHHHc-CCCceeeEEEEEccCCCCCceEEEEEEEEecccccccccccCcccccccccccccccccccccccccc
Confidence            99999999995 99999999999999999999999999998541         00      0 00011110        0


Q ss_pred             cCceEEEEEecccHHHHHHHHHHHHHHhhh
Q 006969          575 VQRTFSGTGAGMDIVVSSVKAYIGALNKML  604 (623)
Q Consensus       575 ~~~~~~g~G~~~DIi~AS~~A~i~A~N~l~  604 (623)
                      ..+.|||+|+|+||++||++||++|+||++
T Consensus       614 ~~~~~~g~g~~~di~~AS~~A~~~a~n~~~  643 (644)
T 3hq1_A          614 TSKTVWGVGIAPSITTASLRAVVSAVNRAA  643 (644)
T ss_dssp             -CEEEEEEEEESSHHHHHHHHHHHHHHHHC
T ss_pred             ccceEEEEEecccHHHHHHHHHHHHHHhhc
Confidence            123999999999999999999999999986
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3f6g_B Alpha-isopropylmalate synthase; licmsc, allosteric regulation, feedback inhibition, selectivity, specificity, transferase; 2.00A {Leptospira interrogans} PDB: 3f6h_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum} Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5 Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3-epimeras tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* Back     alignment and structure
>3m0z_A Putative aldolase; MCSG, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, lyase; HET: MSE; 1.20A {Klebsiella pneumoniae subsp} PDB: 3nzr_A 3lm7_A Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3bdk_A D-mannonate dehydratase; xylose isomerase-like TIM barrel, lyase; HET: DNO; 2.50A {Streptococcus suis} PDB: 3ban_A* 3dbn_A* 3fvm_A Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>1bxb_A Xylose isomerase; xylose metabolism; 2.20A {Thermus thermophilus} SCOP: c.1.15.3 PDB: 1bxc_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>3m6y_A 4-hydroxy-2-oxoglutarate aldolase; structural genomics, MCSG, lyase, PSI-2, protein structure initiative; HET: MSE; 1.45A {Bacillus cereus} PDB: 3n73_A 3mux_A Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>1tz9_A Mannonate dehydratase; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium; 2.90A {Enterococcus faecalis} SCOP: c.1.15.6 Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>1xim_A D-xylose isomerase; isomerase(intramolecular oxidoreductse); HET: XYL; 2.20A {Actinoplanes missouriensis} SCOP: c.1.15.3 PDB: 4xim_A 5xim_A* 6xim_A* 7xim_A 8xim_A* 9xim_A* 3xin_A 2xim_A* 5xin_A* 1xin_A* 1bhw_A* 2xin_A* 3xim_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3ayv_A Putative uncharacterized protein TTHB071; structural genomics, riken structural genomics/proteomics in RSGI, TIM barrel, unknown function; 1.85A {Thermus thermophilus} PDB: 3ayt_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3srk_A* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>4drs_A Pyruvate kinase; glycolysis, allosteric EN transferase; 2.50A {Cryptosporidium parvum} PDB: 3ma8_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 3srh_A 3srd_A 1zjh_A 4b2d_A* 4b2d_D* 3u2z_A* 3g2g_A 1t5a_A* 3bjt_A 4g1n_A* 3bjf_A* 3srf_C 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* ... Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 623
d1sr9a2310 c.1.10.5 (A:61-370) 2-isopropylmalate synthase Leu 7e-66
d1rqba2303 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N- 6e-52
d1nvma2289 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolas 8e-45
d1sr9a3152 d.270.1.1 (A:492-643) 2-isopropylmalate synthase L 4e-16
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 310 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: HMGL-like
domain: 2-isopropylmalate synthase LeuA, catalytic domain
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  216 bits (550), Expect = 7e-66
 Identities = 82/318 (25%), Positives = 132/318 (41%), Gaps = 25/318 (7%)

Query: 71  PNRIPDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDF 130
           P+R+ D          LRDG Q+    ++   K  +   L ++G   IE GFP+AS+ DF
Sbjct: 4   PDRVIDRA-PLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPSASQTDF 62

Query: 131 EAVRTIAKEVGNAVDAESGYVPVICGLSRCNERDIKTAWEAVKYAKRPRIHTFIATSGIH 190
           + VR I ++     D        I  L++C    I+  ++A   A R  +H + +TS + 
Sbjct: 63  DFVREIIEQGAIPDDVT------IQVLTQCRPELIERTFQACSGAPRAIVHFYNSTSILQ 116

Query: 191 MEHKLRKT----KQQVVEIARSMVKFARSLGCD--DVEFSPEDAGRSDRKFLYEILGEVI 244
                R      +    + AR  V+ A          E+SPE    ++ ++  ++   V 
Sbjct: 117 RRVVFRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGTELEYAKQVCDAVG 176

Query: 245 KV------GATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTAN 298
           +V           N+P TV +T P  +   I  +  N    E+V++S H  ND G + A 
Sbjct: 177 EVIAPTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDRGTAVAA 236

Query: 299 TIAGACAGARQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASK 358
              G  AGA ++E  + G GER GN  L  + +    R      G+   I+  +I    +
Sbjct: 237 AELGFAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSR------GVDPQIDFSNIDEIRR 290

Query: 359 MVEEYTGLHVQPHKAIVG 376
            VE    L V       G
Sbjct: 291 TVEYCNQLPVHERHPYGG 308
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Length = 303 Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Length = 289 Back     information, alignment and structure
>d1sr9a3 d.270.1.1 (A:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query623
d1sr9a2310 2-isopropylmalate synthase LeuA, catalytic domain 100.0
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 100.0
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 100.0
d1sr9a3152 2-isopropylmalate synthase LeuA, allosteric (dimer 99.92
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 96.76
d1sr9a155 2-isopropylmalate synthase LeuA, communication dom 96.7
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 96.59
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 96.19
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 95.78
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 95.52
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 94.62
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 94.23
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 94.22
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 93.51
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 93.1
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 92.96
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 92.69
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 92.51
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 92.06
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 91.94
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 91.7
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 91.45
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxI 91.21
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 90.86
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 90.39
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 89.24
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 89.13
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 88.89
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 88.21
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 87.66
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 87.64
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 87.23
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 87.14
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 87.02
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 86.89
d2g0wa1275 Hypothetical protein Lmo2234 {Listeria monocytogen 86.5
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 86.39
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 86.22
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 85.98
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 85.82
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 85.78
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 84.91
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 84.51
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 84.42
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 84.36
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 84.02
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 83.76
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 83.52
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 83.26
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {S 82.84
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 82.33
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 82.32
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 81.76
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 81.35
d1qtwa_285 Endonuclease IV {Escherichia coli [TaxId: 562]} 81.34
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 80.77
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: HMGL-like
domain: 2-isopropylmalate synthase LeuA, catalytic domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1e-53  Score=441.86  Aligned_cols=286  Identities=27%  Similarity=0.353  Sum_probs=250.6

Q ss_pred             eEEEeCCCcccCCCCCCCCCHHHHHHHHHHHhHcCCCEEEEecCCCChhHHHHHHHHHHHhccccccCCCccceEEeecc
Q 006969           80 VRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKEDFEAVRTIAKEVGNAVDAESGYVPVICGLSR  159 (623)
Q Consensus        80 v~I~DtTLRDG~Q~~g~~~t~e~Kl~Ia~~L~~~Gvd~IEvGfP~~s~~d~e~v~~i~~~~~~~~~~~~~l~~~i~~~~r  159 (623)
                      ..|+|||||||+|+++..|++++|++|++.|+++||++||+|||.++|+++++++.+.+.....  .    ......+.+
T Consensus        12 ~~~~D~tLRDG~Q~~~~~~~~~~k~~i~~~L~~aGv~~IEvG~p~~s~~~~~~~~~~~~~~~~~--~----~~~~~~~~~   85 (310)
T d1sr9a2          12 PLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPSASQTDFDFVREIIEQGAIP--D----DVTIQVLTQ   85 (310)
T ss_dssp             CEEEECTTTHHHHTCSSCCCHHHHHHHHHHHHHHTCSEEEEECTTTCHHHHHHHHHHHHTTCSC--T----TCEEEEEEE
T ss_pred             CeeeECCCCccCcCCCCCCCHHHHHHHHHHHHHcCCCEEEEeCCcCCHHHHHHHHHHHHhcccc--c----cceeeeeee
Confidence            4677999999999999999999999999999999999999999999999999999888753221  1    134556667


Q ss_pred             cchhhHHHHHHHHhcCCCCEEEEEecCCHHHHHHHhCCCHHHHHHHHHHHHHHHHHcC----CC--eEEEcccCCCCCCH
Q 006969          160 CNERDIKTAWEAVKYAKRPRIHTFIATSGIHMEHKLRKTKQQVVEIARSMVKFARSLG----CD--DVEFSPEDAGRSDR  233 (623)
Q Consensus       160 ~~~~dI~~a~eal~~a~~~~v~i~~~~Sd~h~~~~l~~t~ee~l~~~~~~v~~ak~~G----~~--~V~f~~eda~r~d~  233 (623)
                      .+..++....+...+.....+.++.+.+..|.....+++..+...............+    ..  .+.++.++.+++..
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (310)
T d1sr9a2          86 CRPELIERTFQACSGAPRAIVHFYNSTSILQRRVVFRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGTEL  165 (310)
T ss_dssp             SCHHHHHHHHHHHTTCSEEEEEEEEECCHHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHSCSSEEEEEEEEETGGGSCH
T ss_pred             echhhhHHHHHhhcCcceeeEEeecchhHHHHHHHhhccHHhhhhhhhhhhhHHHHHHHHhhcceeEEEEecccCCCCcH
Confidence            7777888777777766777888999999999999999999988887766655443321    11  35677889999999


Q ss_pred             HHHHHHHHHHHHc------CCcEEeecCcccccCHHHHHHHHHHHHHhCCCCcceeEEEeecCCcchHHHHHHHHHHhCC
Q 006969          234 KFLYEILGEVIKV------GATTLNIPDTVGITMPTEFGKLIADIKANTPGIENVVISTHCQNDLGLSTANTIAGACAGA  307 (623)
Q Consensus       234 e~l~~~~~~~~~a------Ga~~I~l~DTvG~~~P~~v~~li~~l~~~~~~~~~v~i~~H~HND~GlAvANslaAv~aGA  307 (623)
                      +.+.+.++.+.++      |++.|+|+||+|.++|.++.++++.+++++|+..+++|++|+|||+|||+||+++|+++||
T Consensus       166 ~~~~~~~~~~~~~~~~~~~g~~~i~l~Dt~G~~~P~~v~~~v~~~~~~~~~~~~i~i~~H~Hn~~Gla~AN~laA~~aG~  245 (310)
T d1sr9a2         166 EYAKQVCDAVGEVIAPTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDRGTAVAAAELGFAAGA  245 (310)
T ss_dssp             HHHHHHHHHHHHHHCCBTTBCEEEEEEESSCCSCHHHHHHHHHHHHHHSSSGGGEEEEEEEBCTTSCHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHhhhhhcCceEEeecccccccchhHHHHHHHHHHHhccCccceeeeeccccchhhhhHHHHHHHhccC
Confidence            9998888877664      7899999999999999999999999999998766789999999999999999999999999


Q ss_pred             CEEEeccCCccCccCcccHHHHHHHHHhcccccccccccCCChhHHHHHHHHHHHHhCCCCCCCCcccCc
Q 006969          308 RQVEVTINGIGERAGNASLEEVVMAFKCRGEHILGGLYTGINTRHIVMASKMVEEYTGLHVQPHKAIVGA  377 (623)
Q Consensus       308 ~~Vd~Tv~GlGERaGNa~lEevv~~L~~~~~~~~~G~~t~idl~~L~~~s~~v~~~~g~~i~~~~pivG~  377 (623)
                      ++||+|++|||||+||++||+++++|+.+      |+++++|+++|.++++++++++|+|+++|+||||+
T Consensus       246 ~~iD~si~GmG~~aGN~~tE~lv~~l~~~------g~~~~idl~~L~~~~~~v~~~~~~~~~~~~p~vG~  309 (310)
T d1sr9a2         246 DRIEGCLFGNGERTGNVCLVTLGLNLFSR------GVDPQIDFSNIDEIRRTVEYCNQLPVHERHPYGGD  309 (310)
T ss_dssp             CEEEEBGGGCSSTTCBCBHHHHHHHHHTT------TCCCSSCCTTHHHHHHHHHHHHSCCCCTTCTTTST
T ss_pred             CEEecCCcccccccCChhHHHHHHHHHhc------CCCCCcCHHHHHHHHHHHHHHhCCCCCCCCCCccC
Confidence            99999999999999999999999999863      78899999999999999999999999999999997
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1sr9a3 d.270.1.1 (A:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sr9a1 a.5.7.1 (A:437-491) 2-isopropylmalate synthase LeuA, communication domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure