Citrus Sinensis ID: 007075

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
cccHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHccccEEEEccccccccccHHHccccccEEEcccccccccccccccEEEEccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHcccccEEccccccccHHHHHHHHHccccEEEcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHcHHHHHHHcccHHHHEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHcHHHHHccccHHHHHHHHHHccccEEEEcccccccccccEEEEccccEEEEEEccccccccccEEEEEEccccccccHccccEEEHEcccccEEcccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccHHHEEEcccccccHHHHHHHHHccEEcccccccccccHHHHHHccccEEEcccccHHHHHHHHHHHHccccHHEcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLgviykdrdnLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQClkidpdsrnagqNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYtswdntkdperplvigyvspdyfthSVSYFIeaplvyhdyqnYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTghtannklgmmacqpapvqvtwigypnttglptidyritdsladppetkQKHVEELIrlpecflcytpspeagpvcptpaltngfitfgsfnnlakitPKVLQVWARILCavpnsrlvvkckpfccdsvrhRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDisldtfpyagttttceslymgvpcvtmagsvhahnVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDlmskspvcdgqnfalglESTYRNMWHryckgdvpslKRMEMLQQQVvseepskfseptkiifakegspgsvmpngfnqaspsmlnlsnieeNGVQLNQHY
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTswdntkdperPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKadaktirfrekvmkkggiwrdiygiDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCavpnsrlvvKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVvseepskfsepTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGkmdaaaemiekaiaaNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYkvvvysavvkadakTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
**NLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSL*********HVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVP******************************************************************
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPS*****************************************************************
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQ************EPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQ*******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query619 2.2.26 [Sep-21-2011]
O82039932 Probable UDP-N-acetylgluc N/A no 0.991 0.658 0.832 0.0
Q96301914 Probable UDP-N-acetylgluc yes no 0.956 0.647 0.855 0.0
Q8LP10918 Probable UDP-N-acetylgluc N/A no 0.983 0.663 0.807 0.0
Q8RVB2931 Probable UDP-N-acetylgluc N/A no 0.995 0.661 0.815 0.0
O82422944 Probable UDP-N-acetylgluc N/A no 0.898 0.588 0.853 0.0
Q6YZI0927 Probable UDP-N-acetylgluc yes no 0.901 0.601 0.848 0.0
Q9M8Y0977 Probable UDP-N-acetylgluc no no 0.882 0.558 0.273 2e-52
P565581036 UDP-N-acetylglucosamine-- yes no 0.534 0.319 0.263 1e-30
Q8CGY81046 UDP-N-acetylglucosamine-- yes no 0.534 0.316 0.263 1e-30
P814361046 UDP-N-acetylglucosamine-- yes no 0.534 0.316 0.268 1e-30
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function desciption
 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/625 (83%), Positives = 562/625 (89%), Gaps = 11/625 (1%)

Query: 1   MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALS 60
           MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMAL+
Sbjct: 303 MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALT 362

Query: 61  IKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAI 120
           IKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+ISLAI
Sbjct: 363 IKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNISLAI 422

Query: 121 DAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTK 180
           +AYEQCLKIDPDSRNAGQNRLLAMNYINEG DDKL+EAHRDWG RFMRLY QY SWDN+K
Sbjct: 423 EAYEQCLKIDPDSRNAGQNRLLAMNYINEGSDDKLYEAHRDWGWRFMRLYQQYNSWDNSK 482

Query: 181 DPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMK 240
           DPER LVIGYVSPDYFTHSVSYFIEAPL YHDY NYKVV+YSAVVKADAKT RFR+KV+K
Sbjct: 483 DPERQLVIGYVSPDYFTHSVSYFIEAPLAYHDYANYKVVIYSAVVKADAKTNRFRDKVLK 542

Query: 241 KGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNT 300
           KGG+WRDIYGIDEKKV++M+REDK+DI++ELTGHTANNKLGMMAC+PAPVQVTWIGYPNT
Sbjct: 543 KGGVWRDIYGIDEKKVSSMIREDKVDIMIELTGHTANNKLGMMACRPAPVQVTWIGYPNT 602

Query: 301 TGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITF 360
           TGLPTIDYRITDS+ADPP TKQKHVEEL+RLP+ FLCYTPSPEAGPV P PALTNGF+TF
Sbjct: 603 TGLPTIDYRITDSMADPPSTKQKHVEELVRLPDSFLCYTPSPEAGPVSPAPALTNGFVTF 662

Query: 361 GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVD 420
           GSFNNLAKITPKVLQVWARILCAVP+SRL+VKCKPF CDSVR RFLS LEQLGLE  RVD
Sbjct: 663 GSFNNLAKITPKVLQVWARILCAVPHSRLIVKCKPFGCDSVRQRFLSILEQLGLEPQRVD 722

Query: 421 LLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL 480
           L+PLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTM GSVHAHNVGVSLL
Sbjct: 723 LVPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMGGSVHAHNVGVSLL 782

Query: 481 TKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTY 540
             VGL+ L+A+NEDEYV+LA+QLASDVT+L+NLRMSLR+LM+KSP+CDG  F   LESTY
Sbjct: 783 KTVGLRKLVARNEDEYVELAIQLASDVTSLSNLRMSLRELMAKSPLCDGAQFTQNLESTY 842

Query: 541 RNMWHRYCKGDVPSLKRME-------MLQQQVVSEE-PSKFSEPTKIIFAKEGSPGSVMP 592
           R+MW RYC GDVPSL+RME        L + VV EE P    E T+I  +K+   G +  
Sbjct: 843 RSMWRRYCDGDVPSLRRMELLQQQQQTLAELVVPEESPVSPIEKTRISASKD---GPIKE 899

Query: 593 NGFNQASPSMLNLSNIEENGVQLNQ 617
           NGF  +   + N S IEENGVQLNQ
Sbjct: 900 NGFTVSPALVYNSSTIEENGVQLNQ 924
Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway. OGTs catalyze the addition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Probably acts by adding O-linked sugars to yet unknown proteins.
Petunia hybrida (taxid: 4102)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query619
356500631 928 PREDICTED: probable UDP-N-acetylglucosam 0.996 0.664 0.875 0.0
225440809 914 PREDICTED: probable UDP-N-acetylglucosam 0.975 0.660 0.884 0.0
356505394 919 PREDICTED: probable UDP-N-acetylglucosam 0.972 0.655 0.864 0.0
255579381 930 o-linked n-acetylglucosamine transferase 0.995 0.662 0.872 0.0
356570865 917 PREDICTED: probable UDP-N-acetylglucosam 0.985 0.665 0.869 0.0
356534448 929 PREDICTED: probable UDP-N-acetylglucosam 0.996 0.664 0.867 0.0
256772634 916 putative SPINDLY protein [Rosa lucieae] 0.987 0.667 0.868 0.0
224088480 934 predicted protein [Populus trichocarpa] 0.993 0.658 0.847 0.0
224140075 917 predicted protein [Populus trichocarpa] 0.967 0.653 0.869 0.0
449526080 925 PREDICTED: probable UDP-N-acetylglucosam 0.985 0.659 0.856 0.0
>gi|356500631|ref|XP_003519135.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] gi|401721241|gb|AFP99901.1| putative UDP-N-acetylglucosamin [Glycine max] Back     alignment and taxonomy information
 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/618 (87%), Positives = 579/618 (93%), Gaps = 1/618 (0%)

Query: 1   MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALS 60
           MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQ+AL 
Sbjct: 301 MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQLALG 360

Query: 61  IKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAI 120
           IKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG I+LAI
Sbjct: 361 IKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGDIALAI 420

Query: 121 DAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTK 180
           +AYEQCLKIDPDSRNAGQNRLLAMNYI+EG+DDKLFEAHRDWG+RFMRLYSQ+TSWDN+K
Sbjct: 421 NAYEQCLKIDPDSRNAGQNRLLAMNYIDEGNDDKLFEAHRDWGRRFMRLYSQFTSWDNSK 480

Query: 181 DPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMK 240
           DPERPLVIGYVSPDYFTHSVSYFIEAPL+YHDY NYKVVVYSAVVKADAKTIRFREKV+K
Sbjct: 481 DPERPLVIGYVSPDYFTHSVSYFIEAPLLYHDYTNYKVVVYSAVVKADAKTIRFREKVLK 540

Query: 241 KGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNT 300
           KGGIW+DIYG DEKKVA MVRED++DIL+ELTGHTANNKLGMMAC+PAPVQVTWIGYPNT
Sbjct: 541 KGGIWKDIYGTDEKKVADMVREDQVDILIELTGHTANNKLGMMACRPAPVQVTWIGYPNT 600

Query: 301 TGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITF 360
           TGLPTIDYRITDS ADPPETKQKHVEEL+RLP+CFLCYTPSPEAGPVCPTPAL+NGF+TF
Sbjct: 601 TGLPTIDYRITDSQADPPETKQKHVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFVTF 660

Query: 361 GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVD 420
           GSFNNLAKITPKVLQVWA+ILCA+PNSRLVVKCKPFCCDSVR RFLSTLE+LGLE LRVD
Sbjct: 661 GSFNNLAKITPKVLQVWAKILCAIPNSRLVVKCKPFCCDSVRQRFLSTLEKLGLEPLRVD 720

Query: 421 LLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL 480
           LLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL
Sbjct: 721 LLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL 780

Query: 481 TKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTY 540
           +KVGL +LIAKNEDEYV+LA++LASD++AL NLRMSLR+LMSKSP+C+G  F LGLESTY
Sbjct: 781 SKVGLGNLIAKNEDEYVKLAVKLASDISALQNLRMSLRELMSKSPLCNGAKFTLGLESTY 840

Query: 541 RNMWHRYCKGDVPSLKRMEMLQQQVVSEEPS-KFSEPTKIIFAKEGSPGSVMPNGFNQAS 599
           R MW RYCKGDVP+LKRME+LQQ V S +PS K SEPT+   + EGSPGSV  NGF+   
Sbjct: 841 RKMWRRYCKGDVPALKRMELLQQPVSSNDPSNKNSEPTRATNSSEGSPGSVKANGFSSTQ 900

Query: 600 PSMLNLSNIEENGVQLNQ 617
           P  LN  N EENG  LN 
Sbjct: 901 PPKLNFVNCEENGGSLNH 918

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225440809|ref|XP_002281883.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY [Vitis vinifera] gi|297740152|emb|CBI30334.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505394|ref|XP_003521476.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|255579381|ref|XP_002530535.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223529939|gb|EEF31867.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356570865|ref|XP_003553604.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|356534448|ref|XP_003535766.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|256772634|emb|CAX46402.1| putative SPINDLY protein [Rosa lucieae] Back     alignment and taxonomy information
>gi|224088480|ref|XP_002308458.1| predicted protein [Populus trichocarpa] gi|222854434|gb|EEE91981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140075|ref|XP_002323412.1| predicted protein [Populus trichocarpa] gi|222868042|gb|EEF05173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449526080|ref|XP_004170042.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query619
TAIR|locus:2080722914 SPY "SPINDLY" [Arabidopsis tha 0.969 0.656 0.803 2e-271
UNIPROTKB|Q749Z1585 GSU2601 "TPR domain/SEC-C moti 0.857 0.907 0.388 1.1e-101
TIGR_CMR|GSU_2601585 GSU_2601 "TPR domain/SEC-C mot 0.857 0.907 0.388 1.1e-101
UNIPROTKB|Q608I2699 MCA1509 "TPR domain protein" [ 0.867 0.768 0.332 1.9e-74
TAIR|locus:2103025977 SEC "secret agent" [Arabidopsi 0.583 0.369 0.286 1.9e-54
ZFIN|ZDB-GENE-051128-11102 ogt.2 "O-linked N-acetylglucos 0.520 0.292 0.255 2.1e-45
UNIPROTKB|A5D7G11036 OGT "OGT protein" [Bos taurus 0.521 0.311 0.25 1.7e-44
UNIPROTKB|F1RSV21046 OGT "UDP-N-acetylglucosamine-- 0.521 0.308 0.25 1.8e-44
UNIPROTKB|P814361046 OGT "UDP-N-acetylglucosamine-- 0.521 0.308 0.25 1.8e-44
WB|WBGene000038581151 ogt-1 [Caenorhabditis elegans 0.313 0.168 0.323 2e-44
TAIR|locus:2080722 SPY "SPINDLY" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2610 (923.8 bits), Expect = 2.0e-271, P = 2.0e-271
 Identities = 486/605 (80%), Positives = 534/605 (88%)

Query:     1 MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALS 60
             MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGV+YKDRDNLDKAVECYQMALS
Sbjct:   298 MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVLYKDRDNLDKAVECYQMALS 357

Query:    61 IKPNFSQSLNNLGVVYTVQGXXXXXXXXXXXXXXXNPTYAEAYNNLGVLYRDAGSISLAI 120
             IKPNF+QSLNNLGVVYTVQG               NPTYAEA+NNLGVLYRDAG+I++AI
Sbjct:   358 IKPNFAQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAFNNLGVLYRDAGNITMAI 417

Query:   121 DAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTK 180
             DAYE+CLKIDPDSRNAGQNRLLAMNYINEG DDKLFEAHRDWG RF RL+ QYTSWDN K
Sbjct:   418 DAYEECLKIDPDSRNAGQNRLLAMNYINEGLDDKLFEAHRDWGWRFTRLHPQYTSWDNLK 477

Query:   181 DPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYXXXXXXXXXXXXXXTIRFREKVMK 240
             DPERP+ IGY+SPD+FTHSVSYFIEAPL +HDY  Y              T RFR+KV+K
Sbjct:   478 DPERPITIGYISPDFFTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTYRFRDKVLK 537

Query:   241 KGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNT 300
             KGG+W+DIYGIDEKK+A+MVREDKIDILVELTGHTANNKLG MAC+PAPVQVTWIGYPNT
Sbjct:   538 KGGVWKDIYGIDEKKIASMVREDKIDILVELTGHTANNKLGTMACRPAPVQVTWIGYPNT 597

Query:   301 TGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITF 360
             TGLPT+DYRITDSLADPP+TKQK VEEL+RLP+CFLCYTPSPEAGPVCPTPAL+NGF+TF
Sbjct:   598 TGLPTVDYRITDSLADPPDTKQKQVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFVTF 657

Query:   361 GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVD 420
             GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDS+R RFL+TLEQLGLES RVD
Sbjct:   658 GSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSIRQRFLTTLEQLGLESKRVD 717

Query:   421 LLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL 480
             LLPLIL NHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL
Sbjct:   718 LLPLILFNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLL 777

Query:   481 TKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTY 540
             TKVGL HL+AKNEDEYVQL++ LASDVTAL+ LRMSLRDLM+ SPVC+G +FA+GLES Y
Sbjct:   778 TKVGLGHLVAKNEDEYVQLSVDLASDVTALSKLRMSLRDLMAGSPVCNGPSFAVGLESAY 837

Query:   541 RNMWHRYCKGDVPSLKRMEMLQQQVVSEEP--SKFSEPTKIIFAKEGSPGSVMPNGFNQA 598
             RNMW +YCKG+VPSL+RMEMLQ++V  ++P  SK   P+++    E +P S+  NG +  
Sbjct:   838 RNMWKKYCKGEVPSLRRMEMLQKEV-HDDPLISKDLGPSRVSVTGEATP-SLKANG-SAP 894

Query:   599 SPSML 603
              PS L
Sbjct:   895 VPSSL 899
GO:0005634 "nucleus" evidence=ISM;IDA;TAS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016262 "protein N-acetylglucosaminyltransferase activity" evidence=TAS
GO:0009938 "negative regulation of gibberellic acid mediated signaling pathway" evidence=IGI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009736 "cytokinin mediated signaling pathway" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q749Z1 GSU2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2601 GSU_2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q608I2 MCA1509 "TPR domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2103025 SEC "secret agent" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051128-1 ogt.2 "O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7G1 OGT "OGT protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSV2 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P81436 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
WB|WBGene00003858 ogt-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O82039SPY_PETHY2, ., 4, ., 1, ., -0.8320.99190.6587N/Ano
Q8LP10SPY_EUSER2, ., 4, ., 1, ., -0.80720.98380.6633N/Ano
Q96301SPY_ARATH2, ., 4, ., 1, ., -0.85570.95630.6477yesno
Q6YZI0SPY_ORYSJ2, ., 4, ., 1, ., -0.84830.90140.6019yesno
Q8RVB2SPY_SOLLC2, ., 4, ., 1, ., -0.81570.99510.6616N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00021566001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (920 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00008957001
SubName- Full=Chromosome undetermined scaffold_213, whole genome shotgun sequence; (561 aa)
    • • 0.474

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query619
COG3914620 COG3914, Spy, Predicted O-linked N-acetylglucosami 2e-97
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-24
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 7e-24
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 2e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-19
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-15
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-15
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 7e-15
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-12
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-12
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-11
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-10
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 7e-10
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-09
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-09
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 7e-08
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 7e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-08
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-07
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-07
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-07
smart0002834 smart00028, TPR, Tetratricopeptide repeats 3e-07
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 3e-07
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-07
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 9e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 3e-06
PRK12370553 PRK12370, PRK12370, invasion protein regulator; Pr 3e-06
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 5e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-05
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-05
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 3e-05
COG4976287 COG4976, COG4976, Predicted methyltransferase (con 3e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-05
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 5e-05
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 6e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-05
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 7e-05
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 8e-05
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 8e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-05
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 1e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 2e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-04
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 3e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-04
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit Bcs 4e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.001
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 0.001
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 0.002
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 0.002
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 0.003
>gnl|CDD|226428 COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  310 bits (796), Expect = 2e-97
 Identities = 166/562 (29%), Positives = 248/562 (44%), Gaps = 56/562 (9%)

Query: 15  DMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECY-QMALSIKPNFSQSLNNLG 73
            +A +   +    NP    A  NL    +       A+    ++A  + P+ ++ L +L 
Sbjct: 84  TLAFLAKRIPLSVNPENCPAVQNLAAALELDGLQFLALADISEIAEWLSPDNAEFLGHLI 143

Query: 74  VVYTVQ------GKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL--------- 118
             Y +       G+   A   +E+A+   P Y      L    ++  S            
Sbjct: 144 RFYQLGRYLKLLGRTAEAELALERAVDLLPKYPRVLGALMTARQEQCSWPEEAPTNLLSQ 203

Query: 119 ------AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQ 172
                         L  DP    A  N+LL +   N     +                  
Sbjct: 204 LALFLGIYGFSLAYLADDPLKNLAIANQLLKILSQNAPELVR------------------ 245

Query: 173 YTSWDNTKDPE-RPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS-AVVKADAK 230
           +   D       + L +GY+S D  +H+V + +     YHD   ++V  YS      DA 
Sbjct: 246 FPIRDENIKRNGKRLRVGYLSSDLRSHAVGFLLRWVFEYHDRDKFEVFAYSLGPPHTDAL 305

Query: 231 TIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPV 290
             R    V K    W  I  +D+ ++A  +R D IDILV+L GHT + +  + A +PAP+
Sbjct: 306 QERISAAVEK----WYPIGRMDDAEIANAIRTDGIDILVDLDGHTVDTRCQVFAHRPAPI 361

Query: 291 QVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPT 350
           QV+W+GYP TTG P +DY I+D    PP  ++ + E+L RLP    CY P     PV P 
Sbjct: 362 QVSWLGYPATTGSPNMDYFISDPYTVPPTAEEYYSEKLWRLP---QCYQPVDGFEPVTPP 418

Query: 351 PA-----LTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRF 405
           P+     L    + F  FNN  KITP+V  +W +IL AVPNS L++K        +  R 
Sbjct: 419 PSRAQLGLPEDAVVFCCFNNYFKITPEVFALWMQILSAVPNSVLLLKAGG-DDAEINARL 477

Query: 406 LSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVT 465
               E+ G++S R+  LP    N DH   Y + D+ LDT+PY G TT  ++L+MGVP +T
Sbjct: 478 RDLAEREGVDSERLRFLP-PAPNEDHRARYGIADLVLDTYPYGGHTTASDALWMGVPVLT 536

Query: 466 MAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSP 525
             G   A   G S+ T  G+  L+A +  +YV+ A+   SD      +R  L+     SP
Sbjct: 537 RVGEQFASRNGASIATNAGIPELVADSRADYVEKAVAFGSDRALRQQVRAELKRSRQTSP 596

Query: 526 VCDGQNFALGLESTYRNMWHRY 547
           + D + FA  LE+ Y  MW  Y
Sbjct: 597 LFDPKAFARKLETLYWGMWSEY 618

Length = 620
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|237080 PRK12370, PRK12370, invasion protein regulator; Provisional Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 619
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 100.0
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 100.0
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 100.0
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.88
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.81
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.78
PLN02949463 transferase, transferring glycosyl groups 99.78
cd03796398 GT1_PIG-A_like This family is most closely related 99.75
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.73
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.73
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.72
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.7
cd03820348 GT1_amsD_like This family is most closely related 99.7
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.69
cd03822366 GT1_ecORF704_like This family is most closely rela 99.69
cd03801374 GT1_YqgM_like This family is most closely related 99.68
cd03807365 GT1_WbnK_like This family is most closely related 99.68
cd03806419 GT1_ALG11_like This family is most closely related 99.68
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.68
KOG1126638 consensus DNA-binding cell division cycle control 99.67
cd03821375 GT1_Bme6_like This family is most closely related 99.67
cd04962371 GT1_like_5 This family is most closely related to 99.67
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.67
PRK15359144 type III secretion system chaperone protein SscB; 99.66
cd03812358 GT1_CapH_like This family is most closely related 99.66
cd03818396 GT1_ExpC_like This family is most closely related 99.65
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.64
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.64
cd03813475 GT1_like_3 This family is most closely related to 99.63
cd04951360 GT1_WbdM_like This family is most closely related 99.63
cd03805392 GT1_ALG2_like This family is most closely related 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.62
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.62
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.62
PRK12370553 invasion protein regulator; Provisional 99.62
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.62
PLN02846462 digalactosyldiacylglycerol synthase 99.6
cd03811353 GT1_WabH_like This family is most closely related 99.6
PRK10307412 putative glycosyl transferase; Provisional 99.6
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.6
PLN02501794 digalactosyldiacylglycerol synthase 99.59
KOG1126638 consensus DNA-binding cell division cycle control 99.59
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.59
cd03817374 GT1_UGDG_like This family is most closely related 99.59
PLN02939977 transferase, transferring glycosyl groups 99.59
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.59
cd03795357 GT1_like_4 This family is most closely related to 99.59
PRK11189296 lipoprotein NlpI; Provisional 99.58
cd03798377 GT1_wlbH_like This family is most closely related 99.58
PRK12370553 invasion protein regulator; Provisional 99.57
cd03819355 GT1_WavL_like This family is most closely related 99.57
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.57
cd04949372 GT1_gtfA_like This family is most closely related 99.57
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.57
PRK10370198 formate-dependent nitrite reductase complex subuni 99.56
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.56
PRK15359144 type III secretion system chaperone protein SscB; 99.55
cd03808359 GT1_cap1E_like This family is most closely related 99.55
cd03802335 GT1_AviGT4_like This family is most closely relate 99.55
KOG1111426 consensus N-acetylglucosaminyltransferase complex, 99.55
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.55
cd03814364 GT1_like_2 This family is most closely related to 99.54
cd03825365 GT1_wcfI_like This family is most closely related 99.54
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.54
KOG1125579 consensus TPR repeat-containing protein [General f 99.54
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.54
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.53
cd03823359 GT1_ExpE7_like This family is most closely related 99.53
PLN023161036 synthase/transferase 99.52
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.52
cd03809365 GT1_mtfB_like This family is most closely related 99.51
cd04955363 GT1_like_6 This family is most closely related to 99.5
PLN00142815 sucrose synthase 99.5
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.5
PRK11189296 lipoprotein NlpI; Provisional 99.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.49
cd04946407 GT1_AmsK_like This family is most closely related 99.49
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.48
PRK11788389 tetratricopeptide repeat protein; Provisional 99.47
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.47
cd03816415 GT1_ALG1_like This family is most closely related 99.47
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 99.47
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.45
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.45
PRK11788389 tetratricopeptide repeat protein; Provisional 99.45
PRK00654466 glgA glycogen synthase; Provisional 99.44
PRK14099485 glycogen synthase; Provisional 99.44
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 99.44
PRK14098489 glycogen synthase; Provisional 99.44
KOG0553304 consensus TPR repeat-containing protein [General f 99.44
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.44
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.43
KOG0553304 consensus TPR repeat-containing protein [General f 99.42
KOG0547606 consensus Translocase of outer mitochondrial membr 99.41
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.41
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.4
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 99.4
PHA01630331 putative group 1 glycosyl transferase 99.37
PRK10370198 formate-dependent nitrite reductase complex subuni 99.37
PLN02605382 monogalactosyldiacylglycerol synthase 99.36
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.36
PLN02789320 farnesyltranstransferase 99.36
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.35
cd03794394 GT1_wbuB_like This family is most closely related 99.35
KOG0547606 consensus Translocase of outer mitochondrial membr 99.35
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.35
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.33
cd03804351 GT1_wbaZ_like This family is most closely related 99.33
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.33
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.33
PHA01633335 putative glycosyl transferase group 1 99.32
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.31
PLN02789320 farnesyltranstransferase 99.31
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 99.3
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.29
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.29
KOG1125579 consensus TPR repeat-containing protein [General f 99.28
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.28
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.28
PRK10125405 putative glycosyl transferase; Provisional 99.28
KOG1129478 consensus TPR repeat-containing protein [General f 99.26
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.25
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.23
KOG2076 895 consensus RNA polymerase III transcription factor 99.23
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.22
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.22
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 99.22
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.22
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.21
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.2
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.2
KOG2003840 consensus TPR repeat-containing protein [General f 99.2
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 99.2
PRK14574 822 hmsH outer membrane protein; Provisional 99.19
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.19
PLN02275371 transferase, transferring glycosyl groups 99.18
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 99.16
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.16
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.16
KOG1129478 consensus TPR repeat-containing protein [General f 99.13
KOG2003840 consensus TPR repeat-containing protein [General f 99.13
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.12
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.11
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.11
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.09
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.09
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.08
KOG2076 895 consensus RNA polymerase III transcription factor 99.08
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 99.08
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.07
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.07
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.07
PRK11906458 transcriptional regulator; Provisional 99.06
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.06
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.05
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 99.05
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 99.04
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.02
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 99.02
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.02
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 99.01
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.01
PRK14574 822 hmsH outer membrane protein; Provisional 99.01
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.0
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.0
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.99
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.98
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.98
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.97
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.97
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.96
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.94
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.93
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.93
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.92
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.92
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.89
KOG0853495 consensus Glycosyltransferase [Cell wall/membrane/ 98.89
KOG1128777 consensus Uncharacterized conserved protein, conta 98.89
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.89
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.89
KOG1387465 consensus Glycosyltransferase [Cell wall/membrane/ 98.89
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.88
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.87
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.85
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.85
PRK15331165 chaperone protein SicA; Provisional 98.83
PRK10803263 tol-pal system protein YbgF; Provisional 98.82
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.81
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.8
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 98.8
PRK10803263 tol-pal system protein YbgF; Provisional 98.8
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 98.79
PRK15331165 chaperone protein SicA; Provisional 98.79
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.77
PF12688120 TPR_5: Tetratrico peptide repeat 98.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.76
KOG1128777 consensus Uncharacterized conserved protein, conta 98.76
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 98.75
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.74
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.72
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.7
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.7
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.69
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 98.68
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.68
PF12688120 TPR_5: Tetratrico peptide repeat 98.67
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.66
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.66
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.62
KOG4234271 consensus TPR repeat-containing protein [General f 98.61
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.6
COG4700251 Uncharacterized protein conserved in bacteria cont 98.6
COG4700251 Uncharacterized protein conserved in bacteria cont 98.6
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.58
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.56
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.55
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.55
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.54
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.54
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.54
PF1337173 TPR_9: Tetratricopeptide repeat 98.53
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.52
KOG4234271 consensus TPR repeat-containing protein [General f 98.5
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 98.49
PF1337173 TPR_9: Tetratricopeptide repeat 98.49
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.49
PF13512142 TPR_18: Tetratricopeptide repeat 98.47
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.46
KOG4648536 consensus Uncharacterized conserved protein, conta 98.46
PLN032181060 maturation of RBCL 1; Provisional 98.44
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.44
KOG4648536 consensus Uncharacterized conserved protein, conta 98.43
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.43
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 98.43
KOG4555175 consensus TPR repeat-containing protein [Function 98.42
PRK11906458 transcriptional regulator; Provisional 98.42
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.41
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.41
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.4
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.39
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.38
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.38
KOG4555175 consensus TPR repeat-containing protein [Function 98.37
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.37
TIGR03492396 conserved hypothetical protein. This protein famil 98.34
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.33
PLN032181060 maturation of RBCL 1; Provisional 98.32
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.32
PF13512142 TPR_18: Tetratricopeptide repeat 98.31
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 98.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.29
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.29
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.28
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.25
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 98.25
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.23
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.23
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 98.22
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.22
KOG2376652 consensus Signal recognition particle, subunit Srp 98.17
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 98.15
PLN03077857 Protein ECB2; Provisional 98.14
KOG2376652 consensus Signal recognition particle, subunit Srp 98.13
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.1
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.09
PRK04841903 transcriptional regulator MalT; Provisional 98.09
KOG1941518 consensus Acetylcholine receptor-associated protei 98.09
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.08
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.07
PLN03077857 Protein ECB2; Provisional 98.02
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.0
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 98.0
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.96
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 97.96
PLN02670472 transferase, transferring glycosyl groups 97.94
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.93
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.91
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.9
PLN02992481 coniferyl-alcohol glucosyltransferase 97.87
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.86
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.85
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 97.84
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 97.84
PRK04841903 transcriptional regulator MalT; Provisional 97.83
KOG1941518 consensus Acetylcholine receptor-associated protei 97.83
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.82
PF1342844 TPR_14: Tetratricopeptide repeat 97.8
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 97.8
PLN02764453 glycosyltransferase family protein 97.8
PLN03004451 UDP-glycosyltransferase 97.79
PF1342844 TPR_14: Tetratricopeptide repeat 97.79
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.76
PF1343134 TPR_17: Tetratricopeptide repeat 97.76
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.74
PLN02167475 UDP-glycosyltransferase family protein 97.74
PLN02562448 UDP-glycosyltransferase 97.71
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 97.71
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.69
PF1343134 TPR_17: Tetratricopeptide repeat 97.68
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.68
PLN02210456 UDP-glucosyl transferase 97.67
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.67
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.66
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 97.65
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 97.64
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.61
PLN02554481 UDP-glycosyltransferase family protein 97.6
PLN02448459 UDP-glycosyltransferase family protein 97.6
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.59
PLN02207468 UDP-glycosyltransferase 97.58
PLN00414446 glycosyltransferase family protein 97.57
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.56
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 97.56
PLN03007482 UDP-glucosyltransferase family protein 97.54
PLN02208442 glycosyltransferase family protein 97.53
PLN00164480 glucosyltransferase; Provisional 97.52
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 97.52
KOG1586288 consensus Protein required for fusion of vesicles 97.52
PLN02555480 limonoid glucosyltransferase 97.5
KOG1915677 consensus Cell cycle control protein (crooked neck 97.48
PLN02173449 UDP-glucosyl transferase family protein 97.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.45
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.44
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.42
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 97.42
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.41
KOG1585308 consensus Protein required for fusion of vesicles 97.4
KOG1915677 consensus Cell cycle control protein (crooked neck 97.4
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.38
KOG2941444 consensus Beta-1,4-mannosyltransferase [Posttransl 97.38
PLN02534491 UDP-glycosyltransferase 97.36
PLN03015470 UDP-glucosyl transferase 97.36
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.35
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 97.35
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.35
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.34
PLN02152455 indole-3-acetate beta-glucosyltransferase 97.34
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 97.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.33
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.3
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.29
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 97.24
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.23
TIGR00661321 MJ1255 conserved hypothetical protein. This model 97.22
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.2
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.18
KOG2471696 consensus TPR repeat-containing protein [General f 97.16
KOG1586288 consensus Protein required for fusion of vesicles 97.15
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.14
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 96.96
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.94
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.94
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.94
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.92
KOG4507886 consensus Uncharacterized conserved protein, conta 96.86
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.8
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 96.76
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.76
KOG2047835 consensus mRNA splicing factor [RNA processing and 96.75
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.72
KOG4507886 consensus Uncharacterized conserved protein, conta 96.69
KOG2047835 consensus mRNA splicing factor [RNA processing and 96.68
PF05693633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 96.67
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.67
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 96.63
KOG2471696 consensus TPR repeat-containing protein [General f 96.54
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.48
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.46
KOG1585308 consensus Protein required for fusion of vesicles 96.44
COG3898531 Uncharacterized membrane-bound protein [Function u 96.38
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.38
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.34
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 96.32
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 96.25
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 96.21
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.21
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.21
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.21
COG3898531 Uncharacterized membrane-bound protein [Function u 96.18
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.17
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 96.09
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.08
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.08
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.06
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 96.05
KOG1550552 consensus Extracellular protein SEL-1 and related 96.05
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.02
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.01
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.0
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 96.0
PRK10117474 trehalose-6-phosphate synthase; Provisional 95.91
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.82
PRK10941269 hypothetical protein; Provisional 95.78
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.74
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 95.7
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.66
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.63
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 95.62
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.62
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.61
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.61
PRK10941269 hypothetical protein; Provisional 95.54
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 95.54
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.26
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 95.21
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.2
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.19
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 95.19
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 94.98
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.93
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.91
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 94.9
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.83
PF00982474 Glyco_transf_20: Glycosyltransferase family 20; In 94.82
TIGR02201344 heptsyl_trn_III lipopolysaccharide heptosyltransfe 94.82
PF01075247 Glyco_transf_9: Glycosyltransferase family 9 (hept 94.76
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.75
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.74
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.66
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.63
KOG3364149 consensus Membrane protein involved in organellar 94.61
KOG1550552 consensus Extracellular protein SEL-1 and related 94.53
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 94.53
PRK14089347 ipid-A-disaccharide synthase; Provisional 94.49
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.48
KOG4814872 consensus Uncharacterized conserved protein [Funct 94.47
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 94.44
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.35
KOG2300629 consensus Uncharacterized conserved protein [Funct 94.28
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 94.17
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.12
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.03
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.02
KOG1310758 consensus WD40 repeat protein [General function pr 93.99
COG4671400 Predicted glycosyl transferase [General function p 93.97
KOG2300629 consensus Uncharacterized conserved protein [Funct 93.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.65
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.53
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.38
KOG1310758 consensus WD40 repeat protein [General function pr 93.3
KOG0530318 consensus Protein farnesyltransferase, alpha subun 93.25
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.22
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.16
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.12
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 92.92
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.91
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.82
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 92.65
PRK10422352 lipopolysaccharide core biosynthesis protein; Prov 92.53
COG4370412 Uncharacterized protein conserved in bacteria [Fun 92.45
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 92.44
PRK10017426 colanic acid biosynthesis protein; Provisional 92.33
KOG4814872 consensus Uncharacterized conserved protein [Funct 91.98
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 91.98
KOG1258577 consensus mRNA processing protein [RNA processing 91.71
COG0380486 OtsA Trehalose-6-phosphate synthase [Carbohydrate 91.67
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 91.35
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 91.35
KOG3364149 consensus Membrane protein involved in organellar 91.18
KOG0529421 consensus Protein geranylgeranyltransferase type I 90.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.84
COG5191435 Uncharacterized conserved protein, contains HAT (H 90.07
PF1286294 Apc5: Anaphase-promoting complex subunit 5 89.89
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 89.66
COG2912269 Uncharacterized conserved protein [Function unknow 89.45
PF1286294 Apc5: Anaphase-promoting complex subunit 5 89.4
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 89.37
COG2912269 Uncharacterized conserved protein [Function unknow 89.24
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 88.24
KOG2581493 consensus 26S proteasome regulatory complex, subun 88.2
KOG1914656 consensus mRNA cleavage and polyadenylation factor 88.09
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.05
COG5191435 Uncharacterized conserved protein, contains HAT (H 87.55
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 87.26
KOG2422665 consensus Uncharacterized conserved protein [Funct 86.97
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.74
KOG1258577 consensus mRNA processing protein [RNA processing 86.68
KOG1914656 consensus mRNA cleavage and polyadenylation factor 86.6
COG3629280 DnrI DNA-binding transcriptional activator of the 86.53
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 86.51
PF10933364 DUF2827: Protein of unknown function (DUF2827); In 86.41
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 86.35
COG3629280 DnrI DNA-binding transcriptional activator of the 86.29
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.21
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 86.14
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=7.4e-116  Score=897.41  Aligned_cols=560  Identities=41%  Similarity=0.627  Sum_probs=531.5

Q ss_pred             CHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcC
Q 007075            1 MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQG   80 (619)
Q Consensus         1 ~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~la~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg~~~~~~g   80 (619)
                      ++|||+++.++|++++|..+|+++++..|+.+.++.|||.+|.++|++++|+.+|+.+++++|..++++.|+|+.|..+|
T Consensus       357 m~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g  436 (966)
T KOG4626|consen  357 MNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMG  436 (966)
T ss_pred             HHHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhh
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhhcCCc-----HHH
Q 007075           81 KMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHD-----DKL  155 (619)
Q Consensus        81 ~~~eA~~~~~~al~~~p~~~~a~~~Lg~~~~~~g~~~eA~~~~~~al~~~P~~~~a~~~~~la~~~~~~g~~-----~~a  155 (619)
                      +...|+.+|.+|++++|..++++.|||.+|...|+..+|+..|+.++++.|+.+++++|++.++.+...+.+     ++.
T Consensus       437 ~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~~kl  516 (966)
T KOG4626|consen  437 DVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRMKKL  516 (966)
T ss_pred             hHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999999988876     677


Q ss_pred             HHHHHHHHH--HHHhhc----------------------------------cCCCCCCCCCCCCCCccccccCCCCccCh
Q 007075          156 FEAHRDWGK--RFMRLY----------------------------------SQYTSWDNTKDPERPLVIGYVSPDYFTHS  199 (619)
Q Consensus       156 ~~~~~~~~~--~~~~~~----------------------------------~~~~~~~~~~~~~~~LrIgyvs~~~~~h~  199 (619)
                      ++.+++|..  +++...                                  +++..|.+.+.+++||||||+|+||++||
T Consensus       517 ~sivrdql~~~rlpsvhP~hsm~ypl~~~~~~aia~k~a~~c~~~~~~~~k~pyth~~~l~~~~~rlrIGYvSsDFgnHp  596 (966)
T KOG4626|consen  517 VSIVRDQLEKNRLPSVHPHHSMLYPLSHILRKAIAAKHANLCLDKVHVLGKPPYTHPDNLKVKEGRLRIGYVSSDFGNHP  596 (966)
T ss_pred             HHHHHHHHhhhcCCccCcccccccccchHHHHHHHHHHhhhhHHHHHhccCCCCCChhhCCCCcCceEEEeecccccCCc
Confidence            788888773  333322                                  34667777788889999999999999999


Q ss_pred             HHHhhHhHhhhhcCCceEEEEEecCcCCChhhHHHHHHHhhhCCeEEEcccCCHHHHHHHhHhCCccEEEeCCCCCCCCc
Q 007075          200 VSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNK  279 (619)
Q Consensus       200 v~~~~~~~l~~~d~~~fev~~ys~~~~~D~~t~~~r~~~~~~~~~~~~~~~~~~~~~~~~i~~d~~Dilvdl~g~t~~~r  279 (619)
                      +.+++..+..+||++++|||||+..+..+.   .||.++.+.+++|.++++++...+|+.|++|+|||||.+.|||.|+|
T Consensus       597 ~Shlmqsv~gmHdr~kveVfcYals~~d~t---~fR~kv~~e~ehf~Dls~i~~~kiA~~I~qD~I~ILvnlnGyTkgar  673 (966)
T KOG4626|consen  597 TSHLMQSVPGMHDRSKVEVFCYALSVNDGT---NFRDKVMKEAEHFVDLSQIPCNKIADKIRQDKIHILVNLNGYTKGAR  673 (966)
T ss_pred             hHHHhccCcCcCCccceEEEEEEeecCCCc---hHHHHHHhhccceeehhcCChHHHHHHHhhcCceEEEeccccccccc
Confidence            999999999999999999999999877653   38999999999999999999999999999999999999999999999


Q ss_pred             chhhccCCcceeEecccCCCCCCCCCccEEEecCCCCCCCccCCCccceEEcCCCccccCCCC--------CCCCCCCCC
Q 007075          280 LGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSP--------EAGPVCPTP  351 (619)
Q Consensus       280 ~~~~a~r~Apvq~~~~G~p~ttg~~~~Dy~i~d~~~~p~~~~~~~~E~l~~lp~~~~~~~p~~--------~~~~~~~~~  351 (619)
                      .++||+|||||||+|+|||+|||.+.|||+|+|.+..|.+....|+||+++||+||+++++.+        ...|.++.+
T Consensus       674 neifAlrPAPIQv~wlGyPgTtGa~~mDYiITDs~tsPl~~a~~ysEkLv~lPh~ffi~d~~qk~~~~~dpn~kP~r~~y  753 (966)
T KOG4626|consen  674 NEIFALRPAPIQVMWLGYPGTTGATFMDYIITDSVTSPLELAQQYSEKLVYLPHCFFIGDHKQKNQDVLDPNNKPTRSQY  753 (966)
T ss_pred             cceeeccCCceeEEeecCCCCCCCceeeEEeecccCChHHHHHHHHHHHhhCCceEEecCcccccccccCCCCCCCCCCC
Confidence            999999999999999999999999999999999999999999999999999999999998876        555788899


Q ss_pred             CCCCCCeEEEecCCCCcCCHHHHHHHHHHHHHCCCceEEEeccCCCCHHHHHHHHHHHHHcCCCCCcEEEcCCccCcHHH
Q 007075          352 ALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDH  431 (619)
Q Consensus       352 ~l~~~~~~f~~~~~~~K~~~~~~~~~~~il~~~P~a~l~l~g~~~~~~~~~~~l~~~~~~~Gi~~~rv~f~g~~~~~~~~  431 (619)
                      ++|+|+|||||||+++||+|+++++|++||+++|+++||+...|+.++   .+++..+++.|++++||+|.+-.. .+||
T Consensus       754 ~Lp~d~vvf~~FNqLyKidP~~l~~W~~ILk~VPnS~LwllrfPa~ge---~rf~ty~~~~Gl~p~riifs~va~-k~eH  829 (966)
T KOG4626|consen  754 GLPEDAVVFCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGE---QRFRTYAEQLGLEPDRIIFSPVAA-KEEH  829 (966)
T ss_pred             CCCCCeEEEeechhhhcCCHHHHHHHHHHHHhCCcceeEEEeccccch---HHHHHHHHHhCCCccceeeccccc-hHHH
Confidence            999999999999999999999999999999999999999998887655   789999999999999999999877 6999


Q ss_pred             HHhcccCcEeecCCCCCCchhHHHhhhcCCcEEeccCCccccchhHHHHHhcCCCccccCCHHHHHHHHHHhhcCHHHHH
Q 007075          432 MQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALA  511 (619)
Q Consensus       432 ~~~~~~~Dv~Ldt~~~~g~~t~~eAl~~GvPvVt~~g~~~~~r~~~~~l~~~gl~~~v~~~~~~y~~~a~~L~~d~~~~~  511 (619)
                      +.++..+||+|||++++|+||.+|.||+|||+|||+|+++++||++|+|..+|++++|+.+.+||++++|+|++|.+.++
T Consensus       830 vrr~~LaDv~LDTplcnGhTTg~dvLw~GvPmVTmpge~lAsrVa~Sll~~~Gl~hliak~~eEY~~iaV~Latd~~~L~  909 (966)
T KOG4626|consen  830 VRRGQLADVCLDTPLCNGHTTGMDVLWAGVPMVTMPGETLASRVAASLLTALGLGHLIAKNREEYVQIAVRLATDKEYLK  909 (966)
T ss_pred             HHhhhhhhhcccCcCcCCcccchhhhccCCceeecccHHHHHHHHHHHHHHcccHHHHhhhHHHHHHHHHHhhcCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHhcCCCCCchhhHHHHhhhcc
Q 007075          512 NLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVS  567 (619)
Q Consensus       512 ~lr~~~r~~~~~~~~~~~~~~~~~le~~y~~~~~~~~~g~~p~~~~~~~~~~~~~~  567 (619)
                      .+|..+|..+..||+||...|+..||++|.+||++||.|+.|+.+|++.+++.+.+
T Consensus       910 ~lr~~l~~~r~~splfd~~q~~~~LE~~y~~MW~~y~~G~~p~h~~me~~~e~~hd  965 (966)
T KOG4626|consen  910 KLRAKLRKARASSPLFDTKQYAKGLERLYLQMWKKYCSGEVPDHRRMENLQEEPHD  965 (966)
T ss_pred             HHHHHHHHHhcCCCccCchHHHHHHHHHHHHHHHHhccCCCCchHHHhccccCcCC
Confidence            99999999999999999999999999999999999999999999999998876543

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative Back     alignment and domain information
>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10933 DUF2827: Protein of unknown function (DUF2827); InterPro: IPR021234 This is a family of uncharacterised proteins found in Burkholderia Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query619
2vsn_A568 Structure And Topological Arrangement Of An O-Glcna 1e-28
2vsy_A568 Xanthomonas Campestris Putative Ogt (Xcc0866), Apos 2e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 1e-26
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 3e-23
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 9e-17
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-12
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-12
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 2e-11
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 2e-10
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 1e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-10
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-09
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 4e-07
3q3e_A631 Crystal Structure Of The Actinobacillus Pleuropneum 5e-06
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 2e-04
4eqf_A365 Trip8b-1a#206-567 Interacting With The Carboxy-Term 4e-04
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 6e-04
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 6e-04
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 7e-04
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 7e-04
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 8e-04
>pdb|2VSN|A Chain A, Structure And Topological Arrangement Of An O-Glcnac Transferase Homolog: Insight Into Molecular Control Of Intracellular Glycosylation Length = 568 Back     alignment and structure 
Iteration: 1

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/355 (27%), Positives = 153/355 (43%), Gaps = 16/355 (4%)
Query: 185 PLVIGYVSPDYFTHSVSYFIEAPL-VYHDYQNYXXXXXXXXXXXXXXTIRFREKVMKKGG 243
           PL +G+VS  +  H       A        Q                T+R R   + +  
Sbjct: 205 PLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTR---LAQAS 261
Query: 244 IWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGL 303
              D+  +     A  +R   ID+L +L G     +  + A +PAPVQV W+ YP T+G 
Sbjct: 262 TLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGA 321
Query: 304 PTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTN-GF----I 358
           P +DY + D+ A PP  +  + E ++RL   F    PS  +  V   P+ T  G     +
Sbjct: 322 PWMDYVLGDAFALPPALEPFYSEHVLRLQGAF---QPSDTSRVVAEPPSRTQCGLPEQGV 378
Query: 359 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLR 418
               FNN  K+ P+ +     +L  VP+S L +   P   D+   R  +     G+++ R
Sbjct: 379 VLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADA---RLRAFAHAQGVDAQR 435
Query: 419 VDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 478
           +  +P  L +  ++  Y   D+ LDT PY   TT  ++L+ G P +T  G   A  V  S
Sbjct: 436 LVFMP-KLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGS 494
Query: 479 LLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFA 533
           L   +GL  +   ++  +V  A+ LASD  AL  L   +  L   S V     FA
Sbjct: 495 LNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFA 549
>pdb|2VSY|A Chain A, Xanthomonas Campestris Putative Ogt (Xcc0866), Apostructure Length = 568 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3Q3E|A Chain A, Crystal Structure Of The Actinobacillus Pleuropneumoniae Hmw1c Glycosyltransferase Length = 631 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|4EQF|A Chain A, Trip8b-1a#206-567 Interacting With The Carboxy-Terminal Seven Residues Of Hcn2 Length = 365 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query619
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 0.0
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-20
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-12
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 1e-126
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-96
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-83
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-29
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-52
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-42
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-41
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-40
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-36
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-35
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-50
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-36
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-45
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-45
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-20
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-37
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-30
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-24
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-40
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-34
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-34
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-30
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-17
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-40
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-40
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-38
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-31
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-19
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-40
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-35
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-35
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-28
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-40
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-30
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-26
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-18
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-40
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-35
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-35
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-30
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-29
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-26
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-23
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-22
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-38
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-34
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-33
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-32
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-31
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-30
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-26
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-33
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-26
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-24
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-38
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-27
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-16
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-37
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-37
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-30
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-29
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-21
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-37
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-33
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-33
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-33
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-25
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-22
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-19
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-16
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-37
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-36
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-35
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-34
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-33
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-21
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-35
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-32
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-31
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-27
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-31
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-31
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-31
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-31
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-30
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-29
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-29
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-28
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-28
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-28
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-24
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-31
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-28
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-26
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-21
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-30
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-29
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-24
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-29
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-26
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-24
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-24
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-16
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-11
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-28
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-27
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-26
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-26
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-24
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-28
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-27
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-27
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-26
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-25
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-20
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 4e-25
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-24
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-23
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-21
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-28
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-27
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-26
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-26
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-24
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-23
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-23
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-23
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-22
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-22
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-22
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-22
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-22
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-20
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-19
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-15
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-14
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-27
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-24
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-23
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-23
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-21
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-15
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-27
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-25
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-18
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-25
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 7e-23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 8e-20
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 9e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-24
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-23
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-16
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 7e-08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-24
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-20
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-23
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-20
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-18
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-17
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-22
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-10
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-22
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-19
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-16
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-09
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-19
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-13
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-19
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-18
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-18
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-11
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-13
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-10
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-07
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-17
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-10
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-15
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 5e-09
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-14
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-10
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-08
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 5e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 7e-13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 5e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-12
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 6e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-11
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 7e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-10
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 3e-10
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 8e-10
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 2e-09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 2e-09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 9e-09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 2e-07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-10
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 7e-09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-06
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-09
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-08
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-08
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 5e-08
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 9e-08
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 9e-08
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 1e-05
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 6e-09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 5e-08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 7e-09
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 4e-08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 5e-08
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-08
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-07
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-07
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-07
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 3e-06
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 9e-08
1klx_A138 Cysteine rich protein B; structural genomics, heli 1e-07
1klx_A138 Cysteine rich protein B; structural genomics, heli 4e-04
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 7e-06
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 4e-05
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 1e-04
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
 Score =  562 bits (1451), Expect = 0.0
 Identities = 125/571 (21%), Positives = 207/571 (36%), Gaps = 43/571 (7%)

Query: 14  FDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLG 73
               ++    A    P    A   L        +        Q  L++ P   +++  LG
Sbjct: 5   GPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLG 64

Query: 74  VVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDS 133
            V   Q +   AA ++++A  A P +      LG    DAG    A  AY +  ++ P+ 
Sbjct: 65  RVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEE 124

Query: 134 RNAGQNRLLAMNYINEGH-------------------------------DDKLFEAHRDW 162
                  L     + +                                   +     R  
Sbjct: 125 PYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTR 184

Query: 163 GKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS 222
            +      S           + PL +G+VS  +  H       A       +   + ++ 
Sbjct: 185 AQAIAA--SVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHL 242

Query: 223 -AVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLG 281
            A    D  T+R R   + +     D+  +     A  +R   ID+L +L G     +  
Sbjct: 243 FATSGDDGSTLRTR---LAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPE 299

Query: 282 MMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPS 341
           + A +PAPVQV W+ YP T+G P +DY + D+ A PP  +  + E ++RL   F     S
Sbjct: 300 VFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTS 359

Query: 342 PEAG--PVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCD 399
                 P      L    +    FNN  K+ P+ +     +L  VP+S L +   P    
Sbjct: 360 RVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGP---G 416

Query: 400 SVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYM 459
               R  +     G+++ R+  +P  L +  ++  Y   D+ LDT PY   TT  ++L+ 
Sbjct: 417 EADARLRAFAHAQGVDAQRLVFMP-KLPHPQYLARYRHADLFLDTHPYNAHTTASDALWT 475

Query: 460 GVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRD 519
           G P +T  G   A  V  SL   +GL  +   ++  +V  A+ LASD  AL  L   +  
Sbjct: 476 GCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDV 535

Query: 520 LMSKSPVCDGQNFALGLESTYRNMWHRYCKG 550
           L   S V     FA    +  + +  R+   
Sbjct: 536 LRRASGVFHMDGFADDFGALLQALARRHGWL 566
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Length = 631 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query619
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 100.0
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 100.0
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 100.0
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.85
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.84
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.82
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 99.81
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.79
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.79
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 99.78
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.77
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.76
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.75
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.74
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.73
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.73
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 99.73
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.72
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.72
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.72
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.72
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.71
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 99.71
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.71
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.71
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 99.7
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.7
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.7
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.7
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.69
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 99.69
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.69
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.69
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.67
3u4t_A272 TPR repeat-containing protein; structural genomics 99.67
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.67
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.67
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.66
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.65
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.64
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.64
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.63
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.63
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.63
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 99.63
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.63
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.62
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.61
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.61
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.6
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.6
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.6
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.6
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.6
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 99.6
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.59
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.59
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.59
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.58
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.58
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.57
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.57
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.56
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.56
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 99.56
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 99.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.55
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.55
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.55
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.55
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.54
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.54
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.53
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.53
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 99.53
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.53
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.52
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.52
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.52
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.52
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.51
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.51
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.51
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.51
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.51
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.5
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.5
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.5
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.5
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.49
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.49
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.49
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.49
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.48
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.48
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.48
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.47
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.47
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.47
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.46
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.46
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.45
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.45
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.44
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.44
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.44
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.43
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 99.43
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.42
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.41
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.4
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.4
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.4
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 99.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.4
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.4
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.39
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.38
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.38
3k9i_A117 BH0479 protein; putative protein binding protein, 99.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.37
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.37
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.37
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.37
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.36
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
3k9i_A117 BH0479 protein; putative protein binding protein, 99.34
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.34
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.33
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.33
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.33
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.32
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.32
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 99.31
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 99.31
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.3
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 99.28
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 99.27
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.27
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.24
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.24
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.22
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.21
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.21
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.21
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.21
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.2
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.19
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.19
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.19
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.14
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.12
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 99.12
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.11
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 99.1
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.03
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.03
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.03
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.01
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.01
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.0
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.98
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.97
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 98.97
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.91
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.89
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 98.88
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 98.85
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.85
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.84
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 98.81
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.8
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 98.78
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.76
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.76
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 98.73
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.7
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 98.66
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.65
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.64
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.6
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.57
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.56
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 98.56
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.5
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.5
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.49
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.47
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 98.45
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.45
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 98.44
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.4
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.38
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.33
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 98.33
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.32
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 98.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.23
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 98.2
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.17
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.1
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 98.04
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 97.95
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.92
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 97.85
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 97.84
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 97.84
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.76
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 97.71
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 97.7
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.63
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.53
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.44
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 97.42
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.38
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.24
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.1
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.04
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.83
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 96.82
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 96.7
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.5
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.47
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.28
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.24
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.2
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 95.14
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.08
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.98
2gj4_A824 Glycogen phosphorylase, muscle form; transferase; 94.78
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 94.76
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.72
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.47
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.47
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.07
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 93.94
1l5w_A796 Maltodextrin phosphorylase; enzymatic catalysis, s 93.68
2c4m_A796 Glycogen phosphorylase; allosteric control, phosph 93.62
3tov_A349 Glycosyl transferase family 9; structural genomics 93.11
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.89
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.99
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 90.94
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 90.84
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 90.19
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.52
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.52
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.36
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 88.89
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.06
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 87.35
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 86.75
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 85.75
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 85.38
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 82.14
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-110  Score=949.39  Aligned_cols=546  Identities=29%  Similarity=0.436  Sum_probs=496.8

Q ss_pred             CHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcC
Q 007075            1 MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQG   80 (619)
Q Consensus         1 ~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~la~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg~~~~~~g   80 (619)
                      |++||.++.++|++++|+.+|+++++++|++..+++++|.+|.++|++++|+++|+++++++|+++.+++++|.++..+|
T Consensus        12 l~nLG~~~~~~G~~~eAi~~~~kAl~l~P~~~~a~~nLg~~l~~~g~~~eA~~~~~~Al~l~P~~~~a~~nLg~~l~~~g   91 (723)
T 4gyw_A           12 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ   91 (723)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcC
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhhcCCcHHHHHHHH
Q 007075           81 KMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHR  160 (619)
Q Consensus        81 ~~~eA~~~~~~al~~~p~~~~a~~~Lg~~~~~~g~~~eA~~~~~~al~~~P~~~~a~~~~~la~~~~~~g~~~~a~~~~~  160 (619)
                      ++++|+++|+++++++|++..+++++|.+|..+|++++|+++|+++++++|++..++.+  ++..+...|+++++.+.++
T Consensus        92 ~~~~A~~~~~kAl~l~P~~~~a~~~Lg~~~~~~g~~~eAi~~~~~Al~l~P~~~~a~~~--L~~~l~~~g~~~~A~~~~~  169 (723)
T 4gyw_A           92 DVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCN--LAHCLQIVCDWTDYDERMK  169 (723)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHH--HHHHHHHTTCCTTHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHhh--hhhHHHhcccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999988  7777888888887776665


Q ss_pred             HHHHHHHhhc-------------------------------------------cCCCCCCCCCCCCCCccccccCCCCcc
Q 007075          161 DWGKRFMRLY-------------------------------------------SQYTSWDNTKDPERPLVIGYVSPDYFT  197 (619)
Q Consensus       161 ~~~~~~~~~~-------------------------------------------~~~~~~~~~~~~~~~LrIgyvs~~~~~  197 (619)
                      +..+......                                           ++.......+.++++|||||+|++|++
T Consensus       170 kal~l~~~~~~~~~l~~~~~~~~l~~~~~~~~~~aia~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~klrIGyvS~df~~  249 (723)
T 4gyw_A          170 KLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGN  249 (723)
T ss_dssp             HHHHHHHHHHHTTCCCSSCTTGGGGSCCCHHHHHHHHHHHHHHHHHHHHTTTCCCCCCCCSSTTTTTCEEEEEEESCSSS
T ss_pred             HHHHhChhHHhhccCcccchhhhhhhhcCHHHHHHHHHHHHHhhhhhhhcccCccccCccccccccccceeeeechhhcc
Confidence            5443321100                                           001111223456789999999999999


Q ss_pred             ChHHHhhHhHhhhhcCCceEEEEEecCcC-CChhhHHHHHHHhhhCCeEEEcccC-CHHHHHHHhHhCCccEEEeCCCCC
Q 007075          198 HSVSYFIEAPLVYHDYQNYKVVVYSAVVK-ADAKTIRFREKVMKKGGIWRDIYGI-DEKKVAAMVREDKIDILVELTGHT  275 (619)
Q Consensus       198 h~v~~~~~~~l~~~d~~~fev~~ys~~~~-~D~~t~~~r~~~~~~~~~~~~~~~~-~~~~~~~~i~~d~~Dilvdl~g~t  275 (619)
                      |++++++..++.+||+.+||+++|+.++. .+..+.+++..    .+.|+++.++ ++.+++++||+|+|||||||+|||
T Consensus       250 H~v~~~~~~~~~~~d~~~fei~~y~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~d~~~a~~i~~d~iDIlidl~g~t  325 (723)
T 4gyw_A          250 HPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAE----ANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYT  325 (723)
T ss_dssp             SHHHHHHTTHHHHSCTTTEEEEEEESSCCCSCHHHHHHHHH----SSEEEEGGGCCCHHHHHHHHHHTTCSEEEESCSSB
T ss_pred             CcHHHHHHHHHHHhccCceeEEEEEcCCCCccHHHHHHHHh----hccccccccCCcHHHHHHHHHhccceeEEeccCCC
Confidence            99999999999999999999999998754 35555555553    4899999998 689999999999999999999999


Q ss_pred             CCCcchhhccCCcceeEecccCCCCCCCCCccEEEecCCCCCCCccCCCccceEEcCCCccccCCCCCCC----------
Q 007075          276 ANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAG----------  345 (619)
Q Consensus       276 ~~~r~~~~a~r~Apvq~~~~G~p~ttg~~~~Dy~i~d~~~~p~~~~~~~~E~l~~lp~~~~~~~p~~~~~----------  345 (619)
                      .++|+.+|++|||||||+|||||+|||+++|||+|+|.+++|++.+.+|+||++|||++|+|++|....+          
T Consensus       326 ~~~r~~i~a~r~APvQv~~lG~p~TtG~~~iDY~i~D~~~~P~~~~~~ysEklirLP~~~~~~d~~~~~p~~~~~~~~~~  405 (723)
T 4gyw_A          326 KGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDF  405 (723)
T ss_dssp             TTCCTHHHHTCCSSEEEECSSCSSCCCCTTCCEEEECTTTSCGGGGGGCSSEEEECSSCSCCCCHHHHCGGGSSCEEECC
T ss_pred             CCCcchhhhcCCCCceeeeccCCCCCCCCcCCEEEeCCCCCCchhhhcceeeeeeCCCccccCCcccccccccccccccc
Confidence            9999999999999999999999999999999999999999999999999999999999999986321000          


Q ss_pred             --------------------------------------------------------------------------------
Q 007075          346 --------------------------------------------------------------------------------  345 (619)
Q Consensus       346 --------------------------------------------------------------------------------  345 (619)
                                                                                                      
T Consensus       406 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~p~~p~~~~~~~~~~~~~~~~~~~~~~g~~  485 (723)
T 4gyw_A          406 KSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFS  485 (723)
T ss_dssp             C---CCCSSSEEEECTTHHHHHHTSSSCEEEC-----------------CEEEECSSHHHHHHHHHHHHTCCEEEETTEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                                                                                            


Q ss_pred             --------------------------CCCCCCCCCCCCeEEEecCCCCcCCHHHHHHHHHHHHHCCCceEEEeccCCCCH
Q 007075          346 --------------------------PVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCD  399 (619)
Q Consensus       346 --------------------------~~~~~~~l~~~~~~f~~~~~~~K~~~~~~~~~~~il~~~P~a~l~l~g~~~~~~  399 (619)
                                                ..+..++|+++.|||||||+++|++|+++++|++||+++|+|+|||+..+   .
T Consensus       486 ~~~~~~~~~~~~~~~~~~~~p~~~~~~~R~~~gLp~~~v~f~~fN~~~Ki~p~~~~~W~~IL~~vP~S~L~Ll~~~---~  562 (723)
T 4gyw_A          486 ISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFP---A  562 (723)
T ss_dssp             EEETTCHHHHCHHHHHTSSCCCSEEEEEGGGGTCCTTSEEEECCSCGGGCCHHHHHHHHHHHHHCSSEEEEEEETT---G
T ss_pred             cccccccccccccccccccccccccccchhhcCCCCCCEEEEeCCccccCCHHHHHHHHHHHHhCCCCeEEEEeCc---H
Confidence                                      01223579999999999999999999999999999999999999998654   2


Q ss_pred             HHHHHHHHHHHHcCCCCCcEEEcCCccCcHHHHHhcccCcEeecCCCCCCchhHHHhhhcCCcEEeccCCccccchhHHH
Q 007075          400 SVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSL  479 (619)
Q Consensus       400 ~~~~~l~~~~~~~Gi~~~rv~f~g~~~~~~~~~~~~~~~Dv~Ldt~~~~g~~t~~eAl~~GvPvVt~~g~~~~~r~~~~~  479 (619)
                      ..+.++++.+++.||+++||+|.|..+ ..+|++.|+.+||+|||||||||||++|||||||||||+.|++|+||+|+|+
T Consensus       563 ~~~~~l~~~~~~~gi~~~r~~f~~~~~-~~~~l~~~~~~Di~LDt~p~~g~tT~~eal~~GvPvvt~~g~~~~sR~~~s~  641 (723)
T 4gyw_A          563 VGEPNIQQYAQNMGLPQNRIIFSPVAP-KEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQ  641 (723)
T ss_dssp             GGHHHHHHHHHHTTCCGGGEEEEECCC-HHHHHHHGGGCSEEECCSSSCCSHHHHHHHHTTCCEEBCCCSSGGGTHHHHH
T ss_pred             HHHHHHHHHHHhcCCCcCeEEECCCCC-HHHHHHHhCCCeEEeCCCCcCCHHHHHHHHHcCCCEEEccCCCccHhHHHHH
Confidence            456889999999999999999999987 7999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCccccCCHHHHHHHHHHhhcCHHHHHHHHHHHHHHhhcCCCCChHHHHHHHHHHHHHHHHHHhcCCCCCch
Q 007075          480 LTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLK  556 (619)
Q Consensus       480 l~~~gl~~~v~~~~~~y~~~a~~L~~d~~~~~~lr~~~r~~~~~~~~~~~~~~~~~le~~y~~~~~~~~~g~~p~~~  556 (619)
                      |.++|++|||+.|+++|+++|++|++|++.++++|+++|+++..+++||.++|++.||++|++||++||+|++|+..
T Consensus       642 l~~~gl~e~ia~~~~~Y~~~a~~la~d~~~l~~lr~~l~~~~~~s~l~d~~~~~~~le~a~~~~w~r~~~G~~p~~~  718 (723)
T 4gyw_A          642 LTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHM  718 (723)
T ss_dssp             HHHHTCGGGBCSSHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSSTTCHHHHHHHHHHHHHHHHHHHHTTCCCCCB
T ss_pred             HHHcCCcccccCCHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhCcCcCHHHHHHHHHHHHHHHHHHHHcCCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999853
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 619
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-27
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-25
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-23
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-21
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-20
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-05
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-23
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-21
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-18
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-16
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-16
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-13
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 9e-18
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-16
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 9e-16
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-08
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-15
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-11
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-04
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 8e-14
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 9e-09
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-08
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 4e-08
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 8e-08
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-13
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-13
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-11
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-09
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-11
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-11
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-08
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 2e-08
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-10
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-07
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 8e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 0.002
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-09
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 7e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 6e-06
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-08
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-08
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 3e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-08
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-05
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 3e-07
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-06
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-06
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-05
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 2e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 7e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.003
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 5e-04
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  112 bits (280), Expect = 2e-27
 Identities = 43/140 (30%), Positives = 70/140 (50%)

Query: 1   MYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALS 60
             NL   Y E    D+AI  Y  A    PH  +A  NL    K++ ++ +A +CY  AL 
Sbjct: 240 HGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALR 299

Query: 61  IKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAI 120
           + P  + SLNNL  +   QG ++ A  +  KA+   P +A A++NL  + +  G +  A+
Sbjct: 300 LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL 359

Query: 121 DAYEQCLKIDPDSRNAGQNR 140
             Y++ ++I P   +A  N 
Sbjct: 360 MHYKEAIRISPTFADAYSNM 379
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query619
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.74
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.72
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.72
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.72
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.71
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.69
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.67
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.66
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.61
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.55
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.51
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.51
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.5
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.45
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.44
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.44
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.43
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.4
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.39
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.38
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.33
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.33
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.33
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.32
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 99.23
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.23
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.2
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.16
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.15
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.12
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 99.09
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.07
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.06
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.05
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.04
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.98
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.9
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.85
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.73
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.65
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.64
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.51
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.33
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.09
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.02
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.97
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 97.77
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 97.77
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 97.71
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 97.67
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 97.57
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.35
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 97.14
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 97.13
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 97.06
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 96.74
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 95.67
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 95.21
d1l5wa_796 Maltodextrin phosphorylase (MALP) {Escherichia col 90.83
d2gj4a1824 Glycogen phosphorylase {Rabbit (Oryctolagus cunicu 89.56
d1pswa_348 ADP-heptose LPS heptosyltransferase II {Escherichi 89.5
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.2
d1iiba_103 Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56 83.79
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Protein prenylyltransferase
family: Protein prenylyltransferase
domain: Protein farnesyltransferase alpha-subunit
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.74  E-value=5e-17  Score=164.87  Aligned_cols=144  Identities=12%  Similarity=0.086  Sum_probs=137.5

Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcC-CHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcC
Q 007075            2 YNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRD-NLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQG   80 (619)
Q Consensus         2 ~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~la~~~~~~g-~~~~A~~~~~~al~l~p~~~~~~~~lg~~~~~~g   80 (619)
                      .++|.++.+.+.+++|+.+++++++++|++..+|+++|.++..++ ++++|++.++++++++|++..+|.++|.++..+|
T Consensus        47 ~~~~~~~~~~e~~~~Al~~~~~ai~lnP~~~~a~~~r~~~l~~l~~~~~eal~~~~~al~~~p~~~~a~~~~~~~~~~l~  126 (315)
T d2h6fa1          47 DYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR  126 (315)
T ss_dssp             HHHHHHHHHTCCCHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHhCCchHHHHHHHHHHHHHCCCChHHHHHHHHHHHHhCcCHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHhhc
Confidence            468899999999999999999999999999999999999999987 5999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Q 007075           81 KMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMN  145 (619)
Q Consensus        81 ~~~eA~~~~~~al~~~p~~~~a~~~Lg~~~~~~g~~~eA~~~~~~al~~~P~~~~a~~~~~la~~  145 (619)
                      ++++|+..++++++++|++..+|.++|.++..+|++++|++.|+++++++|++..++.++.....
T Consensus       127 ~~~eAl~~~~kal~~dp~n~~a~~~~~~~~~~~~~~~~Al~~~~~al~~~p~n~~a~~~r~~~l~  191 (315)
T d2h6fa1         127 DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVIS  191 (315)
T ss_dssp             CCTTHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCCTTHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred             cHHHHHHHHhhhhhhhhcchHHHHHHHHHHHHHHhhHHHHHHHHHHHHHCCccHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999998655443
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]} Back     information, alignment and structure