Citrus Sinensis ID: 007072
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 619 | ||||||
| 224068448 | 868 | predicted protein [Populus trichocarpa] | 0.982 | 0.700 | 0.757 | 0.0 | |
| 359484270 | 866 | PREDICTED: tubulin--tyrosine ligase-like | 0.980 | 0.700 | 0.738 | 0.0 | |
| 147856096 | 870 | hypothetical protein VITISV_006435 [Viti | 0.987 | 0.702 | 0.738 | 0.0 | |
| 255550449 | 851 | protein binding protein, putative [Ricin | 0.959 | 0.698 | 0.721 | 0.0 | |
| 356556388 | 874 | PREDICTED: tubulin--tyrosine ligase-like | 0.983 | 0.696 | 0.685 | 0.0 | |
| 449452568 | 875 | PREDICTED: tubulin--tyrosine ligase-like | 0.990 | 0.700 | 0.676 | 0.0 | |
| 449500492 | 875 | PREDICTED: LOW QUALITY PROTEIN: tubulin- | 0.990 | 0.700 | 0.674 | 0.0 | |
| 356556390 | 855 | PREDICTED: tubulin--tyrosine ligase-like | 0.953 | 0.690 | 0.662 | 0.0 | |
| 297842531 | 854 | predicted protein [Arabidopsis lyrata su | 0.957 | 0.694 | 0.661 | 0.0 | |
| 79383745 | 855 | tubulin-tyrosine ligase [Arabidopsis tha | 0.961 | 0.695 | 0.653 | 0.0 |
| >gi|224068448|ref|XP_002326123.1| predicted protein [Populus trichocarpa] gi|222833316|gb|EEE71793.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 941 bits (2432), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 462/610 (75%), Positives = 529/610 (86%), Gaps = 2/610 (0%)
Query: 7 RIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLD 66
+I+ YEDFVKVHG+LLAASGLP++LHR+LF KLT+ETFD G+YF+++ C+DGRQRRL+L
Sbjct: 3 KIQAYEDFVKVHGILLAASGLPRTLHRKLFDKLTSETFDGGAYFQVDPCQDGRQRRLLLT 62
Query: 67 SQ-SMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVK 125
S SMPK+SNVFL+DHAWTFRLSDA+ QLQEVPGLAQRMA+LMCVD D ++D+EE+D
Sbjct: 63 SAASMPKDSNVFLIDHAWTFRLSDAYKQLQEVPGLAQRMAALMCVDIDSNSDVEEIDG-D 121
Query: 126 GVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQA 185
GV + +K NV DI+E+EI A E+G TVKWLELE+ DI DDMLLSL+LSSKFPDL A
Sbjct: 122 GVSRDTYSKLNVTDIVENEIGYAKERGYDTVKWLELEELDIDDDMLLSLDLSSKFPDLLA 181
Query: 186 LSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNF 245
LSLCGNKLE VEI+VQEVTKLKNL+ALWLNNNPVL+ CD CM D I +GCP LEIYNS F
Sbjct: 182 LSLCGNKLENVEIVVQEVTKLKNLKALWLNNNPVLENCDGCMADTIFKGCPGLEIYNSCF 241
Query: 246 TINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSL 305
T NFGEWALGFCG VY+KDNP + + PLQSVTSLDLSNR IH+L+NKAFSP EMPSL
Sbjct: 242 TSNFGEWALGFCGGVYEKDNPCPIHQDNHPLQSVTSLDLSNRSIHSLINKAFSPVEMPSL 301
Query: 306 SHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVT 365
SHLNIRGNPL+QNSV EL +VLKGF LQ+L VD+PGPLGESAIEILES+P L LNGV
Sbjct: 302 SHLNIRGNPLKQNSVSELFKVLKGFTSLQTLEVDLPGPLGESAIEILESVPNLSQLNGVN 361
Query: 366 ASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYV 425
SKILE G HVID++LQPRLPEW+A++PLADRV++AMWLYLMTYRLA+EEKIDETSVWYV
Sbjct: 362 VSKILETGNHVIDAVLQPRLPEWTAEEPLADRVINAMWLYLMTYRLADEEKIDETSVWYV 421
Query: 426 MDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGE 485
MDELGSA+RHSDEPNFRVAPFLFMPEG L SAVS+SILWPIQNV DECTRDFL+GIGE
Sbjct: 422 MDELGSALRHSDEPNFRVAPFLFMPEGNLDSAVSYSILWPIQNVQNGDECTRDFLFGIGE 481
Query: 486 DKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYT 545
DKQRSARLTA+FHTPQ YFI EYEK QKLQ KS + P KSS++ +L R+DGCA RVYT
Sbjct: 482 DKQRSARLTAYFHTPQYYFIQEYEKFHQKLQSKSSTPLPVKSSSSRTLRRTDGCALRVYT 541
Query: 546 DIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMK 605
D+P VE FLTRTEF+ITTE KDADIIWT +QVD+D+K A GITDQQY+NQFPFE+CLVMK
Sbjct: 542 DLPQVEGFLTRTEFIITTELKDADIIWTGMQVDDDVKRAAGITDQQYINQFPFEACLVMK 601
Query: 606 HHLAETVQKV 615
HHLAET+QK
Sbjct: 602 HHLAETIQKA 611
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359484270|ref|XP_002278055.2| PREDICTED: tubulin--tyrosine ligase-like protein 12-like [Vitis vinifera] gi|297738564|emb|CBI27809.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147856096|emb|CAN82450.1| hypothetical protein VITISV_006435 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255550449|ref|XP_002516275.1| protein binding protein, putative [Ricinus communis] gi|223544761|gb|EEF46277.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356556388|ref|XP_003546508.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452568|ref|XP_004144031.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449500492|ref|XP_004161112.1| PREDICTED: LOW QUALITY PROTEIN: tubulin--tyrosine ligase-like protein 12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356556390|ref|XP_003546509.1| PREDICTED: tubulin--tyrosine ligase-like protein 12-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297842531|ref|XP_002889147.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334988|gb|EFH65406.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|79383745|ref|NP_177879.3| tubulin-tyrosine ligase [Arabidopsis thaliana] gi|47550675|gb|AAT35236.1| At1g77550 [Arabidopsis thaliana] gi|110741647|dbj|BAE98770.1| hypothetical protein [Arabidopsis thaliana] gi|332197871|gb|AEE35992.1| tubulin-tyrosine ligase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 619 | ||||||
| TAIR|locus:2204745 | 855 | AT1G77550 [Arabidopsis thalian | 0.961 | 0.695 | 0.653 | 6.6e-216 | |
| ZFIN|ZDB-GENE-040426-697 | 625 | ttll12 "tubulin tyrosine ligas | 0.340 | 0.337 | 0.327 | 2e-36 | |
| MGI|MGI:3039573 | 639 | Ttll12 "tubulin tyrosine ligas | 0.336 | 0.325 | 0.325 | 1e-35 | |
| UNIPROTKB|F1NZA1 | 627 | TTLL12 "Uncharacterized protei | 0.339 | 0.334 | 0.309 | 4.2e-35 | |
| FB|FBgn0033225 | 626 | CG1550 [Drosophila melanogaste | 0.345 | 0.341 | 0.293 | 8.3e-35 | |
| UNIPROTKB|F1N5K2 | 655 | TTLL12 "Uncharacterized protei | 0.353 | 0.334 | 0.310 | 1.9e-34 | |
| UNIPROTKB|F1PQD3 | 682 | TTLL12 "Uncharacterized protei | 0.353 | 0.321 | 0.310 | 2e-34 | |
| RGD|1305319 | 639 | Ttll12 "tubulin tyrosine ligas | 0.340 | 0.330 | 0.307 | 2.5e-34 | |
| UNIPROTKB|Q14166 | 644 | TTLL12 "Tubulin--tyrosine liga | 0.336 | 0.322 | 0.312 | 3.5e-34 | |
| WB|WBGene00008405 | 662 | ttll-12 [Caenorhabditis elegan | 0.447 | 0.418 | 0.278 | 3.5e-30 |
| TAIR|locus:2204745 AT1G77550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2086 (739.4 bits), Expect = 6.6e-216, P = 6.6e-216
Identities = 398/609 (65%), Positives = 490/609 (80%)
Query: 6 NRIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVL 65
++IE+++DFVKVHG+LLAASGLP L+ +LF+KL +TFD G YF+IE CED ++R+L+L
Sbjct: 2 SKIESFDDFVKVHGILLAASGLPPKLYPRLFEKLAYDTFDGGDYFQIESCEDDQRRKLLL 61
Query: 66 DSQSMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVK 125
++SMPK+S+VFLVDHAWTFRL DA+ QL+E+PGLA+RMASLM VD D+D EEV
Sbjct: 62 TAESMPKDSDVFLVDHAWTFRLPDAYKQLKEIPGLAERMASLMSVDIDVDAGEEEV---- 117
Query: 126 GVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQA 185
+ +V+ I+++EI A +KG +++WLELE + DD LLSL+L SKF DL A
Sbjct: 118 ------AEELSVDQIIDNEIRYAADKGYDSLRWLELEGLGV-DDSLLSLHLPSKFQDLVA 170
Query: 186 LSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNF 245
LSL GNK+E+ ++++QE+ K KNL+ALWLN+NPVL+K + M D ILQGCP LEIYNS F
Sbjct: 171 LSLIGNKIESADVVIQEIVKFKNLKALWLNDNPVLQKSERQMADEILQGCPSLEIYNSCF 230
Query: 246 TINFGEWALGFCGEVYDKDNPSSLCLR-DRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPS 304
T N+G WALGFCG+++ KDNP C++ D+PL +VTSLDLSNR IHNLVNKAFS EMP
Sbjct: 231 TPNYGLWALGFCGDIFGKDNPG--CVQQDQPLCNVTSLDLSNRSIHNLVNKAFSVHEMPL 288
Query: 305 LSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGV 364
LSHLNIRGN L+QNSV ELLEVLK FP L SL VDIPGPLG +A+EILESL L LNGV
Sbjct: 289 LSHLNIRGNSLDQNSVGELLEVLKLFPSLSSLEVDIPGPLGINALEILESLSNLSLLNGV 348
Query: 365 TASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWY 424
+KILE GKHV+DSMLQPR+PE + D L DRVL AMWLY + YRLA++EK+DETS+WY
Sbjct: 349 DTAKILETGKHVVDSMLQPRIPELNPDDTLVDRVLDAMWLYALNYRLADDEKLDETSLWY 408
Query: 425 VMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIG 484
VMDELGSA+RHSDEPNF+VAPFLFMP GKL SAVS+S++WPI++ K DECTRDFL GIG
Sbjct: 409 VMDELGSALRHSDEPNFKVAPFLFMPSGKLESAVSYSVMWPIKHSQKGDECTRDFLSGIG 468
Query: 485 EDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVY 544
EDKQRSARLTAWF TP++YFI+E+EK+ QKLQ K+ P+ S + S+ SDG VY
Sbjct: 469 EDKQRSARLTAWFQTPENYFIHEFEKYQQKLQAKAFESKPSNPSVSRSIQHSDGSPLLVY 528
Query: 545 TDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVM 604
TD+P VEEFLTR EFVIT EPKDADI+WTS+QVD+++K GITD QY+NQFPFE+CLVM
Sbjct: 529 TDLPQVEEFLTRPEFVITNEPKDADILWTSVQVDDELKKEVGITDDQYINQFPFEACLVM 588
Query: 605 KHHLAETVQ 613
KHHLAET+Q
Sbjct: 589 KHHLAETIQ 597
|
|
| ZFIN|ZDB-GENE-040426-697 ttll12 "tubulin tyrosine ligase-like family, member 12" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3039573 Ttll12 "tubulin tyrosine ligase-like family, member 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZA1 TTLL12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033225 CG1550 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N5K2 TTLL12 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PQD3 TTLL12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1305319 Ttll12 "tubulin tyrosine ligase-like family, member 12" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14166 TTLL12 "Tubulin--tyrosine ligase-like protein 12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008405 ttll-12 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_scaffold_28000022 | hypothetical protein (868 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 619 | |||
| KOG2155 | 631 | consensus Tubulin-tyrosine ligase-related protein | 100.0 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.87 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.28 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.27 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.22 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.2 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.14 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 99.11 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.09 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.03 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.01 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.93 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.75 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.71 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.7 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.7 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.68 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.6 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.56 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.56 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.43 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.42 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.42 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.41 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.35 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.35 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.34 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.34 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.28 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.26 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.25 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.01 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.97 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.93 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.91 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.79 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.77 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.77 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.71 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.64 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.63 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.56 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.54 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.5 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.47 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.42 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.28 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.25 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.24 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.18 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.17 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.08 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.08 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 96.88 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.79 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.68 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.62 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 96.59 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.5 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.49 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.98 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.77 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.54 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 95.34 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.24 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 95.13 | |
| smart00317 | 116 | SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) | 94.99 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.52 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 94.5 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 93.54 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 93.29 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 91.73 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 91.48 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 90.4 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 90.4 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 90.12 | |
| KOG2155 | 631 | consensus Tubulin-tyrosine ligase-related protein | 88.77 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 88.62 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 88.04 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 86.9 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 85.69 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 85.67 | |
| KOG1083 | 1306 | consensus Putative transcription factor ASH1/LIN-5 | 82.56 |
| >KOG2155 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.8e-94 Score=749.98 Aligned_cols=379 Identities=35% Similarity=0.577 Sum_probs=315.8
Q ss_pred ccccccHHHHHHHhHHHHhcCCCCHHHHHHHHHHhhhcccCCCCceeEEEccCCceeEEEEecC--CCC--CCCCeEeec
Q 007072 5 SNRIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLDSQ--SMP--KESNVFLVD 80 (619)
Q Consensus 5 ~~~~~~~~~f~~~H~~~l~~~~~P~~l~~~L~~kl~~~~fDag~~F~i~~~~~~~~~~~vv~~~--~l~--~~~~vflid 80 (619)
+.++++|.+|+++||+||+||||||+||++||+||++|+||||++|||+.++++++-.-.+|++ .++ +..++|+++
T Consensus 1 ~~~a~~f~~F~~~Hg~~L~ASgvPp~lw~rL~~KL~~~tFDaGd~FqI~~~e~~~dEe~e~arel~~~q~nd~~~~~~l~ 80 (631)
T KOG2155|consen 1 DRSAYPFSTFLDQHGGQLNASGVPPELWHRLYKKLSDQTFDAGDHFQIICEENEDDEETEFARELEDLQNNDEDNIFLLD 80 (631)
T ss_pred CCccccHHHHHHhcccccccCCCCHHHHHHHHHHhhhcccCCcCeeeEEEecccchhHHHHHHHHHhccCCCccceeeee
Confidence 4678999999999999999999999999999999999999999999999887643323335665 444 678899999
Q ss_pred cceeccchHHHHhhhcCcchHHHHHhhhcccCCCCchhhhhhhhhcccccCCCCcchhHHHHhhhhcccccCCCceeeee
Q 007072 81 HAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENGTKSNVEDILESEIHNATEKGDGTVKWLE 160 (619)
Q Consensus 81 h~~tf~~~~a~~~L~~vp~L~~Rm~~lm~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~g~~~l~~L~ 160 (619)
|+.+|--.+|++...-..||.+|+++++++|.+...+.++ . ++++
T Consensus 81 ~~~s~~~ESa~~c~~pn~gl~~~~~~iFgiD~~~t~~vd~---t------------~~~l-------------------- 125 (631)
T KOG2155|consen 81 HFMSFSSESARKCVEPNEGLVERLAGIFGIDTDSTEEVDE---T------------VEKL-------------------- 125 (631)
T ss_pred eeeeeehhhhhcccCCCccHHHhhccccccCCccceeccH---H------------HHHh--------------------
Confidence 9999999999999999999999999999999665544221 0 1100
Q ss_pred cccCCCCccccccccccCCCCCccEeecCCCcccchhhHHHHHhcccccceeecCCCcccccccchhhhHHhhcCCcccc
Q 007072 161 LEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEI 240 (619)
Q Consensus 161 Ls~~~I~~~~li~l~l~~~~p~L~~L~Ls~NkL~~~~~v~~~l~~L~~Lk~L~Ls~Npi~~~~~~~~~~~il~~lP~Lei 240 (619)
+. +++
T Consensus 126 ------e~--------------------------~v~------------------------------------------- 130 (631)
T KOG2155|consen 126 ------ET--------------------------SVE------------------------------------------- 130 (631)
T ss_pred ------hc--------------------------cch-------------------------------------------
Confidence 00 000
Q ss_pred cccccccccccccccccccccCCCCCCccccCCCcCCcccccccCccccccCcccccCCCCCCCCcccccCCCCCCccch
Q 007072 241 YNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSV 320 (619)
Q Consensus 241 Ln~~~T~n~~~~~l~fc~~~~~~~~p~~l~~~~~~L~~L~~LdLS~N~I~~Lp~~~f~~~~L~~L~~LnLs~N~i~~i~~ 320 (619)
T Consensus 131 -------------------------------------------------------------------------------- 130 (631)
T KOG2155|consen 131 -------------------------------------------------------------------------------- 130 (631)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred HHHHHHHhCCCCCccccccCCCCCCchhHHHhhhcCccccccCccchhhhccCcceeecccCCCCCCCCCChhhHHHHHH
Q 007072 321 RELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLS 400 (619)
Q Consensus 321 ~~l~~~l~~~~~L~sL~ld~p~~l~~~~~~il~~lp~L~~LNg~~~s~~~~~~~~~~~~~~~~~~~~~~~~e~~~~rV~~ 400 (619)
..+.+.+.++..|+|.+ .++++++++++| .|+-.|..++.++|++
T Consensus 131 ----------------------------~e~~e~l~~~s~l~G~~------~~~~~vd~~l~~-~~~~~P~~elv~~VL~ 175 (631)
T KOG2155|consen 131 ----------------------------KEEAEHLKKISSLTGNL------PRHESVDARLSS-YSVDDPKNELVEKVLK 175 (631)
T ss_pred ----------------------------hhHHHHHHHHHHhhCCC------CcccchhhccCc-ccccCcchHHHHHHHH
Confidence 12223344444555555 257788888888 7888888999999999
Q ss_pred HHHhhhceEEcccccccCcceeeEeccccccccccCCCCCceeeceeeccCCCCCCceEEEEEeeccccCCCCccccccc
Q 007072 401 AMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFL 480 (619)
Q Consensus 401 ~mWk~~~tY~l~~~~~~~~~p~WYvmDE~GsaI~HSd~PN~r~~Pf~~~p~~~~~~~~sySllwPi~di~~gdevTRD~~ 480 (619)
+||+|+|||+++++++.+++|+|||||||||||||||+||||+|||||||++ +|||||||++++..||||||||+
T Consensus 176 amWky~qtY~la~~~~~ek~svWYvMDefGsrvrHsdePnf~~aPf~fmPq~-----vaYsimwp~k~~~tgeE~trDfa 250 (631)
T KOG2155|consen 176 AMWKYSQTYSLAYQGEIEKKSVWYVMDEFGSRVRHSDEPNFRIAPFMFMPQN-----VAYSIMWPTKPVNTGEEITRDFA 250 (631)
T ss_pred HHHHhhheeecccCccccccceeEEHhhhhhhhccCCCCcceeeeheecchh-----cceeEEeeccCCCCchHHHHHHh
Confidence 9999999999999999999999999999999999999999999999999998 99999999999999999999999
Q ss_pred cCCCCccchhhhccccccCChhhhHHHHHHHhhhhcccccCCCCCCCCCCccccCCCCCceEEEechhHHHhhcCCCCEE
Q 007072 481 YGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYTDIPYVEEFLTRTEFV 560 (619)
Q Consensus 481 ~~~~~~~~R~a~L~pw~~~p~~~f~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~lkVytd~~~v~~~Lt~~~F~ 560 (619)
+|++++++|+|+|+||+.+|+.+|..++.++-+...+.+.... .....++.+ |+++|||||.+||.+|||+|+|+
T Consensus 251 sg~~~p~~Rk~~l~pWa~tde~~~~~~~~e~~qa~~~e~k~s~---p~~s~pi~h--g~~~kVYtD~~Qv~e~Lt~p~f~ 325 (631)
T KOG2155|consen 251 SGVIHPEWRKYILQPWAATDETMIPDATLEYFQATEQETKQSA---PFTSLPILH--GRKIKVYTDDTQVTEHLTNPKFE 325 (631)
T ss_pred hcCCCHHHHHHHhccccCCCcccCCchHHHHHHHHHHhccccC---Ccccccccc--CceeEEEcCcHHHHHhccCCceE
Confidence 9999999999999999999888887765443333222221111 111123333 78999999999999999999999
Q ss_pred ecCCCCCccEEEEecccchhHHHhhCCCCceeeccCCCCchhhhhhHHHHHHHhhhcCC
Q 007072 561 ITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKVRKIN 619 (619)
Q Consensus 561 lvd~~~eADIiW~~~h~~~d~k~~~~~~p~~~iNQFP~E~~lt~Kd~La~~~~~~~~~~ 619 (619)
+|+++++|||+|+++||+ |||++++++|++||||||||+|||||||||++++|++|-|
T Consensus 326 ~t~~~kdADilw~~~hf~-Dykkls~e~p~~~iNQFPfE~cltvKd~LA~~a~r~~g~~ 383 (631)
T KOG2155|consen 326 YTDDIKDADILWMIKHFH-DYKKLSEENPCGMINQFPFESCLTVKDLLAACAMRDPGKN 383 (631)
T ss_pred eccCccccceeeehhhHH-HHHHHhccCCcceeccCchHHHHHHHHHHHHHHhhcCCCC
Confidence 999999999999999997 8999999999999999999999999999999999999854
|
|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00317 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2155 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1083 consensus Putative transcription factor ASH1/LIN-59 [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 619 | |||
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-07 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 9e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 9e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-06 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-07 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 8e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 6e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 6e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 6e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 1e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 1e-05 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 2e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 3e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 6e-05 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-05 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 7e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 6e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 3e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 7e-04 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 5e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 9e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 9e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 9e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-04 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 5e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 7e-04 |
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
Score = 55.0 bits (133), Expect = 5e-08
Identities = 31/182 (17%), Positives = 67/182 (36%), Gaps = 43/182 (23%)
Query: 171 LLSLNLS-------------SKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNN 217
L L++ +L+ L L + +ET + ++ L +L++L L+ N
Sbjct: 327 LTHLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYN 386
Query: 218 PVLKKCDHCMEDAILQGCPKLE---IYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDR 274
++ + CP+LE + + + +
Sbjct: 387 EP-----LSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQ------------------- 422
Query: 275 PLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQ 334
L + L+LS+ + + F +P+L HLN++GN + ++ + L+ L+
Sbjct: 423 NLHLLKVLNLSHSLLDISSEQLFD--GLPALQHLNLQGNHFPKGNI-QKTNSLQTLGRLE 479
Query: 335 SL 336
L
Sbjct: 480 IL 481
|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 619 | |||
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.58 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.55 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.52 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.51 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.51 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.5 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.49 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.49 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.48 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.47 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.45 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.44 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.44 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.44 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.44 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.43 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.43 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.43 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.42 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.42 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.42 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.42 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.42 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.42 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.42 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.41 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.41 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.41 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.41 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.41 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.41 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.4 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.39 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.38 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.38 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.38 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.37 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.37 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.37 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.37 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.36 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.36 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.36 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.35 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.34 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.34 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.34 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.34 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.33 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.33 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.32 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.32 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.32 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.31 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.3 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.3 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.3 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.29 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.29 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.29 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.29 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.29 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.29 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.28 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.28 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.28 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.28 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.28 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.27 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.26 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.26 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.26 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.25 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.25 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.25 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.25 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.25 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.25 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.24 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.24 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.24 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.24 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.23 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.23 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.23 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.23 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.22 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.21 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.21 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.21 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.2 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.19 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.19 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.19 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.18 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.18 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.17 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.16 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.15 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.14 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.13 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.13 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.13 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.13 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.12 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.12 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.11 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.09 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.07 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.07 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.06 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.02 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.01 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.99 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.95 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.95 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.94 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.92 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.92 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.92 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.92 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.89 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.89 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.87 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.86 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.81 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.79 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.77 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.76 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.76 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.73 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.67 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.64 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.64 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.6 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.4 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.38 | |
| 3tig_A | 380 | TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si | 98.07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.05 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.02 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.0 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.97 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.9 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.51 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.48 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.37 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.86 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.98 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 95.81 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.67 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.28 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.25 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 95.15 | |
| 2f69_A | 261 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 95.12 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 94.75 | |
| 3f9x_A | 166 | Histone-lysine N-methyltransferase SETD8; methyltr | 94.61 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 94.3 | |
| 1n3j_A | 119 | A612L, histone H3 lysine methyltransferase; beta b | 93.82 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 93.81 | |
| 3ope_A | 222 | Probable histone-lysine N-methyltransferase ASH1L; | 91.99 | |
| 3ooi_A | 232 | Histone-lysine N-methyltransferase, H3 lysine-36 l | 91.05 | |
| 2w5y_A | 192 | Histone-lysine N-methyltransferase HRX; transcript | 90.8 | |
| 3rq4_A | 247 | Histone-lysine N-methyltransferase SUV420H2; suppr | 90.77 | |
| 1h3i_A | 293 | Histone H3 lysine 4 specific methyltransferase; 2. | 90.36 | |
| 3h6l_A | 278 | Histone-lysine N-methyltransferase SETD2; SET doma | 90.34 | |
| 1ml9_A | 302 | Histone H3 methyltransferase DIM-5; adoMet-depende | 89.27 | |
| 1mvh_A | 299 | Cryptic LOCI regulator 4; lysine methyltransferase | 89.1 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 88.14 | |
| 2r3a_A | 300 | Histone-lysine N-methyltransferase SUV39H2; histon | 87.92 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 87.84 | |
| 3bo5_A | 290 | Histone-lysine N-methyltransferase setmar; SET dom | 87.61 | |
| 3hna_A | 287 | Histone-lysine N-methyltransferase, H3 lysine-9 sp | 87.05 | |
| 3s8p_A | 273 | Histone-lysine N-methyltransferase SUV420H1; SET d | 86.82 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 85.39 | |
| 2qpw_A | 149 | PR domain zinc finger protein 2; methyltransferase | 83.55 |
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
Probab=99.58 E-value=2.7e-15 Score=150.71 Aligned_cols=174 Identities=22% Similarity=0.258 Sum_probs=132.7
Q ss_pred CceeeeecccCCCCccccccccccCCCCCccEeecCCCcccchhhHHHHHhcccccceeecCCCcccccccchhhhHHhh
Q 007072 154 GTVKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQ 233 (619)
Q Consensus 154 ~~l~~L~Ls~~~I~~~~li~l~l~~~~p~L~~L~Ls~NkL~~~~~v~~~l~~L~~Lk~L~Ls~Npi~~~~~~~~~~~il~ 233 (619)
..++.|+|++|+|.. ++...+.++++|+.|+|++|.|..++ ...+.++++|+.|+|++|.+.... ...+.
T Consensus 37 ~~l~~L~l~~n~l~~---~~~~~~~~l~~L~~L~l~~n~l~~i~--~~~~~~l~~L~~L~l~~n~l~~~~-----~~~~~ 106 (270)
T 2o6q_A 37 ADTKKLDLQSNKLSS---LPSKAFHRLTKLRLLYLNDNKLQTLP--AGIFKELKNLETLWVTDNKLQALP-----IGVFD 106 (270)
T ss_dssp TTCSEEECCSSCCSC---CCTTSSSSCTTCCEEECCSSCCSCCC--TTTTSSCTTCCEEECCSSCCCCCC-----TTTTT
T ss_pred CCCCEEECcCCCCCe---eCHHHhcCCCCCCEEECCCCccCeeC--hhhhcCCCCCCEEECCCCcCCcCC-----HhHcc
Confidence 468899999999988 77777889999999999999999876 456788999999999999988665 33567
Q ss_pred cCCcccccccccccccccccccccccccCCCCCCccccCCCcCCcccccccCccccccCcccccCCCCCCCCcccccCCC
Q 007072 234 GCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGN 313 (619)
Q Consensus 234 ~lP~LeiLn~~~T~n~~~~~l~fc~~~~~~~~p~~l~~~~~~L~~L~~LdLS~N~I~~Lp~~~f~~~~L~~L~~LnLs~N 313 (619)
.+++|+.|+++...-.+ .|. .....+.+|+.|+|++|.|..+|...|. .+++|+.|+|++|
T Consensus 107 ~l~~L~~L~l~~n~l~~--------------~~~---~~~~~l~~L~~L~Ls~n~l~~~~~~~~~--~l~~L~~L~L~~n 167 (270)
T 2o6q_A 107 QLVNLAELRLDRNQLKS--------------LPP---RVFDSLTKLTYLSLGYNELQSLPKGVFD--KLTSLKELRLYNN 167 (270)
T ss_dssp TCSSCCEEECCSSCCCC--------------CCT---TTTTTCTTCCEEECCSSCCCCCCTTTTT--TCTTCCEEECCSS
T ss_pred cccCCCEEECCCCccCe--------------eCH---HHhCcCcCCCEEECCCCcCCccCHhHcc--CCcccceeEecCC
Confidence 88999999887533211 110 1123578899999999999999888887 8899999999999
Q ss_pred CCCccchHHHHHHHhCCCCCccccccCCCCCCchhHHHhhhcCccccc
Q 007072 314 PLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTL 361 (619)
Q Consensus 314 ~i~~i~~~~l~~~l~~~~~L~sL~ld~p~~l~~~~~~il~~lp~L~~L 361 (619)
.|..++ ...+.++++|+.|++..+.. +......+..+++|+.|
T Consensus 168 ~l~~~~----~~~~~~l~~L~~L~L~~N~l-~~~~~~~~~~l~~L~~L 210 (270)
T 2o6q_A 168 QLKRVP----EGAFDKLTELKTLKLDNNQL-KRVPEGAFDSLEKLKML 210 (270)
T ss_dssp CCSCCC----TTTTTTCTTCCEEECCSSCC-SCCCTTTTTTCTTCCEE
T ss_pred cCcEeC----hhHhccCCCcCEEECCCCcC-CcCCHHHhccccCCCEE
Confidence 998887 44578889999999887743 22222334556666654
|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2f69_A Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7; SET domain, protein lysine methyltransferase, enzyme- peptide-adohcy complex; HET: MLZ SAH; 1.30A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 3m53_A* 3m55_A* 3m54_A* 3m56_A* 3m58_A* 3m57_A* 3m59_A* 3m5a_A* 1xqh_A* 4e47_A* 1n6a_A* 1o9s_A* 3cbp_A* 3cbm_A* 3cbo_A* 3os5_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 4ij8_A* 2bqz_A* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* | Back alignment and structure |
|---|
| >3rq4_A Histone-lysine N-methyltransferase SUV420H2; suppressor, variegation 4-20 homolog 2, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h3i_A Histone H3 lysine 4 specific methyltransferase; 2.1A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 1mt6_A* 1n6c_A* 1muf_A | Back alignment and structure |
|---|
| >1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* | Back alignment and structure |
|---|
| >1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 4h4h_A* 4i51_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* | Back alignment and structure |
|---|
| >3s8p_A Histone-lysine N-methyltransferase SUV420H1; SET domain, histone methyltransferase, transcription regulat histone lysine, SAM, methylation, nucleus; HET: MSE SAM; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2qpw_A PR domain zinc finger protein 2; methyltransferase, activator, alternative initiation, alternative splicing, DNA-binding, metal-binding, nucleus; 1.79A {Homo sapiens} PDB: 2jv0_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 619 | ||||
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 7e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 7e-04 |
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: Decorin species: Cow (Bos taurus) [TaxId: 9913]
Score = 46.6 bits (109), Expect = 5e-06
Identities = 22/168 (13%), Positives = 54/168 (32%), Gaps = 23/168 (13%)
Query: 178 SKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPK 237
L + + + T+ + +L L L+ N K ++
Sbjct: 147 QGMKKLSYIRIADTNITTIPQGL-----PPSLTELHLDGN----KITKVDAASLKGLNNL 197
Query: 238 LEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRP-----LQSVTSLDLSNRCIHNL 292
++ S +I+ + + + ++ L P + + + L N I +
Sbjct: 198 AKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAI 257
Query: 293 VNKAFSP----AEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSL 336
+ F P + S S +++ NP++ ++ F C+
Sbjct: 258 GSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQP-----STFRCVYVR 300
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 619 | |||
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.5 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.46 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.39 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.34 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.32 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.31 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.31 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.3 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.29 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.29 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.26 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.21 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.2 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.18 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.14 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.14 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.12 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.08 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.07 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.03 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.97 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.93 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.89 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.89 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.8 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.75 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.67 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.6 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.6 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.59 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.57 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.51 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.44 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.42 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.36 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.18 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.17 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.85 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.58 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.4 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.21 | |
| d2g46a1 | 119 | Viral histone H3 Lysine 27 Methyltransferase {Para | 96.0 | |
| d2f69a2 | 171 | Histone H3 K4-specific methyltransferase SET7/9 ca | 94.51 | |
| d1ml9a_ | 284 | Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | 92.63 | |
| d1mvha_ | 269 | SET domain of Clr4 {Fission yeast (Schizosaccharom | 92.44 |
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: U2A'-like domain: Splicesomal U2A' protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.50 E-value=6.7e-15 Score=136.92 Aligned_cols=134 Identities=18% Similarity=0.167 Sum_probs=94.7
Q ss_pred CCCCCccEeecCCCcccchhhHHHHHhcccccceeecCCCcccccccchhhhHHhhcCCccccccccccccccccccccc
Q 007072 178 SKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFC 257 (619)
Q Consensus 178 ~~~p~L~~L~Ls~NkL~~~~~v~~~l~~L~~Lk~L~Ls~Npi~~~~~~~~~~~il~~lP~LeiLn~~~T~n~~~~~l~fc 257 (619)
.++.+++.|+|++|+|..++ .....+++|+.|+||+|.+.... +
T Consensus 15 ~n~~~lr~L~L~~n~I~~i~---~~~~~l~~L~~L~Ls~N~i~~l~--~------------------------------- 58 (162)
T d1a9na_ 15 TNAVRDRELDLRGYKIPVIE---NLGATLDQFDAIDFSDNEIRKLD--G------------------------------- 58 (162)
T ss_dssp ECTTSCEEEECTTSCCCSCC---CGGGGTTCCSEEECCSSCCCEEC--C-------------------------------
T ss_pred cCcCcCcEEECCCCCCCccC---ccccccccCCEEECCCCCCCccC--C-------------------------------
Confidence 45667777888888777775 34466777888888888766543 0
Q ss_pred ccccCCCCCCccccCCCcCCcccccccCccccccCcccccCCCCCCCCcccccCCCCCCccchHHHHHHHhCCCCCcccc
Q 007072 258 GEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLG 337 (619)
Q Consensus 258 ~~~~~~~~p~~l~~~~~~L~~L~~LdLS~N~I~~Lp~~~f~~~~L~~L~~LnLs~N~i~~i~~~~l~~~l~~~~~L~sL~ 337 (619)
...+.+|+.|+|++|+|..++...|. .+++|+.|++++|.|.+++. ...+.++++|++|+
T Consensus 59 ---------------~~~l~~L~~L~ls~N~i~~l~~~~~~--~l~~L~~L~L~~N~i~~~~~---l~~l~~l~~L~~L~ 118 (162)
T d1a9na_ 59 ---------------FPLLRRLKTLLVNNNRICRIGEGLDQ--ALPDLTELILTNNSLVELGD---LDPLASLKSLTYLC 118 (162)
T ss_dssp ---------------CCCCSSCCEEECCSSCCCEECSCHHH--HCTTCCEEECCSCCCCCGGG---GGGGGGCTTCCEEE
T ss_pred ---------------cccCcchhhhhcccccccCCCccccc--cccccccceecccccccccc---ccccccccccchhh
Confidence 11256677777788888777776665 67788888888888777651 13467778888888
Q ss_pred ccCCCC--CCchhHHHhhhcCccccccCccch
Q 007072 338 VDIPGP--LGESAIEILESLPTLCTLNGVTAS 367 (619)
Q Consensus 338 ld~p~~--l~~~~~~il~~lp~L~~LNg~~~s 367 (619)
+..|+. +..+...+++.+|+|+.|||..++
T Consensus 119 l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~ 150 (162)
T d1a9na_ 119 ILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVK 150 (162)
T ss_dssp CCSSGGGGSTTHHHHHHHHCTTCSEETTEECC
T ss_pred cCCCccccccchHHHHHHHCCCcCeeCCCCCC
Confidence 777653 223335688999999999999987
|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} | Back information, alignment and structure |
|---|
| >d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|