Citrus Sinensis ID: 007330

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------
MFNFTSLLDESEKRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAHVPTITINRQYVQGIF
cccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccHHHHccccccccccHHHHHcccccccccEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEcHHHHHHHHHHHHcEEEEEEcccccccccccccccEEEEEEEcccccccccccccccccEEEEccccccccccccHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccccccHHHHccccccEEcccccccccccHHHHHHcccccEEEccccccccccccccccccccccccEEEcccccccccccHHHHccccccccEEEEccccccccccHHHHccccccccccEEEEEEccccccccccHHHHHHccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccHHHHcccccccccccccccccEEEccEEEEccc
cHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHccHHccccccccccHHHHEcHHcccHHHHHHHHEEEEccccccEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEEEEEccccccccccHccccccEEEEccccccccccccHHHcccccccEEEEEccccccccccHHHccccccccccEEEEEcccccccccccccccccccEEEEEcccHHHHHccHHHcccccccEEEccccccccccccccccccHcEccEEEccccccccccccHHHHHcHHHcccccccccccccccHHHHHHccccccccccEEEEEcccccccccccHHHHHHHccccccccEEEEEcccccccccHHccccccccEEEEcccccccccccccccccccEEEEEcccccEEccHHcccccccccccccccEEEEcccccHHHcccccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHccccccccccccccccEEEEcccEEEEcc
mfnftslldeSEKRKLLYESSkvqqggvgIKTILHKFGNLLCLRRARKERGSSILDIEMgklnelendplaplllsyndfppmiKLCFLYCavfpkgynieKDELIKLWMAQgyirpignkEMEVIGQEYFDYLATRSFFqkfdkddednvtrckmsdAVHDFAQFLTKHeyfsieadgseesltkTSLEKFRHSMLVlgrrasfpvSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKitgkvswgqnsiyaipkEKEKLVHLRYLKLSLLMREELPDIVCELFNlqtlevehcprlkrlpqgigkLVNLRHLIYYYsnldympkgfeRLTCLRTLTEFVvsggkysgkacnieGLRHLnhlggvfritglgnvtdvdeaENAELEKKRNVVDLglwfdkdeegeeadHEEIIEALkphsnlvaldilgfkgkitfpKWIMSLnnlkslhlrscekceilsplgklpsleTLYIAGMsgkrvgdeffgigsdcniafpklkflrVVDMfeweewgfgitrsnvkedvmvmpclnyldiQFCFKLKALPGYLLEITALEKLEILCCPIleqryrkgtgedwakvahvptitinrQYVQGIF
mfnftslldeseKRKLLYesskvqqggvgiktILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSieadgseesltktsLEKFRHSMlvlgrrasfpvSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKItgkvswgqnsiyaipkekeklVHLRYLKLSLLMREELPDIVCELFNLQTLEVehcprlkrlpqgigklvNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAEnaelekkrnvvdlgLWFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEIlsplgklpsLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKgtgedwakvahvptitinrqyvqgif
MFNFTSLLDESEKRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKdeegeeadheeiieaLKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAHVPTITINRQYVQGIF
**********************VQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEA***********LEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDK**********EIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAHVPTITINRQYVQ***
MFNFTS******KRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEAD*********SLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGK*CNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKD******DHEEIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVK**VMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYR***GEDWAKVAHVPTITINRQYVQGIF
MFNFTSLLDESEKRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAHVPTITINRQYVQGIF
MFNFTSLLDESEKRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAHVPTITINRQYVQGIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNFTSLLDESEKRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAHVPTITINRQYVQGIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query607 2.2.26 [Sep-21-2011]
Q7XBQ9970 Disease resistance protei N/A no 0.871 0.545 0.306 3e-57
Q9LRR5 1424 Putative disease resistan yes no 0.830 0.353 0.323 3e-56
Q9LRR4 1054 Putative disease resistan no no 0.802 0.462 0.320 6e-52
Q7XA40992 Putative disease resistan N/A no 0.879 0.538 0.291 1e-50
Q7XA39 988 Putative disease resistan N/A no 0.794 0.487 0.321 2e-50
Q7XA42979 Putative disease resistan N/A no 0.665 0.412 0.337 8e-50
Q39214926 Disease resistance protei no no 0.889 0.583 0.257 7e-26
Q8W3K3910 Putative disease resistan no no 0.774 0.516 0.244 8e-19
P0C8S1906 Probable disease resistan no no 0.790 0.529 0.268 6e-16
Q9FJK8908 Probable disease resistan no no 0.775 0.518 0.262 3e-15
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 206/672 (30%), Positives = 299/672 (44%), Gaps = 143/672 (21%)

Query: 23  VQQGGVGIKTILHKFGNLLCLRRARKERG-SSILDIEMGKLNELENDPLAPLLLSYNDFP 81
           V++ G G+       G +LC +R  +ER    + D  +  L + E+  L  L LSY+  P
Sbjct: 344 VKKSG-GVPLAAKTLGGILCFKR--EERAWEHVRDSPIWNLPQDESSILPALRLSYHQLP 400

Query: 82  PMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQ 141
             +K CF YCAVFPK   +EK++LI LWMA G++   GN E+E +G E +  L  RSFFQ
Sbjct: 401 LDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEVWKELYLRSFFQ 460

Query: 142 KFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGR 201
           + +   +D  T  KM D +HD A  L     FS  A+ S  ++ + +   + H M +   
Sbjct: 461 EIEV--KDGKTYFKMHDLIHDLATSL-----FS--ANTSSSNIREINKHSYTHMMSI--- 508

Query: 202 RASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIP 261
              F   +F                 F+ L  L  +++ LR L +      G ++   +P
Sbjct: 509 --GFAEVVF-----------------FYTLPPLEKFIS-LRVLNL------GDSTFNKLP 542

Query: 262 KEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLI 321
                LVHLRYL L       LP  +C+L NLQTL++++C +L  LP+   KL +LR+L+
Sbjct: 543 SSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLL 602

Query: 322 YYYS-NLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGN 380
              S +L  MP     LTCL+TL +FVV G K   K   +  L +LN L G  +I+ L  
Sbjct: 603 LDGSQSLTCMPPRIGSLTCLKTLGQFVV-GRK---KGYQLGELGNLN-LYGSIKISHLER 657

Query: 381 VTDVDEAENAELEKKRNVVDLGL-WFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKG 439
           V +  +A+ A L  K N+  L + W +      E++  +++EALKPHSNL +L I GF+G
Sbjct: 658 VKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRG 717

Query: 440 KITFPKWIMS--LNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGI- 496
            I  P+W+    L N+ S+ + +   C  L P G LP LE+L +   S      E   I 
Sbjct: 718 -IHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDID 776

Query: 497 ---GSDCNIAFPKLKFLRVVDMFEWE--------------------EWGFGITRSNVKED 533
              G    I FP L+ L + D    +                    E  F    SN++  
Sbjct: 777 VHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRAL 836

Query: 534 VMVMPCLN------------------YLDIQFCFKLKALPGYLLEITALEKLEI-LC--- 571
             +  C N                  YL I  C  LK LP  L  + AL+ L+I LC   
Sbjct: 837 TSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLCCAL 896

Query: 572 ---------------------------------------------CPILEQRYRKGTGED 586
                                                        CP L +R  KG GED
Sbjct: 897 ESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGED 956

Query: 587 WAKVAHVPTITI 598
           W K++H+P + I
Sbjct: 957 WHKISHIPNVNI 968
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth. Confers a broad resistance to all known races of P.infestans.
Solanum bulbocastanum (taxid: 147425)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
359482788 903 PREDICTED: putative disease resistance p 0.899 0.604 0.453 1e-122
359482790 923 PREDICTED: putative disease resistance p 0.912 0.600 0.443 1e-120
359482769 904 PREDICTED: putative disease resistance p 0.909 0.610 0.435 1e-119
359482784 919 PREDICTED: putative disease resistance p 0.896 0.591 0.448 1e-119
359482792 922 PREDICTED: putative disease resistance p 0.892 0.587 0.451 1e-119
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.953 0.652 0.407 1e-117
147825450 927 hypothetical protein VITISV_000086 [Viti 0.911 0.596 0.439 1e-116
224122696 906 cc-nbs-lrr resistance protein [Populus t 0.863 0.578 0.430 1e-114
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.939 0.603 0.400 1e-114
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.958 0.618 0.400 1e-112
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  447 bits (1149), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 260/573 (45%), Positives = 351/573 (61%), Gaps = 27/573 (4%)

Query: 29  GIKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDPLAPLLLSYNDFPPMIKLCF 88
           G+   +   GNLL ++ + +E    +L+ E+ +L+E E D    LLLSY D PP I+ CF
Sbjct: 348 GLPLAIKTLGNLLRIKNSEEE-WKYVLNSEVWQLDEFERDISPALLLSYYDLPPAIQRCF 406

Query: 89  LYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFDKDDE 148
            +CAVFPK   IE+DELIKLWMAQ Y++  G+KEME+IG+ YF+YLA RSFFQ F+KD +
Sbjct: 407 SFCAVFPKASVIERDELIKLWMAQSYLKSDGSKEMEMIGRTYFEYLAARSFFQDFEKDTD 466

Query: 149 DNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRASFPVS 208
            N+ RCKM D VHDFAQFLT++E F +E D  +      S +K RH  LV+       VS
Sbjct: 467 GNIIRCKMHDIVHDFAQFLTQNECFIVEVDNQQMESIDLSFKKIRHITLVVRESTPNFVS 526

Query: 209 IFKAKKLRSLLIHSEFEVSFHV-LQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKL 267
            +  K L +LL    F+ S  V L  L  +LTCLRAL ++         I  +PKE  KL
Sbjct: 527 TYNMKNLHTLLAKEAFKSSVLVALPNLLRHLTCLRALDLS-----SNQLIEELPKEVGKL 581

Query: 268 VHLRYLKLS-LLMREELPDIVCELFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSN 326
           +HLR+L LS      ELP+ +C+L+NLQTL ++ C  L++LPQ +GKL+NLRHL   + N
Sbjct: 582 IHLRFLNLSGCFWLRELPETICDLYNLQTLNIQGCSSLRKLPQAMGKLINLRHLENSFLN 641

Query: 327 LDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDE 386
              +PKG  RL+ L+TL  F+VS   +      I  LR+LN+L G   I GL  V D  E
Sbjct: 642 NKGLPKGIGRLSSLQTLNVFIVSS--HGNDEGQIGDLRNLNNLRGDLSIQGLDEVKDAGE 699

Query: 387 AENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSNLVALDILGFKGKITFPKW 446
           AE AEL+ K ++ DL L FD+ EEG +     + EAL+PH NL AL I  + G   +P W
Sbjct: 700 AEKAELKNKVHLQDLTLGFDR-EEGTKG----VAEALQPHPNLKALHIY-YYGDREWPNW 753

Query: 447 IM--SLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSG-KRVGDEFFGIGSDCNIA 503
           +M  SL  LK L+L+ CE+C  L PLG+LP LE L I  M G K +G EF G  S     
Sbjct: 754 MMGSSLAQLKILNLKFCERCPCLPPLGQLPVLEELGIWKMYGVKYIGSEFLGSSS---TV 810

Query: 504 FPKLKFLRVVDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITA 563
           FPKLK L +  + + ++W         KE+  +MPCLN+L ++ C KL+ LPG++L+ T 
Sbjct: 811 FPKLKELAISGLDKLKQWEI-----KEKEERSIMPCLNHLIMRGCPKLEGLPGHVLQRTT 865

Query: 564 LEKLEILCCPILEQRYRKGTGEDWAKVAHVPTI 596
           L+ L I   PILE+RYRK  GED  K++H+P +
Sbjct: 866 LQILNIRSSPILERRYRKDIGEDRHKISHIPQV 898

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122696|ref|XP_002318903.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859576|gb|EEE97123.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query607
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.797 0.339 0.337 5e-53
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.780 0.449 0.317 3.4e-48
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.596 0.200 0.273 2.3e-28
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.509 0.333 0.285 2.6e-27
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.400 0.267 0.263 2.8e-16
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.436 0.294 0.256 4.2e-16
UNIPROTKB|Q84UB1928 Pi-ta "Pi-ta protein" [Oryza s 0.431 0.282 0.313 6e-16
UNIPROTKB|Q9AY26928 Pi-ta "Pi-ta protein" [Oryza s 0.431 0.282 0.313 6e-16
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.497 0.287 0.263 1.2e-14
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.497 0.287 0.263 1.2e-14
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 5.0e-53, Sum P(2) = 5.0e-53
 Identities = 177/525 (33%), Positives = 261/525 (49%)

Query:    67 NDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYI-RPIGNKEMEV 125
             N  L  L LSY+  PP +K CF  C++FPKG+  +++EL+ LWMA   + +P  ++ +E 
Sbjct:   401 NSILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLED 460

Query:   126 IGQEYFDYLATRSFFQKFDKDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLT 185
             IG +Y   L  +SFFQ+ D      +T   M D ++D A+ ++    F +E D   E  +
Sbjct:   461 IGNDYLGDLVAQSFFQRLDI----TMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPS 516

Query:   186 KTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLL-IHSEFEV-SFHVLQGLFD-YLTCLR 242
              T    F  S        +F  SI  A+ LR++L  +S   + S  + + + +  L  L 
Sbjct:   517 TTRHFSFSRSQC--DASVAFR-SICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALS 573

Query:   243 ALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCP 302
              L+I   +S     I  +PK  + L  LRYL LS    +ELP+ VC L NLQTL + +C 
Sbjct:   574 GLRI---LSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCR 630

Query:   303 RLKRLPQGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEG 362
              L  LP+ I +L+NLR L    + L  MP G ++L  L+ L+ FV+  G+ SG    +  
Sbjct:   631 DLTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVI--GRLSG--AGLHE 686

Query:   363 LRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGL-WFDKXXXXXXXXXXXXX- 420
             L+ L+HL G  RI+ L NV    EA++A L++K  +  L L W  K              
Sbjct:   687 LKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALAC 746

Query:   421 ------XXLKPHSNLVALDILGFKGKITFPKWI--MSLNNLKSLHLRSCEKCEILSPLGK 472
                     L+PH +L    I  ++G   FPKW+   S   + S+ L SC  C  L P+G+
Sbjct:   747 DQKEVLRMLEPHPHLKTFCIESYQGG-AFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQ 805

Query:   473 LPSLETLYIAGMSG-KRVG-DEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGITRSNV 530
             LPSL+ L I   +  ++VG D FFG  +   + F  L+ L+   M  W+EW   I     
Sbjct:   806 LPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEW---ICPE-- 860

Query:   531 KEDVMVMPCLNYLDIQFCFKL-KALPGYLLEITALEKLEILCCPI 574
              ED  + PCL  L IQ C  L K  P  L   T   ++ I  CP+
Sbjct:   861 LEDG-IFPCLQKLIIQRCPSLRKKFPEGLPSST---EVTISDCPL 901
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84UB1 Pi-ta "Pi-ta protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9AY26 Pi-ta "Pi-ta protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-11
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 63.9 bits (156), Expect = 3e-11
 Identities = 27/52 (51%), Positives = 40/52 (76%)

Query: 67  NDPLAPLLLSYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPI 118
           N+ L+ L LSY++ P  +K CFLY A+FP+ YNI K++LIKLW+A+G++ P 
Sbjct: 232 NEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPS 283

Length = 285

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 607
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.22
KOG4237498 consensus Extracellular matrix protein slit, conta 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG4341483 consensus F-box protein containing LRR [General fu 98.84
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.81
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.79
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
KOG4341483 consensus F-box protein containing LRR [General fu 98.57
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.28
PLN03150623 hypothetical protein; Provisional 98.27
PLN03150623 hypothetical protein; Provisional 98.24
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
PRK15386426 type III secretion protein GogB; Provisional 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.94
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.77
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.36
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.09
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.94
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.72
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.81
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.77
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.64
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.31
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.24
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.0
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.79
smart0037026 LRR Leucine-rich repeats, outliers. 90.79
smart0037026 LRR Leucine-rich repeats, outliers. 88.69
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.69
PRK04841 903 transcriptional regulator MalT; Provisional 86.73
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.21
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-58  Score=500.89  Aligned_cols=341  Identities=27%  Similarity=0.419  Sum_probs=282.4

Q ss_pred             CcccccCCC-cccccchHHHHHHHHhcCCChHHHHHHHHHhhccCCChhHHHHHHhcccccc----cCcCCCCchHHHHh
Q 007330            1 MFNFTSLLD-ESEKRKLLYESSKVQQGGVGIKTILHKFGNLLCLRRARKERGSSILDIEMGK----LNELENDPLAPLLL   75 (607)
Q Consensus         1 ~f~~~~~~~-~~~~~~~~~~~~~i~~~c~GlPLal~~~g~~L~~~~~~~~W~~~~~~~~~~~----l~~~~~~i~~~L~~   75 (607)
                      +|...||.. ....+.++++|++||++|+|||||++++|+.|+.|++.++| +++.+...+.    .++.++.|+++|++
T Consensus       325 LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW-~~~~~~l~s~~~~~~~~~~~~i~~iLkl  403 (889)
T KOG4658|consen  325 LFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEW-RRALNVLKSSLAADFSGMEESILPILKL  403 (889)
T ss_pred             HHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHH-HHHHccccccccCCCCchhhhhHHhhhc
Confidence            466677766 33446699999999999999999999999999999999999 9998876655    22335679999999


Q ss_pred             cccCCChhhHHHhhhhcccCCCceeChhHHHHHHHHcCCcccC-CCCcHHHHHHHHHHHHHHcCCCcccccCCCCCeeEE
Q 007330           76 SYNDFPPMIKLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPI-GNKEMEVIGQEYFDYLATRSFFQKFDKDDEDNVTRC  154 (607)
Q Consensus        76 SYd~L~~~~k~cfL~~s~fp~~~~i~~~~Li~~wi~~g~i~~~-~~~~~~~~~~~~~~~L~~~~ll~~~~~~~~~~~~~~  154 (607)
                      |||+||.++|.||||||+|||||.|+++.|+.+|+||||+.+. .++++++.|+.|+.+|+.++|++.....  ++..+|
T Consensus       404 Syd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~  481 (889)
T KOG4658|consen  404 SYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETV  481 (889)
T ss_pred             cHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cceeEE
Confidence            9999999999999999999999999999999999999999884 4688999999999999999999987654  666889


Q ss_pred             EECHHHHHHHHHhhh-----hceEEEecC-CCccccccCccCceeEEEEEeCCCCCccccccCCCCeeEEEeeccchhhh
Q 007330          155 KMSDAVHDFAQFLTK-----HEYFSIEAD-GSEESLTKTSLEKFRHSMLVLGRRASFPVSIFKAKKLRSLLIHSEFEVSF  228 (607)
Q Consensus       155 ~mhdli~~~~~~~~~-----~e~~~~~~~-~~~~~~~~~~~~~~r~l~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~  228 (607)
                      +|||+||+||.++++     .++.+...+ +....+....+..+|+++++++....++. -..+++|++|.+.++.....
T Consensus       482 kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~-~~~~~~L~tLll~~n~~~l~  560 (889)
T KOG4658|consen  482 KMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAG-SSENPKLRTLLLQRNSDWLL  560 (889)
T ss_pred             EeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccC-CCCCCccceEEEeecchhhh
Confidence            999999999999999     666555443 44445566668899999999999877443 34566899999999854345


Q ss_pred             hhhhhhhccCCceeEEEecCcccccccccccccccccCcccccEEecCCCCcccCchhhhcCCcccEeecCCCCCccccc
Q 007330          229 HVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCELFNLQTLEVEHCPRLKRLP  308 (607)
Q Consensus       229 ~~~~~~~~~l~~L~~L~L~~~~~~~~~~l~~lp~~~~~l~~L~~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp  308 (607)
                      .....+|..++.|+||||++     +..+.++|+.++.|.+||||+++++.+..+|..+++|++|.+||+..+..+..+|
T Consensus       561 ~is~~ff~~m~~LrVLDLs~-----~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~  635 (889)
T KOG4658|consen  561 EISGEFFRSLPLLRVLDLSG-----NSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIP  635 (889)
T ss_pred             hcCHHHHhhCcceEEEECCC-----CCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccccccccccc
Confidence            55677799999999999996     5567889999999999999999999999999999999999999999998777777


Q ss_pred             cccccccCcccccccccccccCcCCCCCCCCCCccCcEEecC
Q 007330          309 QGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSG  350 (607)
Q Consensus       309 ~~i~~l~~L~~L~~~~~~l~~lp~~i~~l~~L~~L~~~~~~~  350 (607)
                      ..+..|++|++|.+.+.....-...++.+.+|++|..+....
T Consensus       636 ~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~  677 (889)
T KOG4658|consen  636 GILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITI  677 (889)
T ss_pred             chhhhcccccEEEeeccccccchhhHHhhhcccchhhheeec
Confidence            666779999999976655322222344555666665554533

>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 6e-04
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure 
Iteration: 1

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 86/195 (44%), Gaps = 20/195 (10%)
Query: 201 RRASFPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAI 260
           R AS P  I    ++  L +H           G+FD L  L+ L +      G N + A+
Sbjct: 30  RHASVPAGIPTNAQI--LYLHDNQITKLE--PGVFDSLINLKELYL------GSNQLGAL 79
Query: 261 PKEK-EKLVHLRYLKLSLLMREELPDIVCE-LFNLQTLEVEHCPRLKRLPQGIGKLVNLR 318
           P    + L  L  L L       LP  V + L +L+ L +  C +L  LP+GI +L +L 
Sbjct: 80  PVGVFDSLTQLTVLDLGTNQLTVLPSAVFDRLVHLKELFM-CCNKLTELPRGIERLTHLT 138
Query: 319 HLIYYYSNLDYMPKG-FERLTCLRTLTEFVVSGGKYSGKACNIEGLRH--LNHLGGVFRI 375
           HL    + L  +P G F+RL+   +LT   + G  +  +  +I  LR+   +H     R 
Sbjct: 139 HLALDQNQLKSIPHGAFDRLS---SLTHAYLFGNPWDCECRDIMYLRNWVADHTSIAMRW 195
Query: 376 TGLGNVTDVDEAENA 390
            G   V D D A+ A
Sbjct: 196 DGKA-VNDPDSAKCA 209
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query607
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-27
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  116 bits (291), Expect = 2e-27
 Identities = 36/270 (13%), Positives = 66/270 (24%), Gaps = 41/270 (15%)

Query: 30  IKTILHKFGNLLCLRRARKERGSSILDIEMGKLNELENDP-----LAPLLLSYNDFPPMI 84
           +  I    G LL     R E     L  +  K     +          + +S       I
Sbjct: 324 VSLI----GALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDI 379

Query: 85  KLCFLYCAVFPKGYNIEKDELIKLWMAQGYIRPIGNKEMEVIGQEYFDYLATRSFFQKFD 144
           K  +   ++  K   +    L  LW  +               ++       +S      
Sbjct: 380 KDYYTDLSILQKDVKVPTKVLCILWDMETE-----------EVEDILQEFVNKSLLF--- 425

Query: 145 KDDEDNVTRCKMSDAVHDFAQFLTKHEYFSIEADGSEESLTKTSLEKFRHSMLVLGRRAS 204
            D      R  + D   DF       +          + L K  + +F+           
Sbjct: 426 CDRNGKSFRYYLHDLQVDFLTEKNCSQL---------QDLHKKIITQFQRYHQPHTLSPD 476

Query: 205 FPVSIFKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAI---- 260
               ++    L   +  ++       L  +F         ++ G        +       
Sbjct: 477 QEDCMYWYNFLAYHMASAKMHKELCAL--MFSLDWIKAKTELVGPAHLIHEFVEYRHILD 534

Query: 261 ---PKEKEKLVHLRYLKLSLLMREELPDIV 287
                  E       L   LL R+  P+IV
Sbjct: 535 EKDCAVSENFQEFLSLNGHLLGRQPFPNIV 564
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.53
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.5
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.5
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.45
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.26
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.24
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.22
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.18
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.99
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.72
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.21
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.2
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.11
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.67
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.53
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.21
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.73
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.88
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.46
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
Probab=99.96  E-value=1.6e-29  Score=275.15  Aligned_cols=349  Identities=16%  Similarity=0.104  Sum_probs=212.8

Q ss_pred             CceeEEEEEeCCCC-CccccccCCCCeeEEEeeccch-------------------------------------------
Q 007330          190 EKFRHSMLVLGRRA-SFPVSIFKAKKLRSLLIHSEFE-------------------------------------------  225 (607)
Q Consensus       190 ~~~r~l~l~~~~~~-~~~~~~~~~~~L~~L~l~~~~~-------------------------------------------  225 (607)
                      .+|+.+.+.++.+. .++..+..+++|++|++++|..                                           
T Consensus        81 ~~V~~L~L~~~~l~g~lp~~l~~L~~L~~L~Ls~N~~~~~~~~~~~~~~~~~~~~~~~~~l~l~l~~~~l~~~~~~~~~~  160 (636)
T 4eco_A           81 GRVTGLSLEGFGASGRVPDAIGQLTELEVLALGSHGEKVNERLFGPKGISANMSDEQKQKMRMHYQKTFVDYDPREDFSD  160 (636)
T ss_dssp             CCEEEEECTTSCCEEEECGGGGGCTTCCEEESCCGGGGGTCCSBSTTSBCTTCCHHHHHHHHTHHHHHHTCCCGGGGSCH
T ss_pred             CCEEEEEecCcccCCcCChHHhcCccceEEECcCCccccCCccccccccccCchHHHHHHHHhhHHHhhhccCchhhHHH
Confidence            56888888887765 4578888999999999988731                                           


Q ss_pred             ---------------------------------hhhhhhhhhhccCCceeEEEecCccccccccccc-------------
Q 007330          226 ---------------------------------VSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYA-------------  259 (607)
Q Consensus       226 ---------------------------------~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~l~~-------------  259 (607)
                                                       .... ++..+.++++|++|+|+      ++.+..             
T Consensus       161 ~~~~l~~~~l~~~~~~~~~~~~l~~l~l~~~~n~l~~-ip~~l~~l~~L~~L~Ls------~n~l~~~~~~~~~~~~~~~  233 (636)
T 4eco_A          161 LIKDCINSDPQQKSIKKSSRITLKDTQIGQLSNNITF-VSKAVMRLTKLRQFYMG------NSPFVAENICEAWENENSE  233 (636)
T ss_dssp             HHHHHHHHCTTSCCCCCCCCCCCCTTTTTCCSCEEEE-ECGGGGGCTTCCEEEEE------SCCCCGGGBSSSCSCTTSH
T ss_pred             HHHHHhhcCccccccccccccchhhhhhccccCCCcc-CCHHHhcccCCCEEECc------CCccccccccccccccccc
Confidence                                             0112 45568889999999999      667766             


Q ss_pred             -----cccccc--CcccccEEecCCCC-cccCchhhhcCCcccEeecCCCCCcc--ccccccccc------cCccccccc
Q 007330          260 -----IPKEKE--KLVHLRYLKLSLLM-REELPDIVCELFNLQTLEVEHCPRLK--RLPQGIGKL------VNLRHLIYY  323 (607)
Q Consensus       260 -----lp~~~~--~l~~L~~L~L~~~~-i~~lp~~i~~L~~L~~L~L~~~~~l~--~lp~~i~~l------~~L~~L~~~  323 (607)
                           +|..++  ++++|++|++++|. ...+|..++++++|++|++++|..+.  .+|..++.+      ++|++|+++
T Consensus       234 ~~~~~ip~~l~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~~l~~~~lp~~~~~L~~~~~l~~L~~L~L~  313 (636)
T 4eco_A          234 YAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEMQLINVACNRGISGEQLKDDWQALADAPVGEKIQIIYIG  313 (636)
T ss_dssp             HHHHHTTSCCCGGGCTTCCEEEEECCTTCSSCCTTTTTCSSCCEEECTTCTTSCHHHHHHHHHHHHHSGGGGTCCEEECC
T ss_pred             hhcccCchhhhhcccCCCCEEEecCCcCCccChHHHhcCCCCCEEECcCCCCCccccchHHHHhhhccccCCCCCEEECC
Confidence                 888888  99999999999988 67788889999999999999987344  588888877      899999988


Q ss_pred             ccccccCcC--CCCCCCCCCccCcEEecCCccCCCcccccccccccccCceEEEeccCCCCCHhHHHHHHhcCCCC-Ccc
Q 007330          324 YSNLDYMPK--GFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRN-VVD  400 (607)
Q Consensus       324 ~~~l~~lp~--~i~~l~~L~~L~~~~~~~~~~~~~~~~~~~l~~L~~L~~~l~i~~~~~~~~~~~~~~~~l~~~~~-L~~  400 (607)
                      .|.+..+|.  .++.+++|+.|.   ++++.+.+....+..+++|+    .+.+.+..- .    .....+..+++ |+.
T Consensus       314 ~n~l~~ip~~~~l~~l~~L~~L~---L~~N~l~g~ip~~~~l~~L~----~L~L~~N~l-~----~lp~~l~~l~~~L~~  381 (636)
T 4eco_A          314 YNNLKTFPVETSLQKMKKLGMLE---CLYNQLEGKLPAFGSEIKLA----SLNLAYNQI-T----EIPANFCGFTEQVEN  381 (636)
T ss_dssp             SSCCSSCCCHHHHTTCTTCCEEE---CCSCCCEEECCCCEEEEEES----EEECCSSEE-E----ECCTTSEEECTTCCE
T ss_pred             CCcCCccCchhhhccCCCCCEEe---CcCCcCccchhhhCCCCCCC----EEECCCCcc-c----cccHhhhhhcccCcE
Confidence            888888888  788888777766   66666552222334444443    444333210 0    11122445555 666


Q ss_pred             eEEEecCCCCCch------------------hcHHHHhhcCC-------CCCCcceEEEeecCCCCCCChhhh-cCCCcc
Q 007330          401 LGLWFDKDEEGEE------------------ADHEEIIEALK-------PHSNLVALDILGFKGKITFPKWIM-SLNNLK  454 (607)
Q Consensus       401 L~l~~~~~~~~~~------------------~~~~~~~~~l~-------~~~~L~~L~l~~~~~~~~lp~~l~-~l~~L~  454 (607)
                      |+++.|.......                  ...+..+..+.       ..++|+.|++++|.+.. +|..+. .+++|+
T Consensus       382 L~Ls~N~l~~lp~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~~~~~~~~~~~L~~L~Ls~N~l~~-lp~~~~~~l~~L~  460 (636)
T 4eco_A          382 LSFAHNKLKYIPNIFDAKSVSVMSAIDFSYNEIGSVDGKNFDPLDPTPFKGINVSSINLSNNQISK-FPKELFSTGSPLS  460 (636)
T ss_dssp             EECCSSCCSSCCSCCCTTCSSCEEEEECCSSCTTTTTTCSSCTTCSSCCCCCCEEEEECCSSCCCS-CCTHHHHTTCCCS
T ss_pred             EEccCCcCcccchhhhhcccCccCEEECcCCcCCCcchhhhcccccccccCCCCCEEECcCCccCc-CCHHHHccCCCCC
Confidence            6666665421000                  00111222222       33455555555555543 444332 355555


Q ss_pred             EEEEecCCCCCcCCCCC--------CCCCCCeeEecCCcCeeeCccccCCCCCCccCCCccceeeecccccccccccccc
Q 007330          455 SLHLRSCEKCEILSPLG--------KLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRVVDMFEWEEWGFGIT  526 (607)
Q Consensus       455 ~L~L~~~~~~~~~~~l~--------~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~  526 (607)
                      .|+|++|.....+....        .+++|++|++++|.++.++..+..      ..+++|+.|+++++ .+..++..  
T Consensus       461 ~L~Ls~N~l~~i~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~lp~~~~~------~~l~~L~~L~Ls~N-~l~~ip~~--  531 (636)
T 4eco_A          461 SINLMGNMLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLTKLSDDFRA------TTLPYLVGIDLSYN-SFSKFPTQ--  531 (636)
T ss_dssp             EEECCSSCCSBCCSSSSEETTEECTTGGGCCEEECCSSCCCBCCGGGST------TTCTTCCEEECCSS-CCSSCCCG--
T ss_pred             EEECCCCCCCCcCHHHhccccccccccCCccEEECcCCcCCccChhhhh------ccCCCcCEEECCCC-CCCCcChh--
Confidence            55555554332221111        122555555555554444433321      14556666666655 33333333  


Q ss_pred             ccCcccccccCCccceeeeec------ccCccccCCCCCCCCCcCeEEEecCcc
Q 007330          527 RSNVKEDVMVMPCLNYLDIQF------CFKLKALPGYLLEITALEKLEILCCPI  574 (607)
Q Consensus       527 ~~~~~~~~~~~~~L~~L~l~~------c~~l~~lp~~~~~l~~L~~L~l~~c~~  574 (607)
                             +..+++|++|++++      |.....+|..+..+++|++|++++|.-
T Consensus       532 -------~~~l~~L~~L~Ls~N~~ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l  578 (636)
T 4eco_A          532 -------PLNSSTLKGFGIRNQRDAQGNRTLREWPEGITLCPSLTQLQIGSNDI  578 (636)
T ss_dssp             -------GGGCSSCCEEECCSCBCTTCCBCCCCCCTTGGGCSSCCEEECCSSCC
T ss_pred             -------hhcCCCCCEEECCCCcccccCcccccChHHHhcCCCCCEEECCCCcC
Confidence                   56677777777743      333455676677777777777777754
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 607
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.2 bits (126), Expect = 3e-08
 Identities = 31/231 (13%), Positives = 65/231 (28%), Gaps = 11/231 (4%)

Query: 251 SWGQNSIYAIPKEKEKLVHLRYLKLS--LLMREELPDIVCELFNLQTLEVEHCPRLKRLP 308
              ++ +     E      ++++ LS  ++    L  I+ +   LQ L +E       + 
Sbjct: 29  RCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIV 88

Query: 309 QGIGKLVNLRHLIYYYSNLDYMPKGFERLTCLRTLTEFVVSGGKYSGKACNIEGLRHLNH 368
             + K  NL  L     +          L+    L E  +S      +      + H++ 
Sbjct: 89  NTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSE 148

Query: 369 LGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSN 428
                 ++G        +           V                   +  +     + 
Sbjct: 149 TITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVM-------LKNDCFQEFFQLNY 201

Query: 429 LVALDILGFKGKI-TFPKWIMSLNNLKSLHLRSCEKCEILSPLGK-LPSLE 477
           L  L +      I      +  +  LK+L +        L  L + LP L+
Sbjct: 202 LQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQ 252
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query607
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.23
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.19
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.02
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.98
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.75
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.74
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.74
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.53
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.2
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.81  E-value=2.5e-19  Score=180.73  Aligned_cols=326  Identities=19%  Similarity=0.224  Sum_probs=202.3

Q ss_pred             cCCCCeeEEEeeccchhhhhhhhhhhccCCceeEEEecCcccccccccccccccccCcccccEEecCCCCcccCchhhhc
Q 007330          210 FKAKKLRSLLIHSEFEVSFHVLQGLFDYLTCLRALKITGKVSWGQNSIYAIPKEKEKLVHLRYLKLSLLMREELPDIVCE  289 (607)
Q Consensus       210 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~l~~lp~~~~~l~~L~~L~L~~~~i~~lp~~i~~  289 (607)
                      .++.+|++|.+.++.  +.. +.+ +..+++|++|+++      ++.++.+|. ++++++|++|++++|.+..+++ +++
T Consensus        41 ~~l~~l~~L~l~~~~--I~~-l~g-l~~L~nL~~L~Ls------~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~~-l~~  108 (384)
T d2omza2          41 TDLDQVTTLQADRLG--IKS-IDG-VEYLNNLTQINFS------NNQLTDITP-LKNLTKLVDILMNNNQIADITP-LAN  108 (384)
T ss_dssp             HHHTTCCEEECCSSC--CCC-CTT-GGGCTTCCEEECC------SSCCCCCGG-GTTCTTCCEEECCSSCCCCCGG-GTT
T ss_pred             HHhCCCCEEECCCCC--CCC-ccc-cccCCCCCEEeCc------CCcCCCCcc-ccCCcccccccccccccccccc-ccc
Confidence            356788999998875  322 333 6788899999999      788888864 8889999999999999888865 888


Q ss_pred             CCcccEeecCCCCCccccccccccccCcccccccccccccCcCC-----------------CCCCCCCCccCcEEecCCc
Q 007330          290 LFNLQTLEVEHCPRLKRLPQGIGKLVNLRHLIYYYSNLDYMPKG-----------------FERLTCLRTLTEFVVSGGK  352 (607)
Q Consensus       290 L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~~~~~~l~~lp~~-----------------i~~l~~L~~L~~~~~~~~~  352 (607)
                      +++|+.|+++++. +..++. ......+..+....+.+..+...                 +..+.............+.
T Consensus       109 l~~L~~L~~~~~~-~~~~~~-~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (384)
T d2omza2         109 LTNLTGLTLFNNQ-ITDIDP-LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNK  186 (384)
T ss_dssp             CTTCCEEECCSSC-CCCCGG-GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSC
T ss_pred             ccccccccccccc-cccccc-ccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccc
Confidence            9999999998876 555542 33344444444333332221110                 0111111111111111111


Q ss_pred             cCCCcccccccccccccCceEEEeccCCCCCHhHHHHHHhcCCCCCcceEEEecCCCCCchhcHHHHhhcCCCCCCcceE
Q 007330          353 YSGKACNIEGLRHLNHLGGVFRITGLGNVTDVDEAENAELEKKRNVVDLGLWFDKDEEGEEADHEEIIEALKPHSNLVAL  432 (607)
Q Consensus       353 ~~~~~~~~~~l~~L~~L~~~l~i~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~~~~L~~L  432 (607)
                          .........+..+. .+.+.... +...     .....+++|+.|+++++....         ++.+..+++|+.|
T Consensus       187 ----~~~~~~~~~l~~~~-~l~l~~n~-i~~~-----~~~~~~~~L~~L~l~~n~l~~---------~~~l~~l~~L~~L  246 (384)
T d2omza2         187 ----VSDISVLAKLTNLE-SLIATNNQ-ISDI-----TPLGILTNLDELSLNGNQLKD---------IGTLASLTNLTDL  246 (384)
T ss_dssp             ----CCCCGGGGGCTTCS-EEECCSSC-CCCC-----GGGGGCTTCCEEECCSSCCCC---------CGGGGGCTTCSEE
T ss_pred             ----cccccccccccccc-eeeccCCc-cCCC-----CcccccCCCCEEECCCCCCCC---------cchhhcccccchh
Confidence                11111222233333 44443322 1221     124567788888888876522         2345667888999


Q ss_pred             EEeecCCCCCCChhhhcCCCccEEEEecCCCCCcCCCCCCCCCCCeeEecCCcCeeeCccccCCCCCCccCCCccceeee
Q 007330          433 DILGFKGKITFPKWIMSLNNLKSLHLRSCEKCEILSPLGKLPSLETLYIAGMSGKRVGDEFFGIGSDCNIAFPKLKFLRV  512 (607)
Q Consensus       433 ~l~~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l  512 (607)
                      ++.+|...+ ++. +..+++|+.|+++++.. ..++.+..++.++.+.+..|.+..+..  +       ..+++++.|++
T Consensus       247 ~l~~n~l~~-~~~-~~~~~~L~~L~l~~~~l-~~~~~~~~~~~l~~l~~~~n~l~~~~~--~-------~~~~~l~~L~l  314 (384)
T d2omza2         247 DLANNQISN-LAP-LSGLTKLTELKLGANQI-SNISPLAGLTALTNLELNENQLEDISP--I-------SNLKNLTYLTL  314 (384)
T ss_dssp             ECCSSCCCC-CGG-GTTCTTCSEEECCSSCC-CCCGGGTTCTTCSEEECCSSCCSCCGG--G-------GGCTTCSEEEC
T ss_pred             ccccCccCC-CCc-ccccccCCEeeccCccc-CCCCccccccccccccccccccccccc--c-------chhcccCeEEC
Confidence            999888776 443 67788899999988753 344557778888888888877554432  1       26778888888


Q ss_pred             ccccccccccccccccCcccccccCCccceeeeecccCccccCCCCCCCCCcCeEEEecCcchhHhhhcCCCCCCCcccc
Q 007330          513 VDMFEWEEWGFGITRSNVKEDVMVMPCLNYLDIQFCFKLKALPGYLLEITALEKLEILCCPILEQRYRKGTGEDWAKVAH  592 (607)
Q Consensus       513 ~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~lp~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~  592 (607)
                      +++ .++.+..          +..+|+|++|++++| .++.+| .+..+++|++|++++|+ ++..      ..+..+.+
T Consensus       315 s~n-~l~~l~~----------l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N~-l~~l------~~l~~l~~  374 (384)
T d2omza2         315 YFN-NISDISP----------VSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHNQ-ISDL------TPLANLTR  374 (384)
T ss_dssp             CSS-CCSCCGG----------GGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSSC-CCBC------GGGTTCTT
T ss_pred             CCC-CCCCCcc----------cccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCCc-CCCC------hhhccCCC
Confidence            876 4554431          447888888888887 577776 46778888888888774 3322      12455566


Q ss_pred             cCeeEeCce
Q 007330          593 VPTITINRQ  601 (607)
Q Consensus       593 ip~~~~~~~  601 (607)
                      +..+.+++|
T Consensus       375 L~~L~L~~N  383 (384)
T d2omza2         375 ITQLGLNDQ  383 (384)
T ss_dssp             CSEEECCCE
T ss_pred             CCEeeCCCC
Confidence            667776654
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure