Citrus Sinensis ID: 007039


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFPPLVRLLYSF
ccHHHHHHHHHHHccccEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccEEcccccccHHHHcccccccEEEEEEccccccccccccccccEEEEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccEEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccHHHHHccc
ccHHHHHHHHHHHcccccEEEEcccccccccccHHcccEEEEEEccccHHHccccccccccEEEEEEccccccccccHHHHHHccccEEEEccccccccccccHHHHHcccEEEcccccccccHHHHHHHccEEEEcccccHHHccHHHHHHHcccEEEcccccccccccHHHHHHHHcccEEEEcccccHHHHcccccHHHHHHHHHcccccEEEEEEccccccccccccccHcHHEEHHccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHEEEHcccccccHccccccccccccccEEEEEcccccHHHcccccccccHcccccccEEEEcccHHHHHHHcccccccccccccEEEEEcccccHcccccccHHcccccccEEEEcccccHHEccccccccHHHHccccccccccccccccccccccEEEEcccccHHHccccccccccccccccEEEEcccccHHHcccHHHHHHHHcccEEEEcccHcHHHHccccccccccccEEccccccccHHccHHHHcccccccccccccccccccccccccccccEEEEcccccHHHHcccccccccHHcccEEEEcccHHHHHccccccHHHccc
MHDVIHVVAVSIAteermfnvpnvaDLEKKMEETIqkdpiaislphrdiqelperlqcpnlqlfllytegngpmqvsdhffegmeglkvlqfpgigssslpssLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNinqlpveigqLTRLQlldlsncwwleviapnVISKLSQLEELymgngfsgwekveggsnasLVELERLtelttleievpdaeilppdfvsVELQRYKirigdgpedefdpllVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVhelddgegfprlkRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLRedqsfsnlriinvDSCRKLKYLFSFSMAKNLLRLqkvkvedcddlkmiigpdmekppttqgfieinaeddpvhqvtfprleeLELVSLTNIKKLWSDqfqgiyccqnltkvtvwscHRLKYLFSYSMVNSLGQLQHLEIRNcrsiegvvntttlggrdefkvfpklhylslhwlpklssfaspedvihtemqpqslfdekvrlpslevlhISEADKLRKIWHHQLASKSFSKLKKLKISGcnnllnifpplvrllysf
MHDVIHVVAvsiateermfnvpNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTtleievpdaeilppdfvSVELQRYKIRigdgpedefdpLLVKSEASRLMMLKGIKKvsilqendgTKMLLQRTEDLWLETLEGVQSVVHelddgegfprLKRLLVTDCSEILhivgsvrrvrCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSmaknllrlqkVKVEDCDDLKMiigpdmekppTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVntttlggrdeFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGcnnllnifpplvrllysf
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFpgigssslpsslgrliNLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASlvelerltelttleieVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQlasksfsklkklkISGCNNLLNIFPPLVRLLYSF
***VIHVVAVSIATEERMFNVPNVADL***********PIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPD******TQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHT******LFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFPPLVRLLY**
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCW***************LEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGP*******************PVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVN*********FKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFPPLVRLLYSF
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFPPLVRLLYSF
*HDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFPPLVRLLYSF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFPPLVRLLYSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query620 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.738 0.464 0.244 4e-17
O81825919 Probable disease resistan no no 0.724 0.488 0.256 1e-15
Q42484909 Disease resistance protei no no 0.608 0.414 0.237 2e-15
Q6DHL5238 Leucine-rich repeat-conta yes no 0.230 0.600 0.309 6e-06
Q7XA39988 Putative disease resistan N/A no 0.15 0.094 0.357 1e-05
C0LGP4 1010 Probable LRR receptor-lik no no 0.217 0.133 0.309 2e-05
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.229 0.101 0.345 2e-05
O35930 734 Platelet glycoprotein Ib no no 0.138 0.117 0.402 2e-05
Q96RT1 1412 Protein LAP2 OS=Homo sapi no no 0.219 0.096 0.342 2e-05
A4IIK1 997 Malignant fibrous histioc no no 0.322 0.200 0.286 3e-05
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 124/507 (24%), Positives = 228/507 (44%), Gaps = 49/507 (9%)

Query: 1   MHDVIHVVAVSIATEERMFNVPNVADLEKKMEETIQKDPIA-----ISLPHRDIQELPER 55
           MHDV+   A+ I +  +  +  +   +     + I++D +A     +SL +  ++ LP+ 
Sbjct: 462 MHDVVRDFAIWIMSSSQ--DDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDL 519

Query: 56  LQCPNLQLFLLYTEGNGPM-QVSDHFFEGMEGLKVLQFPGIGSSSLPS-SLGRLINLQTL 113
           ++   ++  +L  +GN  + +V   F +    L++L   G    S PS SL RL +L +L
Sbjct: 520 VEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSL 579

Query: 114 CLDWC-ELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPN 172
            L  C +L  + ++  L KLE+L L  ++I + P  + +L R + LDLS    LE I   
Sbjct: 580 FLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPAR 639

Query: 173 VISKLSQLEELYMGNGFSGWEKVEGGS---NASLVELERLTELTTLEIEVPDAEIL--PP 227
           V+S+LS LE L M +    W  V+G +    A++ E+  L  L  L I +  +  L    
Sbjct: 640 VVSRLSSLETLDMTSSHYRW-SVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKR 698

Query: 228 DFVSVELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTE 287
           +     L+++++ +G         L  + +  RL     I  +++ Q + G   LL  T 
Sbjct: 699 NTWIKRLKKFQLVVGSRY-----ILRTRHDKRRLT----ISHLNVSQVSIG--WLLAYTT 747

Query: 288 DLWLETLEGVQSVVHEL-DDGEGFPRLKRLLVTDC-----SEILHIVGSVRRVRCEVFPL 341
            L L   +G+++++ +L  D +GF  LK L + +      S +  +  +  +   ++  L
Sbjct: 748 SLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDL 807

Query: 342 LEALSLMFL--TNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKV 399
           L  L  + L   +LET    Q         L+II +  CRKL+ L        +  L+++
Sbjct: 808 LPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEI 867

Query: 400 KVEDCDDLKMIIGPDMEKPPTTQGFIEINAEDDPVHQVTFPRLEELELVSLTNIKKLWS- 458
           ++  CD L+ +    +   P       +   + P             LVS+ N  ++W  
Sbjct: 868 EISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLP------------NLVSICNWGEVWEC 915

Query: 459 -DQFQGIYCCQNLTKVTVWSCHRLKYL 484
            +Q + I+C Q        +C R+K +
Sbjct: 916 LEQVEVIHCNQLNCLPISSTCGRIKKI 942




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description
>sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query620
255563252 1603 Disease resistance protein RPS5, putativ 0.961 0.371 0.403 1e-107
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.961 0.453 0.395 1e-105
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.961 0.444 0.402 1e-100
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.966 0.243 0.393 1e-100
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.964 0.253 0.377 9e-98
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.961 0.445 0.394 6e-97
255574526 1232 Disease resistance protein RFL1, putativ 0.937 0.471 0.397 9e-89
359488103 1530 PREDICTED: disease resistance protein At 0.943 0.382 0.360 4e-87
359488027 1520 PREDICTED: disease resistance protein At 0.909 0.371 0.379 4e-86
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.946 0.346 0.360 7e-86
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  397 bits (1019), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 286/708 (40%), Positives = 388/708 (54%), Gaps = 112/708 (15%)

Query: 1    MHDVIHVVAVSIATE-ERMFNVPNVADLEKKMEETIQKDPIAISLPHRDIQELPERLQCP 59
            +HDV+  VA+SIA+  + +F V N A L++   + + K    ISLP+ DI  LPE L+CP
Sbjct: 466  IHDVVRDVAISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECP 525

Query: 60   NLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCE 119
             L+LFLL+T+ +  ++V D  FE  + L+VL F G+  SSLP SLG L NL TLCLDWC 
Sbjct: 526  ELELFLLFTQ-DISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCA 584

Query: 120  LADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQ 179
            L D+A IG+L  L ILS  +S+I +LP EI QLT+L+ LDLS+C  L+VI   +IS+L+Q
Sbjct: 585  LRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQ 644

Query: 180  LEELYMGNGFSGW--EKVEGGSNASLVELERLTELTTLEIEVPDAEILPPDFVSVELQRY 237
            LEELYM N F  W  + +    NASL ELE L  LTTLEI V DA+ILP D    +L+R+
Sbjct: 645  LEELYMNNSFDLWDVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERF 704

Query: 238  KIRIGDGPEDEFDPLLVKSEASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGV 297
            +I IGD      D        SR + LK +   SI  E+ G  +LL+ TEDL+L  ++G+
Sbjct: 705  RIFIGDVWSGTGD-----YGTSRTLKLK-LNTSSIHLEH-GLSILLEVTEDLYLAEVKGI 757

Query: 298  QSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETIC 357
            +SV+++L D +GF +LK L V +  EI +I+   RR  C  FP+LE+L L  L +LE IC
Sbjct: 758  KSVLYDL-DSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKIC 816

Query: 358  YSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIG----- 412
              +L    SFS LR + V  C +LK LFSFSM + LL+LQ++KV DC +L+ I+      
Sbjct: 817  CGKLTTG-SFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSED 875

Query: 413  --PDMEKPPTTQ------------------------------------GFIEINAE---D 431
               D E    TQ                                    G  EI  +    
Sbjct: 876  TDNDYEAVKLTQLCSLTLKRLPMFKSFCSKKKVSPISLRVQKQLTTDTGLKEIAPKGELG 935

Query: 432  DPV----HQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSY 487
            DP+        FP LE LEL S+   +K+  DQ   I    NL  + V  C  LKYLF+ 
Sbjct: 936  DPLPLFNEMFCFPNLENLELSSIA-CEKICDDQLSAI--SSNLMSLIVERCWNLKYLFTS 992

Query: 488  SMVNSLGQLQHLEIRNCRSIEGVVNTTTL--GGRDEFKVFPKLHYLSLHWLPKLSSFA-- 543
            S+V +L  L+ LE+ +C S+EG++    L    R+  K+FP+L +L L  LP ++ F   
Sbjct: 993  SLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFCDG 1052

Query: 544  -------------------------SPE-DVI--------------HTEMQPQSLFDEKV 563
                                     SP  D+I              HTE QP  LF+EKV
Sbjct: 1053 YPVEFSSLRKLLIENCPALNMFVSKSPSADMIESREAKGMNSEKNHHTETQP--LFNEKV 1110

Query: 564  RLPSLEVLHISEADKLRKIWHHQLASKSFSKLKKLKISGCNNLLNIFP 611
              PSLE + +S  D LR+IWH+QL + SF KLK ++I+GC  L  IFP
Sbjct: 1111 AFPSLEEIELSYIDNLRRIWHNQLDAGSFCKLKIMRINGCKKLRTIFP 1158




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query620
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.291 0.199 0.265 3.1e-13
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.312 0.196 0.263 4.9e-13
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.632 0.426 0.241 2.1e-11
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.233 0.104 0.313 5.6e-05
TAIR|locus:21750751068 AT5G41750 [Arabidopsis thalian 0.120 0.070 0.341 0.00019
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.279 0.178 0.269 0.00021
MGI|MGI:1333744 734 Gp1ba "glycoprotein 1b, alpha 0.122 0.103 0.432 0.00047
MGI|MGI:3045213 991 Tlr13 "toll-like receptor 13" 0.230 0.144 0.288 0.00085
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 146 (56.5 bits), Expect = 3.1e-13, Sum P(2) = 3.1e-13
 Identities = 52/196 (26%), Positives = 91/196 (46%)

Query:   354 ETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGP 413
             E + ++ L   ++ + L I  V S   LK LF F        +Q + VE+C++L     P
Sbjct:   654 EELGFADLEYLENLTTLGI-TVLSLETLKTLFEFGALHK--HIQHLHVEECNELLYFNLP 710

Query:   414 DMEKPPTTQGFIEINAEDDPVHQVT--------FPRLEELELVSLTNIKKLWSDQFQGIY 465
              +         + I +  D  + VT         P LE L L SL N+ ++W +      
Sbjct:   711 SLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQD- 769

Query:   466 CCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVF 525
             C +N+  + +  C++LK   + S V  L +L+ +E+ +CR IE +++       ++  +F
Sbjct:   770 CLRNIRCINISHCNKLK---NVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLF 826

Query:   526 PKLHYLSLHWLPKLSS 541
             P L  L    LP+L+S
Sbjct:   827 PSLKTLRTRDLPELNS 842


GO:0000166 "nucleotide binding" evidence=IEA
GO:0006952 "defense response" evidence=ISS;TAS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0016045 "detection of bacterium" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
GO:0050776 "regulation of immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
GO:0051707 "response to other organism" evidence=RCA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1333744 Gp1ba "glycoprotein 1b, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:3045213 Tlr13 "toll-like receptor 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 51.9 bits (124), Expect = 5e-07
 Identities = 37/104 (35%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 85  EGLKVLQFPGIGSSSLPSSLGRLINLQTLCLDWCELADIAA-IGQLKKLEILSLAYSNIN 143
             LK L        SLPS L  L NL+ L L + +L+D+   +  L  L  L L+ + I+
Sbjct: 140 SNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKIS 199

Query: 144 QLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGN 187
            LP EI  L+ L+ LDLSN   +E+   + +S L  L  L + N
Sbjct: 200 DLPPEIELLSALEELDLSNNSIIEL--LSSLSNLKNLSGLELSN 241


Length = 394

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 620
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.43
KOG4341483 consensus F-box protein containing LRR [General fu 99.43
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.38
KOG4237498 consensus Extracellular matrix protein slit, conta 99.33
KOG4341483 consensus F-box protein containing LRR [General fu 99.24
KOG4237498 consensus Extracellular matrix protein slit, conta 99.21
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.85
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.68
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
PRK15386 426 type III secretion protein GogB; Provisional 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.46
PLN03150623 hypothetical protein; Provisional 98.44
PLN03150623 hypothetical protein; Provisional 98.43
PRK15386 426 type III secretion protein GogB; Provisional 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.39
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.31
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.18
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.08
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.99
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.83
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.83
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.8
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.6
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.54
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.13
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.74
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.54
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.19
smart0037026 LRR Leucine-rich repeats, outliers. 89.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.55
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.0
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.39
smart0037026 LRR Leucine-rich repeats, outliers. 85.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.18
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.5e-33  Score=324.96  Aligned_cols=512  Identities=18%  Similarity=0.152  Sum_probs=323.5

Q ss_pred             cCCcEEEEccCCCCcCC-CCcC-CCCCccEEEcccCCCCCcccchHHHhcCCCCcEEEcCCCCCCC-ChhhhhcccCCcE
Q 007039           36 QKDPIAISLPHRDIQEL-PERL-QCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSS-LPSSLGRLINLQT  112 (620)
Q Consensus        36 ~~~lr~L~l~~~~~~~l-~~~~-~~~~Lr~L~l~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~~~~-lp~~~~~l~~L~~  112 (620)
                      ..+++.|+++++.+... +... .+++|++|++++|.. ...+|..++..+++||+|++++|.+.. +|.  +.+++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~-~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQL-SGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCcc-CCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCE
Confidence            35799999999987543 3333 899999999999987 668898887789999999999998764 553  46788999


Q ss_pred             EEccCCCCCC--hhhhcCCCCCCEEecCCCCCC-CCChhccCCCCCCEEeCCCCccccccchHHHhCCcCCcEEEcCCCc
Q 007039          113 LCLDWCELAD--IAAIGQLKKLEILSLAYSNIN-QLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYMGNGF  189 (620)
Q Consensus       113 L~L~~~~~~~--~~~i~~L~~L~~L~l~~~~l~-~lp~~i~~l~~L~~L~l~~~~~~~~~p~~~l~~l~~L~~L~l~~~~  189 (620)
                      |++++|.+..  |..++.+++|++|++++|.+. .+|..++++++|++|++++|.....+|.. ++++++|++|++++|.
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~  223 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNN  223 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCc
Confidence            9999988764  678889999999999998765 77888889999999999988855566765 8889999999998887


Q ss_pred             cccccccCCCCcchhhhcCCCCCCEEEeecCCCC-CCCCcccc-cCceEEEEEeCCCCCCCCCccccccccccEEEEecc
Q 007039          190 SGWEKVEGGSNASLVELERLTELTTLEIEVPDAE-ILPPDFVS-VELQRYKIRIGDGPEDEFDPLLVKSEASRLMMLKGI  267 (620)
Q Consensus       190 ~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~~~~~~~~-~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~  267 (620)
                      +..        ..+..++++++|++|++++|... .+|..+.. ++|+.|.+..+..... ....+..+++|+.|+++++
T Consensus       224 l~~--------~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~-~p~~l~~l~~L~~L~Ls~n  294 (968)
T PLN00113        224 LSG--------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGP-IPPSIFSLQKLISLDLSDN  294 (968)
T ss_pred             cCC--------cCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeecc-CchhHhhccCcCEEECcCC
Confidence            752        23456788888888888887754 45555544 7888888865432211 1122556778888888773


Q ss_pred             cccccccchhHHHHHhccccceecccccChhhhcccCCcCCCccccceEEeccCCCceEeeecccccccccccccchhcc
Q 007039          268 KKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTDCSEILHIVGSVRRVRCEVFPLLEALSL  347 (620)
Q Consensus       268 ~~~~~i~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l  347 (620)
                      .-...+  +.+ ...+++|+.|++.++.........   +..+++|+.|+++++.-...++     .....+++|+.|++
T Consensus       295 ~l~~~~--p~~-~~~l~~L~~L~l~~n~~~~~~~~~---~~~l~~L~~L~L~~n~l~~~~p-----~~l~~~~~L~~L~L  363 (968)
T PLN00113        295 SLSGEI--PEL-VIQLQNLEILHLFSNNFTGKIPVA---LTSLPRLQVLQLWSNKFSGEIP-----KNLGKHNNLTVLDL  363 (968)
T ss_pred             eeccCC--Chh-HcCCCCCcEEECCCCccCCcCChh---HhcCCCCCEEECcCCCCcCcCC-----hHHhCCCCCcEEEC
Confidence            221111  122 224567777777765543333222   3367778888887775322221     13445677777777


Q ss_pred             ccccCchhhhccCCCCCCcCCCCcEEEeecCCCceeecchhHHHHhcccceEEEEecCCcccccccCCCCCCCCccc-cc
Q 007039          348 MFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLFSFSMAKNLLRLQKVKVEDCDDLKMIIGPDMEKPPTTQGF-IE  426 (620)
Q Consensus       348 ~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~l~~~-~~  426 (620)
                      +++.--..++..    ...+++|+.|.+.++.-....|  ..+..+++|+.|++.+|..-... +......+.+... +.
T Consensus       364 s~n~l~~~~p~~----~~~~~~L~~L~l~~n~l~~~~p--~~~~~~~~L~~L~L~~n~l~~~~-p~~~~~l~~L~~L~Ls  436 (968)
T PLN00113        364 STNNLTGEIPEG----LCSSGNLFKLILFSNSLEGEIP--KSLGACRSLRRVRLQDNSFSGEL-PSEFTKLPLVYFLDIS  436 (968)
T ss_pred             CCCeeEeeCChh----HhCcCCCCEEECcCCEecccCC--HHHhCCCCCCEEECcCCEeeeEC-ChhHhcCCCCCEEECc
Confidence            765422222211    2334566666666543222222  23455666666666665432221 1112222222221 11


Q ss_pred             cccC--CCCccccccCccceEecCCccccccccccCCccccccCCccEEEEecCCCcceecchhhhcccCcccEEEEccc
Q 007039          427 INAE--DDPVHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTVWSCHRLKYLFSYSMVNSLGQLQHLEIRNC  504 (620)
Q Consensus       427 ~~~~--~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~C  504 (620)
                      .+.-  ........+++|+.|++.+|.-...++..     ...++|+.|++++| .++... +..+..+++|++|++++|
T Consensus       437 ~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~-----~~~~~L~~L~ls~n-~l~~~~-~~~~~~l~~L~~L~Ls~N  509 (968)
T PLN00113        437 NNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS-----FGSKRLENLDLSRN-QFSGAV-PRKLGSLSELMQLKLSEN  509 (968)
T ss_pred             CCcccCccChhhccCCCCcEEECcCceeeeecCcc-----cccccceEEECcCC-ccCCcc-ChhhhhhhccCEEECcCC
Confidence            1100  01112345778888888887543333221     13577888888886 444332 345667888888888887


Q ss_pred             ccccccccccccCCccceeeccccceeccccCCCCcccCCCcccccCCCCccccccccccCCCccEEEeccccchhhhcc
Q 007039          505 RSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQPQSLFDEKVRLPSLEVLHISEADKLRKIWH  584 (620)
Q Consensus       505 ~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~~~~l~~l~~~~~~l~~L~~L~i~~C~~L~~l~~  584 (620)
                      .-...+  ++....      +++|+.|+|+++.--.                .+|+.+..+++|++|++++|.-...+|.
T Consensus       510 ~l~~~~--p~~~~~------l~~L~~L~Ls~N~l~~----------------~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  565 (968)
T PLN00113        510 KLSGEI--PDELSS------CKKLVSLDLSHNQLSG----------------QIPASFSEMPVLSQLDLSQNQLSGEIPK  565 (968)
T ss_pred             cceeeC--ChHHcC------ccCCCEEECCCCcccc----------------cCChhHhCcccCCEEECCCCcccccCCh
Confidence            544333  333333      6778888887764221                3455667788899999998865445544


Q ss_pred             ccccCCcccCccEEEeccCcCcccccchh
Q 007039          585 HQLASKSFSKLKKLKISGCNNLLNIFPPL  613 (620)
Q Consensus       585 ~~~~~~~~~sL~~L~i~~C~~l~~~~p~~  613 (620)
                      .   +.++++|+.|++++|+-... +|..
T Consensus       566 ~---l~~l~~L~~l~ls~N~l~~~-~p~~  590 (968)
T PLN00113        566 N---LGNVESLVQVNISHNHLHGS-LPST  590 (968)
T ss_pred             h---HhcCcccCEEeccCCcceee-CCCc
Confidence            3   34678899999988875554 6643



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query620
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.55
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.55
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.52
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.18
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.92
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.91
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.81
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.68
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.87
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.78
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.54
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-35  Score=325.40  Aligned_cols=514  Identities=16%  Similarity=0.126  Sum_probs=317.2

Q ss_pred             cCccchhhhhhccccCCcEEEEccCCCCcCCCC--cCCCCCccEEEcccCCCCCcccchHHHhcCCCCcEEEcCCCCCCC
Q 007039           22 PNVADLEKKMEETIQKDPIAISLPHRDIQELPE--RLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSS   99 (620)
Q Consensus        22 ~~~~~~~~~~~~~~~~~lr~L~l~~~~~~~l~~--~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~l~~Lr~L~l~~~~~~~   99 (620)
                      ..+.+...+|. ++++++|+|++++|.+..++.  ..++++|++|++++|.+  ..+++..|.++++|++|++++|.+..
T Consensus        18 c~~~~l~~ip~-~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l--~~i~~~~~~~l~~L~~L~Ls~n~l~~   94 (606)
T 3vq2_A           18 CMDQKLSKVPD-DIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEI--ETIEDKAWHGLHHLSNLILTGNPIQS   94 (606)
T ss_dssp             CTTSCCSSCCT-TSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCC--CEECTTTTTTCTTCCEEECTTCCCCC
T ss_pred             ccCCCcccCCC-CCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCcc--cccCHHHhhchhhcCEeECCCCcccc
Confidence            34455555564 567899999999999987765  33899999999999987  56655557899999999999999988


Q ss_pred             C-hhhhhcccCCcEEEccCCCCCC-h-hhhcCCCCCCEEecCCCCCC--CCChhccCCCCCCEEeCCCCccccccchHHH
Q 007039          100 L-PSSLGRLINLQTLCLDWCELAD-I-AAIGQLKKLEILSLAYSNIN--QLPVEIGQLTRLQLLDLSNCWWLEVIAPNVI  174 (620)
Q Consensus       100 l-p~~~~~l~~L~~L~L~~~~~~~-~-~~i~~L~~L~~L~l~~~~l~--~lp~~i~~l~~L~~L~l~~~~~~~~~p~~~l  174 (620)
                      + |..|+++++|++|++++|.+.. + ..++++++|++|++++|.+.  .+|..++++++|++|++++|. +..+++..+
T Consensus        95 ~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~-l~~~~~~~~  173 (606)
T 3vq2_A           95 FSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNY-IQTITVNDL  173 (606)
T ss_dssp             CCTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSC-CCEECTTTT
T ss_pred             cChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCc-ceecChhhh
Confidence            7 7889999999999999999887 4 78999999999999999887  579999999999999999998 666665557


Q ss_pred             hCCcCCc----EEEcCCCccccccccCCCCcchhhhcCCCCCCEEEeecCCCC--CCCCcccc-cCceEEEEEeCCCCCC
Q 007039          175 SKLSQLE----ELYMGNGFSGWEKVEGGSNASLVELERLTELTTLEIEVPDAE--ILPPDFVS-VELQRYKIRIGDGPED  247 (620)
Q Consensus       175 ~~l~~L~----~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~--~~~~~~~~-~~L~~L~l~~~~~~~~  247 (620)
                      +.+.+|+    .|++++|.+...         ........+|+.|+++++...  ..+..+.. +.++.+.+........
T Consensus       174 ~~l~~L~~~l~~L~l~~n~l~~~---------~~~~~~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~  244 (606)
T 3vq2_A          174 QFLRENPQVNLSLDMSLNPIDFI---------QDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDE  244 (606)
T ss_dssp             HHHHHCTTCCCEEECTTCCCCEE---------CTTTTTTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEEEECCTTS
T ss_pred             hhhhccccccceeeccCCCccee---------CcccccCceeeeeeccCCccchhHHHHHhccccccccccccccccccC
Confidence            7776665    799999887622         122223347888999887643  22222233 6666666654332211


Q ss_pred             CCCc-----cccccc--cccEEEEecccccccccchhHHHHHhccccceecccccChhhhcccCCcCCCccccceEEecc
Q 007039          248 EFDP-----LLVKSE--ASRLMMLKGIKKVSILQENDGTKMLLQRTEDLWLETLEGVQSVVHELDDGEGFPRLKRLLVTD  320 (620)
Q Consensus       248 ~~~~-----~~~~~~--~L~~L~l~~~~~~~~i~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~~~~L~~L~l~~  320 (620)
                      ....     .+....  .++.+.+.......... +.  ...+++|+.|++.++... .+    +.+..+++|++|++++
T Consensus       245 ~~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~~~~-~~--~~~l~~L~~L~l~~~~~~-~l----~~l~~~~~L~~L~l~~  316 (606)
T 3vq2_A          245 RNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDI-VK--FHCLANVSAMSLAGVSIK-YL----EDVPKHFKWQSLSIIR  316 (606)
T ss_dssp             CCCSCCCGGGGTTGGGSEEEEEEECCCTTCCGGG-GS--CGGGTTCSEEEEESCCCC-CC----CCCCTTCCCSEEEEES
T ss_pred             CcccccChHHhhhhhhccHhheeccccccccccc-cc--cccCCCCCEEEecCccch-hh----hhccccccCCEEEccc
Confidence            1100     011111  34445553322211111 11  234567777777766532 22    1255778888888888


Q ss_pred             CCCceEeeecccccccccccccchhccccccCchhhhccCCCCCCcCCCCcEEEeecCCCceeec-chhHHHHhcccceE
Q 007039          321 CSEILHIVGSVRRVRCEVFPLLEALSLMFLTNLETICYSQLREDQSFSNLRIINVDSCRKLKYLF-SFSMAKNLLRLQKV  399 (620)
Q Consensus       321 ~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~-~~~~~~~l~~L~~L  399 (620)
                      |.- ..++      .. .+++|++|+++++.......      ...+++|+.|++.++ .++... ....+..+++|++|
T Consensus       317 n~l-~~lp------~~-~l~~L~~L~l~~n~~~~~~~------~~~l~~L~~L~ls~n-~l~~~~~~~~~~~~~~~L~~L  381 (606)
T 3vq2_A          317 CQL-KQFP------TL-DLPFLKSLTLTMNKGSISFK------KVALPSLSYLDLSRN-ALSFSGCCSYSDLGTNSLRHL  381 (606)
T ss_dssp             CCC-SSCC------CC-CCSSCCEEEEESCSSCEECC------CCCCTTCCEEECCSS-CEEEEEECCHHHHCCSCCCEE
T ss_pred             ccC-cccc------cC-CCCccceeeccCCcCccchh------hccCCCCCEEECcCC-ccCCCcchhhhhccCCcccEe
Confidence            853 3332      23 77888888888875544331      456788888888875 444442 12345778888888


Q ss_pred             EEEecCCcccccccCCCCCCCCcc-ccccccC--CCC-ccccccCccceEecCCccccccccccCCccccccCCccEEEE
Q 007039          400 KVEDCDDLKMIIGPDMEKPPTTQG-FIEINAE--DDP-VHQVTFPRLEELELVSLTNIKKLWSDQFQGIYCCQNLTKVTV  475 (620)
Q Consensus       400 ~l~~c~~l~~~~~~~~~~~~~l~~-~~~~~~~--~~~-~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~l~~L~~L~i  475 (620)
                      ++++|. +..++ ......+.++. .+..+.-  ... ..+..+++|+.|++++|. +.......   +..+++|++|++
T Consensus       382 ~L~~n~-l~~~~-~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~-l~~~~~~~---~~~l~~L~~L~l  455 (606)
T 3vq2_A          382 DLSFNG-AIIMS-ANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTN-TKIDFDGI---FLGLTSLNTLKM  455 (606)
T ss_dssp             ECCSCS-EEEEC-CCCTTCTTCCEEECTTSEEESTTTTTTTTTCTTCCEEECTTSC-CEECCTTT---TTTCTTCCEEEC
T ss_pred             ECCCCc-cccch-hhccCCCCCCeeECCCCccCCccChhhhhccccCCEEECcCCC-CCccchhh---hcCCCCCCEEEC
Confidence            888765 33333 22222233322 1111110  001 123445566666666652 32221111   224566666666


Q ss_pred             ecCCCcceecchhhhcccCcccEEEEcccccccccccccccCCccceeeccccceeccccCCCCcccCCCcccccCCCCc
Q 007039          476 WSCHRLKYLFSYSMVNSLGQLQHLEIRNCRSIEGVVNTTTLGGRDEFKVFPKLHYLSLHWLPKLSSFASPEDVIHTEMQP  555 (620)
Q Consensus       476 ~~C~~L~~l~~~~~~~~l~~L~~L~i~~C~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~~~~l  555 (620)
                      ++| .++....+..+..+++|++|++++|. ++.+ .++....      +++|++|+++++. ++.+             
T Consensus       456 ~~n-~l~~~~~~~~~~~l~~L~~L~Ls~n~-l~~~-~~~~~~~------l~~L~~L~Ls~N~-l~~~-------------  512 (606)
T 3vq2_A          456 AGN-SFKDNTLSNVFANTTNLTFLDLSKCQ-LEQI-SWGVFDT------LHRLQLLNMSHNN-LLFL-------------  512 (606)
T ss_dssp             TTC-EEGGGEECSCCTTCTTCCEEECTTSC-CCEE-CTTTTTT------CTTCCEEECCSSC-CSCE-------------
T ss_pred             CCC-cCCCcchHHhhccCCCCCEEECCCCc-CCcc-Chhhhcc------cccCCEEECCCCc-CCCc-------------
Confidence            664 33331113445556666666666653 3221 1222222      5566666666552 2221             


Q ss_pred             cccccccccCCCccEEEeccccchhhhccccccCCccc-CccEEEeccCcCc
Q 007039          556 QSLFDEKVRLPSLEVLHISEADKLRKIWHHQLASKSFS-KLKKLKISGCNNL  606 (620)
Q Consensus       556 ~~l~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~~~~-sL~~L~i~~C~~l  606 (620)
                        .|..+..+++|++|++++| .++.+|..   +.+++ +|++|++.++|-.
T Consensus       513 --~~~~~~~l~~L~~L~l~~N-~l~~~p~~---~~~l~~~L~~l~l~~N~~~  558 (606)
T 3vq2_A          513 --DSSHYNQLYSLSTLDCSFN-RIETSKGI---LQHFPKSLAFFNLTNNSVA  558 (606)
T ss_dssp             --EGGGTTTCTTCCEEECTTS-CCCCEESC---GGGSCTTCCEEECCSCCCC
T ss_pred             --CHHHccCCCcCCEEECCCC-cCcccCHh---HhhhcccCcEEEccCCCcc
Confidence              2556677888888888888 47777665   34565 5888888776543



>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 620
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 54.2 bits (129), Expect = 2e-08
 Identities = 23/121 (19%), Positives = 44/121 (36%), Gaps = 6/121 (4%)

Query: 42  ISLPHRDIQELPERLQCPNLQLFLLYTEGNGPMQVSDHFFEGMEGLKVLQFPGIGSSSLP 101
           + L    I  +        L       E N            ++ L  L       S + 
Sbjct: 268 LKLGANQISNISPLAGLTALTNL----ELNENQLEDISPISNLKNLTYLTLYFNNISDIS 323

Query: 102 SSLGRLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLS 161
             +  L  LQ L     +++D++++  L  +  LS  ++ I+ L   +  LTR+  L L+
Sbjct: 324 P-VSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLT-PLANLTRITQLGLN 381

Query: 162 N 162
           +
Sbjct: 382 D 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query620
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.33
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.89
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.7
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.39
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.84  E-value=2.4e-19  Score=181.68  Aligned_cols=81  Identities=21%  Similarity=0.300  Sum_probs=44.0

Q ss_pred             cccCCcEEEccCCCCCChhhhcCCCCCCEEecCCCCCCCCChhccCCCCCCEEeCCCCccccccchHHHhCCcCCcEEEc
Q 007039          106 RLINLQTLCLDWCELADIAAIGQLKKLEILSLAYSNINQLPVEIGQLTRLQLLDLSNCWWLEVIAPNVISKLSQLEELYM  185 (620)
Q Consensus       106 ~l~~L~~L~L~~~~~~~~~~i~~L~~L~~L~l~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~~p~~~l~~l~~L~~L~l  185 (620)
                      .+.+|++|+++++.+++++.++.|++|++|++++|.++.+| .++++++|++|++++|+ +..+++  ++++++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~-i~~i~~--l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQ-IADITP--LANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSC-CCCCGG--GTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCc-cccCCcccccccccccc-cccccc--cccccccccccc
Confidence            34455555555555555444555555555555555555554 25555555555555555 444443  555555555555


Q ss_pred             CCCcc
Q 007039          186 GNGFS  190 (620)
Q Consensus       186 ~~~~~  190 (620)
                      .++..
T Consensus       118 ~~~~~  122 (384)
T d2omza2         118 FNNQI  122 (384)
T ss_dssp             CSSCC
T ss_pred             ccccc
Confidence            55444



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure