Citrus Sinensis ID: 007401
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 605 | ||||||
| 449438199 | 606 | PREDICTED: outer envelope protein 64, mi | 0.998 | 0.996 | 0.710 | 0.0 | |
| 225448253 | 607 | PREDICTED: outer envelope protein 64, mi | 0.998 | 0.995 | 0.737 | 0.0 | |
| 255569802 | 607 | amidase, putative [Ricinus communis] gi| | 0.998 | 0.995 | 0.722 | 0.0 | |
| 224054324 | 599 | amidase family protein [Populus trichoca | 0.985 | 0.994 | 0.705 | 0.0 | |
| 356512046 | 603 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.995 | 0.998 | 0.695 | 0.0 | |
| 356525874 | 598 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.983 | 0.994 | 0.692 | 0.0 | |
| 30682691 | 603 | translocon at the outer membrane of chlo | 0.995 | 0.998 | 0.654 | 0.0 | |
| 356557561 | 665 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.983 | 0.894 | 0.696 | 0.0 | |
| 297806973 | 621 | hypothetical protein ARALYDRAFT_325494 [ | 0.990 | 0.964 | 0.639 | 0.0 | |
| 9955529 | 616 | putative subunit of TOC complex [Arabido | 0.995 | 0.977 | 0.640 | 0.0 |
| >gi|449438199|ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 907 bits (2343), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 430/605 (71%), Positives = 502/605 (82%), Gaps = 1/605 (0%)
Query: 1 MSKSFNIIKTNTSNPKVWVVIGVSVVGFVVLAETLRRRRNPKLNGRVDFGAFLERFELIP 60
MS ++KTN SNPK+W++IGV V G V+LAET RR RN K+ DFGAF++RFEL P
Sbjct: 1 MSNPLKLLKTNASNPKLWILIGVGVAGVVILAETRRRGRNGKVLQGEDFGAFIQRFELRP 60
Query: 61 FPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGA 120
FPQP PPAARQ LAGL FA+KDVFDVK YVTGFG+PDWKR H AE+T +VTLLLKNGA
Sbjct: 61 FPQPSPPAARQSLAGLTFAVKDVFDVKDYVTGFGNPDWKRTHDVAEKTDEMVTLLLKNGA 120
Query: 121 TCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDTI 180
C+GKTV+DE FGITGENK YGTP+NP++ S +PGGSSSGSAVAVA +LVDFALGTDT+
Sbjct: 121 ACVGKTVMDELGFGITGENKQYGTPINPKLSSFVPGGSSSGSAVAVAGELVDFALGTDTV 180
Query: 181 GCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAV 240
GC+R+PASFCGI +RPSHG + M VL NS SLDTVG AR+ S LHRVGHVLL+LN+V
Sbjct: 181 GCIRIPASFCGIFAFRPSHGVIPMNRVLSNSPSLDTVGWFARDPSTLHRVGHVLLKLNSV 240
Query: 241 EPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIASNVPSLKG 300
EPRR RRL+ ADD+FQLSKVP KT+HV+ KAIE+LSGYQ+P+HMN G+Y+ASNVPSLKG
Sbjct: 241 EPRRMRRLVIADDLFQLSKVPLQKTVHVVEKAIENLSGYQSPKHMNFGEYLASNVPSLKG 300
Query: 301 LRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRLGYNVFERVLEAINTT 360
QS + + G LKALSSVM+ LQR EFK +EEW+KS KP+LG N E VL AI T+
Sbjct: 301 FHNQSPTLQKGITILKALSSVMILLQRSEFKINHEEWIKSVKPKLGSNASEDVLAAIKTS 360
Query: 361 QDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTYSAEFHDRTLVLSSI 420
D+IK LYKVR E R AL+ LLKDD ILVIPTV+DPP K +TKK ++EF DRT LSSI
Sbjct: 361 YDDIKTLYKVRMETRIALKSLLKDDGILVIPTVADPPPKFSTKKGIASEFRDRTFALSSI 420
Query: 421 GSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDSLQEQVNIAS-NLVPL 479
SMSGCC+VA+P+GK ++ PISIS IT+HG DKFLLDTVLD++ +LQEQV +AS NL+P
Sbjct: 421 SSMSGCCEVAVPLGKQDDCPISISLITFHGADKFLLDTVLDIFSALQEQVGVASNNLLPF 480
Query: 480 PDTNGSIDASELLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTSATYYSNRAAAYLELGCF 539
DTNG +DASELLKEKGNAAFKG+QWNKAVNYY++AIKLNGT+ATYY NRAAAYLELGCF
Sbjct: 481 ADTNGDMDASELLKEKGNAAFKGRQWNKAVNYYTDAIKLNGTNATYYCNRAAAYLELGCF 540
Query: 540 QQAEEDCSKTISLDKKNVKAYLRRGTAREALFCYNEALQDFKHAMVLEPQNKAANLAEKR 599
QQAE+DCSK I LDKK VKAYLRRGTARE+L Y EA++DFKHA+VLEPQNK ANLAEKR
Sbjct: 541 QQAEDDCSKAILLDKKTVKAYLRRGTARESLLLYKEAIKDFKHALVLEPQNKVANLAEKR 600
Query: 600 LRKLI 604
L+KLI
Sbjct: 601 LQKLI 605
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225448253|ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitochondrial [Vitis vinifera] gi|296086830|emb|CBI32979.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255569802|ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|223534870|gb|EEF36559.1| amidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224054324|ref|XP_002298203.1| amidase family protein [Populus trichocarpa] gi|222845461|gb|EEE83008.1| amidase family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356512046|ref|XP_003524732.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356525874|ref|XP_003531546.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30682691|ref|NP_196504.2| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis thaliana] gi|357580466|sp|F4KCL7.1|OE64M_ARATH RecName: Full=Outer envelope protein 64, mitochondrial; AltName: Full=Mitochondrial outer membrane protein 64; Short=mtOM64; AltName: Full=Translocon at the outer membrane of chloroplasts 64-V; Short=AtTOC64-V gi|332004008|gb|AED91391.1| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356557561|ref|XP_003547084.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297806973|ref|XP_002871370.1| hypothetical protein ARALYDRAFT_325494 [Arabidopsis lyrata subsp. lyrata] gi|297317207|gb|EFH47629.1| hypothetical protein ARALYDRAFT_325494 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|9955529|emb|CAC05468.1| putative subunit of TOC complex [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 605 | ||||||
| TAIR|locus:2184757 | 603 | TOC64-V "AT5G09420" [Arabidops | 0.995 | 0.998 | 0.604 | 6.3e-195 | |
| UNIPROTKB|Q9MUK5 | 593 | TOC64 "Translocon at the outer | 0.919 | 0.937 | 0.5 | 2.9e-142 | |
| TAIR|locus:2088600 | 589 | TOC64-III "translocon at the o | 0.945 | 0.971 | 0.487 | 4.9e-140 | |
| TAIR|locus:2036029 | 425 | AMI1 "AT1G08980" [Arabidopsis | 0.676 | 0.962 | 0.444 | 3.3e-86 | |
| UNIPROTKB|Q60AB7 | 341 | MCA0950 "Amidase family protei | 0.203 | 0.360 | 0.520 | 4.9e-41 | |
| CGD|CAL0003013 | 450 | orf19.3956 [Candida albicans ( | 0.276 | 0.371 | 0.333 | 3.5e-22 | |
| TIGR_CMR|CBU_1474 | 483 | CBU_1474 "glutamyl-tRNA(Gln) a | 0.297 | 0.372 | 0.356 | 9.7e-21 | |
| SGD|S000004907 | 464 | HER2 "Subunit of the trimeric | 0.277 | 0.362 | 0.375 | 2.7e-20 | |
| TIGR_CMR|CJE_1202 | 453 | CJE_1202 "aspartyl/glutamyl-tR | 0.687 | 0.918 | 0.233 | 3.8e-19 | |
| UNIPROTKB|Q936X3 | 457 | atzE "Biuret hydrolase" [Pseud | 0.244 | 0.323 | 0.395 | 6.6e-19 |
| TAIR|locus:2184757 TOC64-V "AT5G09420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1888 (669.7 bits), Expect = 6.3e-195, P = 6.3e-195
Identities = 366/605 (60%), Positives = 456/605 (75%)
Query: 1 MSKSFNIIKTNTSNPKXXXXXXXXXXXXXXLAETLRRRRNPKLNGRVDFGAFLERFELIX 60
MS + ++I++N SNPK LAET R+RR L DFGAFL+RFEL+
Sbjct: 1 MSNTLSLIQSNASNPKVWVVIGVTVAGIVILAET-RKRRIRALREE-DFGAFLDRFELLP 58
Query: 61 XXXXXXXXXXXXLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGA 120
L+GL F+I D FDVK Y+TGFG P WK+ H AE+TAVVVT LLKNGA
Sbjct: 59 FPPPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQWKKTHEAAEKTAVVVTTLLKNGA 118
Query: 121 TCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPXXXXXXXXXXXXXQLVDFALGTDTI 180
TC+GKT++DE FGI GENKHYGTP+NP MP ++P +LVDF+LG DT
Sbjct: 119 TCVGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGCSSGSAVSVGAELVDFSLGIDTT 178
Query: 181 GCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAV 240
G VRVPA+FCGILG+RPS GTVS +GVLPNSQSL+TVG A + S+L +VGH LL L+AV
Sbjct: 179 GGVRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVGWFASDPSVLCQVGHALLNLSAV 238
Query: 241 EPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIASNVPSLKG 300
RR R LIFADD+F+LS +PK K++ V+ KAIE+LSGY+ P+H+NVGQY+ASNVPSL
Sbjct: 239 THRRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSGYKTPKHVNVGQYVASNVPSLAE 298
Query: 301 LRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRLGYNVFERVLEAINTT 360
QS +N +TL+ALSSVML++QR+EFKT +EEW ++ K LG V+ A+ +
Sbjct: 299 FCEQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWWQTCKSFLGPRFSNDVVTALKSK 358
Query: 361 QDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTYSA-EFHDRTLVLSS 419
++IK LY+V+NEMRA +Q LLK+D ILVIPTV+DPP +LNTK+ S EF DRT LS
Sbjct: 359 NESIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPPRLNTKRNKSLNEFLDRTYALSC 418
Query: 420 IGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDSLQEQVNIASNLVPL 479
I SMSGCCQV IP+G++ + PIS+S +TY+GGDKFLLDT LD+Y SLQ+Q +ASNL P+
Sbjct: 419 IASMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLDTTLDVYASLQDQAKLASNLAPV 478
Query: 480 PDTNGSIDASELLKEKGNAAFKGKQWNKAVNYYSEAIKLNGTSATYYSNRAAAYLELGCF 539
DTNG+++ASE++KEKGNAA+KGKQWNKAVN+Y+EAIKLNG +ATYY NRAAA+LEL CF
Sbjct: 479 SDTNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAFLELCCF 538
Query: 540 QQAEEDCSKTISLDKKNVKAYLRRGTAREALFCYNEALQDFKHAMVLEPQNKAANLAEKR 599
QQAE+DC+K + +DKKNVKAYLRRGTARE+L Y EA DF+HA+VLEPQNK A +AEKR
Sbjct: 539 QQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKR 598
Query: 600 LRKLI 604
LRK I
Sbjct: 599 LRKHI 603
|
|
| UNIPROTKB|Q9MUK5 TOC64 "Translocon at the outer membrane of chloroplasts 64" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2088600 TOC64-III "translocon at the outer membrane of chloroplasts 64-III" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036029 AMI1 "AT1G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60AB7 MCA0950 "Amidase family protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003013 orf19.3956 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1474 CBU_1474 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004907 HER2 "Subunit of the trimeric GatFAB AmidoTransferase(AdT) complex" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_1202 CJE_1202 "aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q936X3 atzE "Biuret hydrolase" [Pseudomonas sp. ADP (taxid:47660)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 605 | |||
| PLN02722 | 422 | PLN02722, PLN02722, indole-3-acetamide amidohydrol | 1e-164 | |
| PRK08310 | 395 | PRK08310, PRK08310, amidase; Provisional | 1e-116 | |
| COG0154 | 475 | COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransf | 2e-70 | |
| pfam01425 | 431 | pfam01425, Amidase, Amidase | 1e-59 | |
| TIGR00132 | 460 | TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) a | 7e-51 | |
| PRK00012 | 459 | PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransf | 5e-48 | |
| PRK09201 | 465 | PRK09201, PRK09201, amidase; Provisional | 2e-47 | |
| PRK07056 | 454 | PRK07056, PRK07056, amidase; Provisional | 1e-46 | |
| PRK06102 | 452 | PRK06102, PRK06102, hypothetical protein; Provisio | 8e-46 | |
| TIGR02715 | 452 | TIGR02715, amido_AtzE, amidohydrolase, AtzE family | 2e-45 | |
| TIGR02713 | 561 | TIGR02713, allophanate_hyd, allophanate hydrolase | 2e-44 | |
| PRK08186 | 600 | PRK08186, PRK08186, allophanate hydrolase; Provisi | 5e-44 | |
| PRK07488 | 472 | PRK07488, PRK07488, indole acetimide hydrolase; Va | 1e-41 | |
| PRK05962 | 424 | PRK05962, PRK05962, amidase; Validated | 9e-37 | |
| PRK07139 | 439 | PRK07139, PRK07139, amidase; Provisional | 4e-31 | |
| PRK06170 | 490 | PRK06170, PRK06170, amidase; Provisional | 1e-28 | |
| PRK07235 | 502 | PRK07235, PRK07235, amidase; Provisional | 2e-28 | |
| PRK07486 | 484 | PRK07486, PRK07486, amidase; Provisional | 5e-26 | |
| PRK06169 | 466 | PRK06169, PRK06169, putative amidase; Provisional | 1e-24 | |
| PRK12470 | 462 | PRK12470, PRK12470, amidase; Provisional | 2e-23 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 2e-23 | |
| PRK06061 | 483 | PRK06061, PRK06061, amidase; Provisional | 3e-23 | |
| PRK07869 | 468 | PRK07869, PRK07869, amidase; Provisional | 3e-22 | |
| PRK08137 | 497 | PRK08137, PRK08137, amidase; Provisional | 8e-22 | |
| PRK06707 | 536 | PRK06707, PRK06707, amidase; Provisional | 6e-21 | |
| PRK07487 | 469 | PRK07487, PRK07487, amidase; Provisional | 4e-20 | |
| PRK06828 | 491 | PRK06828, PRK06828, amidase; Provisional | 6e-18 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 2e-16 | |
| PRK11910 | 615 | PRK11910, PRK11910, amidase; Provisional | 2e-15 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 3e-15 | |
| PRK07042 | 464 | PRK07042, PRK07042, amidase; Provisional | 5e-14 | |
| PRK06565 | 566 | PRK06565, PRK06565, amidase; Validated | 6e-14 | |
| PRK06529 | 482 | PRK06529, PRK06529, amidase; Provisional | 8e-13 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 2e-12 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 4e-10 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 5e-09 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 7e-08 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 2e-07 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 5e-06 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 2e-05 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 1e-04 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 3e-04 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 0.001 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 0.001 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 0.002 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 0.002 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 0.003 | |
| pfam13431 | 34 | pfam13431, TPR_17, Tetratricopeptide repeat | 0.003 |
| >gnl|CDD|166363 PLN02722, PLN02722, indole-3-acetamide amidohydrolase | Back alignment and domain information |
|---|
Score = 475 bits (1225), Expect = e-164
Identities = 213/421 (50%), Positives = 277/421 (65%), Gaps = 6/421 (1%)
Query: 48 DFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAER 107
D+GAF+E+F L P + PL GL FA+KD+FDV+GYVTGFG+PDW R H A
Sbjct: 6 DYGAFMEKFVL----SPTSSSHDLPLHGLTFAVKDIFDVEGYVTGFGNPDWARTHSAATS 61
Query: 108 TAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVA 167
TA V +L+ GATC+GKT++DE A+ I GEN HYGTP NP P +PGGSSSGSAVAV
Sbjct: 62 TAPAVLAVLRGGATCVGKTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVG 121
Query: 168 AQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASIL 227
A+LVDF+LGTDT G VRVPAS+CGI G+RPSHG VS +GV+P +QS DTVG AR+ IL
Sbjct: 122 AKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTVGVIPMAQSFDTVGWFARDPVIL 181
Query: 228 HRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQN-PEHMN 286
RVGHVLLQ V P + ++I A+D FQLS +P + + V+ K++E L G + +H+N
Sbjct: 182 KRVGHVLLQQPDVNPIKPSQIIIAEDCFQLSSIPHDRLVQVLVKSVEKLFGGGDIVKHVN 241
Query: 287 VGQYIASNVPSLKG-LRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRL 345
+G Y+ VPSLK + + E +L ALSS M LQRYEFK + EW+ + KP
Sbjct: 242 LGDYVEDKVPSLKHFMSKEIKEQEYNIPSLAALSSAMRLLQRYEFKINHGEWITAVKPEF 301
Query: 346 GYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKT 405
G + ER+ EA+ TT++ I V+ E+RAAL LL + +LVIPTV PP KL T
Sbjct: 302 GPGISERIWEAVRTTEEKIDACQSVKTELRAALTTLLGEFGVLVIPTVPGPPPKLQADPT 361
Query: 406 YSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDS 465
F R L SI +SG CQV+IP+G ++ P+S+S + HG D FLL+ V LY +
Sbjct: 362 TLESFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVSVSLLAKHGSDGFLLNLVESLYGT 421
Query: 466 L 466
+
Sbjct: 422 I 422
|
Length = 422 |
| >gnl|CDD|181375 PRK08310, PRK08310, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223232 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216494 pfam01425, Amidase, Amidase | Back alignment and domain information |
|---|
| >gnl|CDD|232842 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234572 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236409 PRK09201, PRK09201, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235921 PRK07056, PRK07056, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235698 PRK06102, PRK06102, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233982 TIGR02715, amido_AtzE, amidohydrolase, AtzE family | Back alignment and domain information |
|---|
| >gnl|CDD|233981 TIGR02713, allophanate_hyd, allophanate hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|236177 PRK08186, PRK08186, allophanate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236030 PRK07488, PRK07488, indole acetimide hydrolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235945 PRK07139, PRK07139, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235723 PRK06170, PRK06170, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235979 PRK07235, PRK07235, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236028 PRK07486, PRK07486, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180437 PRK06169, PRK06169, putative amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171524 PRK12470, PRK12470, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|235686 PRK06061, PRK06061, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181154 PRK07869, PRK07869, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236161 PRK08137, PRK08137, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235855 PRK06707, PRK06707, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236029 PRK07487, PRK07487, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180715 PRK06828, PRK06828, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|183377 PRK11910, PRK11910, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|235915 PRK07042, PRK07042, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180626 PRK06565, PRK06565, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180608 PRK06529, PRK06529, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 605 | |||
| COG0154 | 475 | GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A su | 100.0 | |
| PLN02722 | 422 | indole-3-acetamide amidohydrolase | 100.0 | |
| TIGR02715 | 452 | amido_AtzE amidohydrolase, AtzE family. Members of | 100.0 | |
| PRK09201 | 465 | amidase; Provisional | 100.0 | |
| PRK06102 | 452 | hypothetical protein; Provisional | 100.0 | |
| PRK06169 | 466 | putative amidase; Provisional | 100.0 | |
| PRK07487 | 469 | amidase; Provisional | 100.0 | |
| PRK07056 | 454 | amidase; Provisional | 100.0 | |
| PRK05962 | 424 | amidase; Validated | 100.0 | |
| PRK07486 | 484 | amidase; Provisional | 100.0 | |
| PRK07042 | 464 | amidase; Provisional | 100.0 | |
| PRK06170 | 490 | amidase; Provisional | 100.0 | |
| PRK12470 | 462 | amidase; Provisional | 100.0 | |
| TIGR00132 | 460 | gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) | 100.0 | |
| PRK08310 | 395 | amidase; Provisional | 100.0 | |
| PRK07235 | 502 | amidase; Provisional | 100.0 | |
| PRK07488 | 472 | indole acetimide hydrolase; Validated | 100.0 | |
| PRK00012 | 459 | gatA aspartyl/glutamyl-tRNA amidotransferase subun | 100.0 | |
| PRK06529 | 482 | amidase; Provisional | 100.0 | |
| PRK06061 | 483 | amidase; Provisional | 100.0 | |
| PRK07869 | 468 | amidase; Provisional | 100.0 | |
| PRK08186 | 600 | allophanate hydrolase; Provisional | 100.0 | |
| PRK08137 | 497 | amidase; Provisional | 100.0 | |
| PRK07139 | 439 | amidase; Provisional | 100.0 | |
| TIGR02713 | 561 | allophanate_hyd allophanate hydrolase. Allophanate | 100.0 | |
| PF01425 | 441 | Amidase: Amidase; InterPro: IPR000120 Amidase sign | 100.0 | |
| PRK06828 | 491 | amidase; Provisional | 100.0 | |
| PRK11910 | 615 | amidase; Provisional | 100.0 | |
| PRK06707 | 536 | amidase; Provisional | 100.0 | |
| PRK06565 | 566 | amidase; Validated | 100.0 | |
| KOG1211 | 506 | consensus Amidases [Translation, ribosomal structu | 100.0 | |
| KOG1212 | 560 | consensus Amidases [Translation, ribosomal structu | 100.0 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.71 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.61 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.53 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.48 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.47 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.47 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.45 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.43 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.4 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.38 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.35 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.35 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.31 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.29 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.28 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.26 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.26 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.24 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.24 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.24 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 99.23 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.21 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 99.19 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.19 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.18 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.18 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.18 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.17 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.17 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.16 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.16 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.16 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.16 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.15 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.15 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.14 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.14 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.14 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.13 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.13 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.12 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.11 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.1 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.1 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.08 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.06 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.06 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.03 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.03 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.03 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 99.03 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.02 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.01 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.99 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.99 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.99 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.98 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.98 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.97 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.96 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.95 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.93 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.93 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.93 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.92 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.92 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.9 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.9 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 98.9 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.89 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.88 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.87 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.86 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.85 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.84 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 98.82 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.81 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.8 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 98.8 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.8 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.79 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.78 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.78 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.78 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.75 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.73 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.73 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.72 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.71 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.7 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.7 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.69 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.65 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.65 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.64 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.64 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.62 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.62 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.61 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.61 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.61 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.61 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.6 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.59 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.58 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.56 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.54 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.54 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.54 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.54 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.53 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.49 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.48 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.48 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.48 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.46 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.45 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.44 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.43 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.43 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.42 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.41 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.4 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.4 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.38 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.37 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.36 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.33 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.33 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.31 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.3 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.29 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.29 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.28 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.27 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.26 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.22 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.2 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.19 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.18 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.16 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.16 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.15 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.13 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.13 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.09 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.07 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.06 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 98.06 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.04 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.0 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 97.99 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.98 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.97 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.97 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.97 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.96 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.95 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.95 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.94 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.91 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.9 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.9 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.86 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.85 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.79 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.78 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.78 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.77 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.75 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.75 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.74 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.73 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.72 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.71 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.71 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.7 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.65 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.62 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.61 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.52 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.5 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.44 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.4 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.39 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.34 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.33 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.29 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.28 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.28 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.26 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.21 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.2 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.2 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.19 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.19 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.17 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.16 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 97.16 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.11 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.09 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.06 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.03 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.98 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 96.95 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.92 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 96.92 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 96.91 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.91 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.88 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.79 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.78 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.78 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.76 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 96.73 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 96.73 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.71 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 96.68 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.66 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.56 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 96.55 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 96.55 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.53 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.5 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.48 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 96.48 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.44 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.44 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 96.42 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.41 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.39 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.39 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 96.39 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.34 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.3 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.27 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.22 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 96.22 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 96.22 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.22 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 96.21 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 96.2 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 96.13 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.07 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.05 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 96.03 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 96.0 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 95.99 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 95.98 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.92 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.92 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 95.9 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.89 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.83 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 95.81 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 95.77 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 95.74 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 95.72 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 95.53 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 95.45 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 95.33 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 95.28 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 95.22 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 95.19 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 95.14 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 95.11 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 95.1 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 95.1 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 95.07 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 95.06 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 94.94 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 94.81 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 94.81 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 94.7 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 94.65 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 94.6 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 94.33 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 93.99 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 93.9 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 93.67 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 93.48 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 93.42 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 93.35 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 93.24 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.23 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 93.18 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 92.91 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 92.89 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 92.82 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 92.82 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 92.58 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 92.31 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 92.24 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 92.21 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 92.17 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 92.06 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 91.81 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 91.77 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 91.59 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 91.2 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 91.18 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 90.95 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 90.69 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 90.64 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 90.46 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 90.42 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 90.3 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 90.2 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 90.09 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 89.77 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 89.3 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 89.15 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 88.68 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 88.67 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 88.61 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 88.3 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 88.28 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 88.28 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 88.13 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 88.11 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 87.71 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 87.58 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 87.47 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 87.37 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 87.32 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 87.29 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 87.11 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 86.98 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 86.45 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 86.33 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 85.57 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 85.36 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 85.15 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 85.03 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 84.58 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 84.58 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 84.26 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 83.88 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 83.58 | |
| KOG3807 | 556 | consensus Predicted membrane protein ST7 (tumor su | 83.49 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 82.88 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 82.26 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 82.11 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 82.0 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 81.96 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 81.87 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 81.83 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 81.15 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 81.14 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 80.89 |
| >COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8e-90 Score=722.77 Aligned_cols=422 Identities=27% Similarity=0.335 Sum_probs=340.3
Q ss_pred HHHHhhhh-----HHHHHHHHHhhcCcccCCCCcCceeeecccCCCC--CCC-------CCCCCCCCCCceEEEeeccCC
Q 007401 21 IGVSVVGF-----VVLAETLRRRRNPKLNGRVDFGAFLERFELIPFP--QPP-------PPAARQPLAGLKFAIKDVFDV 86 (605)
Q Consensus 21 ~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~a~~--~a~-------~~~~~gpL~Gvp~~vKD~~~~ 86 (605)
++.+|++. +|++|+++.+++||++.|+.+|||+....+.++. +|+ .+...|||+||||+|||||+|
T Consensus 8 ~~~~l~~~~~~~~~s~~e~~~~~l~ri~~~~~~~na~~~~~~e~a~~~~~A~~~d~~~~~g~~~gpL~GvPiavKDn~~~ 87 (475)
T COG0154 8 TAAELAALLRAKELSAVELVEAYLARIEALNPDLNAFVAVDPEAALALAEAAAADARLAAGEPLGPLAGVPIAVKDNIDT 87 (475)
T ss_pred hHHHHHHHHHcCCCCHHHHHHHHHHHHHHhCCCCCEEEEeChhhcchHHHHHHHHHHHhcCCCCCCcCCceEEEeecccc
Confidence 45555543 9999999999999999999999999999887643 332 235578999999999999999
Q ss_pred CCcccCCCchhhhhcCCCCCCChHHHHHHHhCCCeEeeecccccccccCCCCCCCCCCCCCCCCCCCCCCCCchHHHHHH
Q 007401 87 KGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAV 166 (605)
Q Consensus 87 ~G~~tt~Gs~~~~~~~~~~~~da~~V~rL~~aGai~~GKt~~~e~~~~~~~~n~~~G~~~NP~~~~~~~GGSSgGsaaaV 166 (605)
+|++||+||+.+.+ +++.+||++|+||++|||||+||||||||+|+.+|+|++||+|+||||++|+||||||||||||
T Consensus 88 ~G~~Tt~gS~~l~~--~~p~~DA~vV~rL~~aGaviiGKTNm~Efa~g~~~~~s~~G~t~NP~~~~~~pGGSSgGSAaAV 165 (475)
T COG0154 88 AGLPTTAGSKALED--YVPPYDATVVERLRAAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWNLERVPGGSSGGSAAAV 165 (475)
T ss_pred CCCccCccChhhcc--CCCCcCcHHHHHHHHCCCEEEeecCCchhhcCCCCCCCCCCCCCCCCCCCCCCCcCchHHHHHH
Confidence 99999999999975 6779999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcCCceeeccCCCCccchhhhhcccccccCCCCCccCCCCccCCCCCccccccccCHHHHHHHHHHHccCCCCC-----
Q 007401 167 AAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVE----- 241 (605)
Q Consensus 167 Aag~~~~a~GtD~gGSiR~PAa~~Gv~GlkPt~G~v~~~G~~p~~~~~d~~G~~ar~~~d~~~v~~~~~~~~~~~----- 241 (605)
|+|++++|||||||||||+|||||||||||||+||||+.|++|+++|+|++|||+|||+|++.+++++.+.+..+
T Consensus 166 Aag~~~~alGSDtGGSIR~PAa~cGvvGlKPT~Grvsr~g~~~~a~sld~~GplartV~D~a~l~~v~~g~D~~d~~~~~ 245 (475)
T COG0154 166 AAGLVPLALGSDTGGSIRIPAAFCGLVGLKPTYGRVSRYGVVPLASSLDQIGPLARTVRDAALLLDVIAGPDPRDSPLPP 245 (475)
T ss_pred HhCCcchhcccCCCCchhhhhhhhCceeeCCCCCccCCCCCccccCCcCccCcccCCHHHHHHHHHHHcCCCCccccccc
Confidence 999999999999999999999999999999999999999999999999999999999999999999998754332
Q ss_pred ---------cccC--ceeeeccchhhhcCCchhhHHHHHHHHHHHHhCCCCCccccccccc-cccCcchhhhhhcCCCCC
Q 007401 242 ---------PRRA--RRLIFADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYI-ASNVPSLKGLRAQSTSPE 309 (605)
Q Consensus 242 ---------~~~~--~~l~~~~~~~~~~~~~~~~~~~~~~~a~~~l~g~~~~~~~~l~~~v-~~~~p~~~~~~~~~~~~~ 309 (605)
..+. .++.++.+.... ....+++.+.+.++++.|+..+ +.+ +..+|.+.....
T Consensus 246 ~~~~~~~~~~~~~~~lrigv~~~~~~~-~~~~~~v~~~~~~a~~~l~~~G--------a~v~~v~lp~~~~~~~------ 310 (475)
T COG0154 246 PPPVPPALAGKDLKGLRIGVPKELGGG-GPLDPDVRAAFEAAVKALEAAG--------AEVVEVSLPLLSDDYA------ 310 (475)
T ss_pred ccCccchhhccCCCCcEEEEECccccc-CCCcHHHHHHHHHHHHHHHHCC--------CEEEeccCCchhhhhh------
Confidence 1112 345555554321 1234689999999999996333 222 334443221000
Q ss_pred CchhHHHHHHHHHHHhhhhhhHhhHHH--HHHhcCCCCChhHHHHHHHHhcCCHHHHHHHHHHHHHH---HHHHHHHhCC
Q 007401 310 NGTATLKALSSVMLSLQRYEFKTIYEE--WVKSAKPRLGYNVFERVLEAINTTQDNIKILYKVRNEM---RAALQRLLKD 384 (605)
Q Consensus 310 ~~~~~~~~~~~~~~~l~~~e~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~a~~~r~~~---~~~~~~~~~~ 384 (605)
...+. ......+.+..+.. +.......+++++++++..|..++..+|..+...|... ++.+.++|++
T Consensus 311 -----~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~ri~~G~~~~~~~~~~a~~~~~~~~~i~~~~~~~f~~ 382 (475)
T COG0154 311 -----LAAYY---LARFDGERYGLRAADLYGKTRAEGFGPEVKRRIMLGTYLLSAGYYDAYYRRAQKTLIRRAFDKLFEE 382 (475)
T ss_pred -----hhHHH---HHHhhhhhhhhcchhhhhhhhhhcccHHHHHHHhccccccchHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 00000 00000011111111 44555677999999999999999999999998888555 9999999999
Q ss_pred CcEEEEeCCCCCCccCCc-cc-ccchhhhhchhhhcccccccCCceeeeecccC-CCCCceeEEeeccCCchhHHhHHHH
Q 007401 385 DKILVIPTVSDPPLKLNT-KK-TYSAEFHDRTLVLSSIGSMSGCCQVAIPIGKY-NEHPISISFITYHGGDKFLLDTVLD 461 (605)
Q Consensus 385 ~Dvll~Pt~~~~ap~~~~-~~-~~~~~~~~~~~~~t~~~nl~G~PaisvP~G~~-~glp~g~~~~~~~~~d~~ll~~a~~ 461 (605)
||+||+||+|.+||++++ .. .........+..+|.++|++|+|++|||+|++ +|||+|+|+++++++|..|++++..
T Consensus 383 ~D~ll~Pt~~~~a~~ig~~~~~~~~~~~~~~~~~~t~~~Nl~G~PaisvP~g~~~~GlPvGlqlig~~~~d~~LL~~a~~ 462 (475)
T COG0154 383 VDVLLTPTTPTPAPKIGESESDGDDPLEMYLLDVFTVPANLAGLPAISVPAGFTADGLPVGLQLIGPAFDDATLLRLAAA 462 (475)
T ss_pred CCEEEeCCCCCCCcccccccccccCHHHHhhhccccccccccCCCeEEeccCCCCCCCCeeEEEecCCCCHHHHHHHHHH
Confidence 999999999999999997 21 11111222233589999999999999999998 5999999999999999999999999
Q ss_pred HHhHHH
Q 007401 462 LYDSLQ 467 (605)
Q Consensus 462 l~~~~~ 467 (605)
+++...
T Consensus 463 ~E~~~~ 468 (475)
T COG0154 463 LEQALG 468 (475)
T ss_pred HHHhhC
Confidence 988543
|
|
| >PLN02722 indole-3-acetamide amidohydrolase | Back alignment and domain information |
|---|
| >TIGR02715 amido_AtzE amidohydrolase, AtzE family | Back alignment and domain information |
|---|
| >PRK09201 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06102 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06169 putative amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07487 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07056 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK05962 amidase; Validated | Back alignment and domain information |
|---|
| >PRK07486 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07042 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06170 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK12470 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit | Back alignment and domain information |
|---|
| >PRK08310 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07235 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07488 indole acetimide hydrolase; Validated | Back alignment and domain information |
|---|
| >PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK06529 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06061 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07869 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK08186 allophanate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08137 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07139 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02713 allophanate_hyd allophanate hydrolase | Back alignment and domain information |
|---|
| >PF01425 Amidase: Amidase; InterPro: IPR000120 Amidase signature (AS) enzymes are a large group of hydrolytic enzymes that contain a conserved stretch of approximately 130 amino acids known as the AS sequence | Back alignment and domain information |
|---|
| >PRK06828 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK11910 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06707 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06565 amidase; Validated | Back alignment and domain information |
|---|
| >KOG1211 consensus Amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1212 consensus Amidases [Translation, ribosomal structure and biogenesis; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 605 | ||||
| 2dc0_A | 434 | Crystal Structure Of Amidase Length = 434 | 1e-23 | ||
| 3h0l_A | 478 | Structure Of Trna-Dependent Amidotransferase Gatcab | 5e-19 | ||
| 3kfu_E | 471 | Crystal Structure Of The Transamidosome Length = 47 | 6e-19 | ||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 1e-18 | ||
| 2bug_A | 140 | Solution Structure Of The Tpr Domain From Protein P | 1e-18 | ||
| 1a17_A | 166 | Tetratricopeptide Repeats Of Protein Phosphatase 5 | 1e-18 | ||
| 4gyr_A | 621 | Granulibacter Bethesdensis Allophanate Hydrolase Ap | 2e-17 | ||
| 3al0_A | 475 | Crystal Structure Of The Glutamine Transamidosome F | 9e-17 | ||
| 2df4_A | 485 | Structure Of Trna-Dependent Amidotransferase Gatcab | 1e-16 | ||
| 2vyi_A | 131 | Crystal Structure Of The Tpr Domain Of Human Sgt Le | 2e-14 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 2e-14 | ||
| 2gi3_A | 476 | Crystal Structure Of Glutamyl-Trna(Gln) Amidotransf | 3e-14 | ||
| 3a1i_A | 521 | Crystal Structure Of Rhodococcus Sp. N-771 Amidase | 1e-13 | ||
| 3a1k_A | 521 | Crystal Structure Of Rhodococcus Sp. N771 Amidase L | 2e-13 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 2e-13 | ||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 5e-13 | ||
| 1obl_A | 414 | Crystal Structure Of The S133a Mutant Of Malonamida | 8e-13 | ||
| 1o9o_A | 414 | Crystal Structure Of The S131a Mutant Of Malonamida | 8e-13 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 5e-12 | ||
| 1obk_A | 414 | Crystal Structure Of The R158q Mutant Of Malonamida | 7e-12 | ||
| 1ock_A | 412 | The Crystal Structure Of Malonamidase E2 From Brady | 7e-12 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 7e-12 | ||
| 1o9q_A | 414 | Crystal Structure Of The S155c Mutant Of Malonamida | 9e-12 | ||
| 1obj_A | 414 | Crystal Structure Of The T150a Mutant Of Malonamida | 3e-11 | ||
| 1o9n_A | 414 | Crystal Structure Of The K62a Mutant Of Malonamidas | 3e-11 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 4e-11 | ||
| 1obi_A | 414 | Crystal Structure Of The G130a Mutant Of Malonamida | 1e-10 | ||
| 1m21_A | 503 | Crystal Structure Analysis Of The Peptide Amidase P | 1e-10 | ||
| 1elw_A | 118 | Crystal Structure Of The Tpr1 Domain Of Hop In Comp | 5e-10 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 7e-10 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 7e-10 | ||
| 3sz7_A | 164 | Crystal Structure Of The Sgt2 Tpr Domain From Asper | 2e-09 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 5e-09 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 6e-09 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 6e-09 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 1e-08 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 2e-08 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 3e-08 | ||
| 1elr_A | 131 | Crystal Structure Of The Tpr2a Domain Of Hop In Com | 5e-08 | ||
| 3uq3_A | 258 | Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = | 6e-08 | ||
| 3esk_A | 129 | Structure Of Hop Tpr2a Domain In Complex With The N | 9e-08 | ||
| 2gw1_A | 514 | Crystal Structure Of The Yeast Tom70 Length = 514 | 2e-07 | ||
| 4gcn_A | 127 | N-Terminal Domain Of Stress-Induced Protein-1 (Sti- | 2e-07 | ||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 4e-07 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 4e-07 | ||
| 3fwv_A | 128 | Crystal Structure Of A Redesigned Tpr Protein, T-Mo | 6e-07 | ||
| 3rkv_A | 162 | C-Terminal Domain Of Protein C56c10.10, A Putative | 8e-07 | ||
| 3a2q_A | 493 | Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolas | 8e-07 | ||
| 1p5q_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Lengt | 1e-06 | ||
| 3a2p_A | 493 | Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolas | 1e-06 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 5e-05 | ||
| 2wap_A | 543 | 3d-Crystal Structure Of Humanized-Rat Fatty Acid Am | 2e-04 | ||
| 2wj1_A | 573 | 3d-Crystal Structure Of Humanized-Rat Fatty Acid Am | 3e-04 | ||
| 2vya_A | 587 | Crystal Structure Of Fatty Acid Amide Hydrolase Con | 3e-04 | ||
| 2if4_A | 338 | Crystal Structure Of A Multi-Domain Immunophilin Fr | 4e-04 | ||
| 4hbp_A | 550 | Crystal Structure Of Faah In Complex With Inhibitor | 8e-04 |
| >pdb|2DC0|A Chain A, Crystal Structure Of Amidase Length = 434 | Back alignment and structure |
|
| >pdb|3H0L|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 478 | Back alignment and structure |
| >pdb|3KFU|E Chain E, Crystal Structure Of The Transamidosome Length = 471 | Back alignment and structure |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
| >pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 | Back alignment and structure |
| >pdb|4GYR|A Chain A, Granulibacter Bethesdensis Allophanate Hydrolase Apo Length = 621 | Back alignment and structure |
| >pdb|3AL0|A Chain A, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 475 | Back alignment and structure |
| >pdb|2DF4|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 485 | Back alignment and structure |
| >pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 | Back alignment and structure |
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
| >pdb|2GI3|A Chain A, Crystal Structure Of Glutamyl-Trna(Gln) Amidotransferase Subunit A (Tm1272) From Thermotoga Maritima At 1.80 A Resolution Length = 476 | Back alignment and structure |
| >pdb|3A1I|A Chain A, Crystal Structure Of Rhodococcus Sp. N-771 Amidase Complexed With Benzamide Length = 521 | Back alignment and structure |
| >pdb|3A1K|A Chain A, Crystal Structure Of Rhodococcus Sp. N771 Amidase Length = 521 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
| >pdb|1OBL|A Chain A, Crystal Structure Of The S133a Mutant Of Malonamidase E2 Complexed With Malonate From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1O9O|A Chain A, Crystal Structure Of The S131a Mutant Of Malonamidase E2 Complexed With Malonamate From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|1OBK|A Chain A, Crystal Structure Of The R158q Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OCK|A Chain A, The Crystal Structure Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 412 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|1O9Q|A Chain A, Crystal Structure Of The S155c Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OBJ|A Chain A, Crystal Structure Of The T150a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1O9N|A Chain A, Crystal Structure Of The K62a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|1OBI|A Chain A, Crystal Structure Of The G130a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1M21|A Chain A, Crystal Structure Analysis Of The Peptide Amidase Pam In Complex With The Competitive Inhibitor Chymostatin Length = 503 | Back alignment and structure |
| >pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 | Back alignment and structure |
| >pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 | Back alignment and structure |
| >pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 | Back alignment and structure |
| >pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 | Back alignment and structure |
| >pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 | Back alignment and structure |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
| >pdb|3FWV|A Chain A, Crystal Structure Of A Redesigned Tpr Protein, T-Mod(Vmy), In Complex With Meevf Peptide Length = 128 | Back alignment and structure |
| >pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 | Back alignment and structure |
| >pdb|3A2Q|A Chain A, Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolase Complexed With Substrate Length = 493 | Back alignment and structure |
| >pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 | Back alignment and structure |
| >pdb|3A2P|A Chain A, Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolase Length = 493 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|2WAP|A Chain A, 3d-Crystal Structure Of Humanized-Rat Fatty Acid Amide Hydrolase (Faah) Conjugated With The Drug-Like Urea Inhibitor Pf-3845 Length = 543 | Back alignment and structure |
| >pdb|2WJ1|A Chain A, 3d-Crystal Structure Of Humanized-Rat Fatty Acid Amide Hydrolase (Faah) Conjugated With 7-Phenyl-1-(4-(Pyridin-2- Yl)oxazol-2-Yl)heptan-1-One, An Alpha-Ketooxazole Length = 573 | Back alignment and structure |
| >pdb|2VYA|A Chain A, Crystal Structure Of Fatty Acid Amide Hydrolase Conjugated With The Drug-Like Inhibitor Pf-750 Length = 587 | Back alignment and structure |
| >pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 | Back alignment and structure |
| >pdb|4HBP|A Chain A, Crystal Structure Of Faah In Complex With Inhibitor Length = 550 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 605 | |||
| 1o9p_A | 414 | Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja | 4e-56 | |
| 2dc0_A | 434 | Probable amidase; structural genomics, NPPSFA, nat | 3e-50 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 6e-50 | |
| 3a2q_A | 493 | 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet | 7e-49 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 2e-48 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 2e-48 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 7e-48 | |
| 3a1k_A | 521 | Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo | 2e-47 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 2e-47 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 3e-47 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 1e-46 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 1e-46 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 4e-46 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 2e-44 | |
| 3ppm_A | 573 | Fatty-acid amide hydrolase 1; protein-inhibitor co | 5e-43 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 2e-41 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 4e-41 | |
| 3kfu_E | 471 | Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP | 2e-40 | |
| 3h0l_A | 478 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 3e-40 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 3e-40 | |
| 2gi3_A | 476 | Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 | 7e-40 | |
| 3ip4_A | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 7e-40 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 2e-38 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 6e-38 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 1e-35 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 9e-35 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 9e-33 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-30 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-23 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-22 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-16 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-15 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-30 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-23 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 8e-18 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 7e-16 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-15 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 7e-29 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-25 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-22 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 7e-17 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-12 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-27 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 9e-21 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-19 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-18 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-17 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-17 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-09 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 1e-26 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-25 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-19 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-19 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-17 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-16 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-16 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 5e-13 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 9e-12 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-04 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 1e-22 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 3e-22 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 1e-19 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 5e-11 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 6e-19 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 1e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-18 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-17 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-16 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-16 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-16 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-16 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-10 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-18 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-17 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-17 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-16 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 6e-14 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 6e-07 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 1e-17 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 6e-08 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 4e-06 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 2e-17 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 9e-10 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-17 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-12 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 5e-11 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 5e-09 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 5e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-17 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-17 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 9e-17 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-16 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-12 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-11 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-16 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 5e-15 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-12 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-07 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-16 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 4e-16 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 8e-15 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 1e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 1e-15 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 7e-15 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 8e-15 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 1e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-15 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-10 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-06 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 2e-15 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 4e-09 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 3e-15 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 4e-15 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 4e-09 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 2e-14 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 2e-10 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 2e-08 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-14 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-14 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 6e-11 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-10 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-09 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-08 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 5e-14 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-13 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 6e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 6e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-10 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-06 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 6e-14 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-13 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-12 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 6e-12 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-12 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-11 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 8e-11 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-14 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-12 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 8e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-07 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 8e-07 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-05 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 8e-14 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 9e-07 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-13 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-13 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 6e-11 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 7e-07 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 8e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 4e-13 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-12 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-08 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-13 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-13 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-10 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-08 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 4e-12 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-11 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 6e-11 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 7e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-05 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 4e-11 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 6e-11 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 4e-06 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 7e-11 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-10 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-07 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-07 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 7e-11 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 4e-10 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 2e-09 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 7e-06 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 1e-10 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 1e-06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 3e-10 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 3e-10 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 5e-10 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 6e-10 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 8e-10 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 1e-09 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 2e-07 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 6e-09 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 3e-07 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 6e-04 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 7e-09 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 9e-05 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 8e-09 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 7e-07 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 8e-09 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 2e-08 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 2e-08 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 3e-08 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 2e-07 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 4e-07 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 3e-05 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 5e-06 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 4e-04 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 1e-05 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 1e-05 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 1e-05 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 4e-04 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 2e-05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 8e-05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 9e-04 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 2e-05 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 9e-05 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 2e-04 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 5e-04 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 3e-05 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 3e-05 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 8e-05 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 4e-04 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 5e-04 |
| >1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Length = 414 | Back alignment and structure |
|---|
Score = 194 bits (495), Expect = 4e-56
Identities = 61/157 (38%), Positives = 75/157 (47%), Gaps = 8/157 (5%)
Query: 68 AARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGATCIGKTV 127
A PL G+ IKD+ D T GS + A VV +L + GAT IGKT
Sbjct: 49 QASGPLRGIAVGIKDIIDTANMPTEMGSE--IYRGWQPRSDAPVVMMLKRAGATIIGKTT 106
Query: 128 LDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDTIGCVRVPA 187
FA NP H PGG+SSGSA AV A ++ ALGT T G V PA
Sbjct: 107 TTAFASRDPTATL------NPHNTGHSPGGASSGSAAAVGAGMIPLALGTQTGGSVIRPA 160
Query: 188 SFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNA 224
++CG +PS + +GV S +LDTVGL A
Sbjct: 161 AYCGTAAIKPSFRMLPTVGVKCYSWALDTVGLFGARA 197
|
| >2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Length = 573 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 | Back alignment and structure |
|---|
| >3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 471 | Back alignment and structure |
|---|
| >3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Length = 478 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* Length = 476 | Back alignment and structure |
|---|
| >3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Length = 485 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 605 | |||
| 2dc0_A | 434 | Probable amidase; structural genomics, NPPSFA, nat | 100.0 | |
| 3ip4_A | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 100.0 | |
| 3h0l_A | 478 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 100.0 | |
| 3kfu_E | 471 | Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP | 100.0 | |
| 1o9p_A | 414 | Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja | 100.0 | |
| 3a2q_A | 493 | 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet | 100.0 | |
| 2gi3_A | 476 | Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 | 100.0 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 100.0 | |
| 3a1k_A | 521 | Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo | 100.0 | |
| 3ppm_A | 573 | Fatty-acid amide hydrolase 1; protein-inhibitor co | 100.0 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.82 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.71 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.71 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.71 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.68 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.67 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.66 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.66 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.66 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.66 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.62 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.6 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.59 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.59 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.59 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.58 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.58 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.58 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.57 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.57 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.57 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.56 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.56 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.55 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.54 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.54 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.53 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.52 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.52 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.51 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.51 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.51 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.5 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.5 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.49 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.48 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.45 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.44 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.44 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.43 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.43 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.43 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.42 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.41 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.4 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.4 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.38 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.37 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.36 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.35 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.35 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.35 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.35 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.35 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.35 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.35 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.34 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.34 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.34 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.33 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.33 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.33 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.32 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.32 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.32 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.31 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.31 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.31 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.31 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.31 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.3 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.3 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.29 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.29 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.29 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.29 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.29 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.29 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.27 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.26 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.26 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.25 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.25 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.25 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.25 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.25 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.24 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.23 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.23 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.21 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.2 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.19 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.18 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.18 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.16 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.13 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.12 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.12 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.12 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.12 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.12 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.12 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.1 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.1 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.09 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.08 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.08 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.07 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.05 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.05 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.04 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.03 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.03 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.03 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.02 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.02 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.02 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.01 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.01 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.0 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.0 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.99 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.99 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.98 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.98 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.98 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.98 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.97 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.97 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.97 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.97 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.96 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.96 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.96 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.96 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.95 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.95 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.95 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.95 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.94 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.94 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.94 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.93 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.93 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.92 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.92 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.91 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.9 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.89 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.88 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.87 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.87 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.85 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.85 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.85 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.84 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.83 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.83 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.82 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.81 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.8 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.8 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.8 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.8 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.8 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.79 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.79 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.79 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.78 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.78 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.78 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.78 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.76 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.74 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.74 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.7 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.69 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.68 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.66 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.66 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.62 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.59 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.59 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.58 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.54 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.53 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.51 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.48 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.43 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.4 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.37 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.35 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.35 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.33 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.33 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.32 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.29 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.24 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.24 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.12 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.08 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.05 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.96 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.96 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.91 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.82 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.8 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.74 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.72 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.65 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.57 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.56 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.54 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.47 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.33 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 97.3 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 97.24 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.2 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.18 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.08 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 96.84 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.68 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 96.36 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 96.33 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 95.81 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 95.17 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 94.95 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 94.69 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 94.69 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 94.6 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 94.47 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 94.28 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 93.82 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 93.11 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 92.93 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 92.6 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 92.45 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 92.01 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 91.83 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 90.42 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 88.96 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 87.87 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 87.81 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 87.4 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 84.56 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 84.4 |
| >2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-91 Score=736.81 Aligned_cols=406 Identities=28% Similarity=0.331 Sum_probs=342.7
Q ss_pred hhHHHHHHHHHhhcCcccCCCCcCceeeecccCCCCCCC-------CCCCCCCCCCceEEEeeccCCCCcccCCCchhhh
Q 007401 27 GFVVLAETLRRRRNPKLNGRVDFGAFLERFELIPFPQPP-------PPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWK 99 (605)
Q Consensus 27 ~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~a~~~a~-------~~~~~gpL~Gvp~~vKD~~~~~G~~tt~Gs~~~~ 99 (605)
+.+|++|+++.+++||++.|| +|||++..+++++++|+ .++..||||||||+|||||+++|++||+||+.|
T Consensus 13 g~~s~~el~~a~l~ri~~~~~-lna~~~~~~~~Al~~A~~~d~~~~~g~~~gpL~GvPi~vKD~~~v~G~~tt~Gs~~~- 90 (434)
T 2dc0_A 13 GRTTPLALLEEALERAKAFQD-RNALAYLDEEAARKEALALTEELRRGQVRGPLHGLPLTVKDLFPVKGMPTRAGTKAP- 90 (434)
T ss_dssp TSCCHHHHHHHHHHHHHHTGG-GCCEEEECHHHHHHHHHHHHHHHHTTCCCSTTTTCEEEEETTSCBTTBCCCTTCSSC-
T ss_pred CCCCHHHHHHHHHHHHHHhCC-CcEEEEcCHHHHHHHHHHHHHHHhcCCCCCCcCCeeEEEEeccccCCcccCCCCccc-
Confidence 449999999999999999999 99999998877766553 355679999999999999999999999999998
Q ss_pred hcCCCCCCChHHHHHHHhCCCeEeeecccccccccCCCCCCCCCCCCCCCCCCCCCCCCchHHHHHHHhcCCceeeccCC
Q 007401 100 RDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDT 179 (605)
Q Consensus 100 ~~~~~~~~da~~V~rL~~aGai~~GKt~~~e~~~~~~~~n~~~G~~~NP~~~~~~~GGSSgGsaaaVAag~~~~a~GtD~ 179 (605)
. .++.+||++|+|||+|||||+||||||||+++.+|+|++||+|+||||++|+|||||||||||||+|++|+|+||||
T Consensus 91 ~--~~a~~dA~vV~rL~~aGAii~GKTn~~Efa~~~~~~n~~~G~t~NP~~~~~~pGGSSgGsAaaVAag~~~~alGtDt 168 (434)
T 2dc0_A 91 L--PPLPEEARAVRRLREAGALLFAKTNMHEIALGITGENPWTGPVRNAVDPSRQAGGSSGGSAVAVALGIGLASLGTDT 168 (434)
T ss_dssp C--CCCCSSCHHHHHHHHTTCEEEEEECCSGGGCCSSCCCTTTCCCBCSSCTTBBCCSSSHHHHHHHHHTSSSCEEEECS
T ss_pred C--CCCCCCHHHHHHHHHCCCEEEEEeChhHHhcCCCCCCCCCCCCCCCCCCCCCCcccHHHHHHHHHcCCCceeeecCC
Confidence 3 44489999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCccchhhhhcccccccCCCCCccCCCCccCCCCCccccccccCHHHHHHHHHHHccCCCCCc--ccCceeeeccchhhh
Q 007401 180 IGCVRVPASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVEP--RRARRLIFADDIFQL 257 (605)
Q Consensus 180 gGSiR~PAa~~Gv~GlkPt~G~v~~~G~~p~~~~~d~~G~~ar~~~d~~~v~~~~~~~~~~~~--~~~~~l~~~~~~~~~ 257 (605)
|||||+||+||||||||||+||||+.|++|+++++|++|||+||++|++.+++++.+. ..++ ..+.++.+..+.+.
T Consensus 169 gGSIRiPAa~cGv~GlKPT~G~vs~~g~~~~~~s~d~~Gp~arsv~D~a~~l~~l~g~-~~d~~~~~~lrig~~~~~~~- 246 (434)
T 2dc0_A 169 GGSIRIPAGFNGVVGFKPSYGRVSLEGALPLSRSTDHAGPLTRSVRDAHFLTEILAGE-SIPLEGVQNPVFGVPLDFLE- 246 (434)
T ss_dssp SSTTHHHHHHHTCEEEECSTTSSCCTTSCCSCTTTCCEEEEESSHHHHHHHHHHHHTS-CCCCCCCCSCEEEECHHHHT-
T ss_pred ChhhhhhHHhCCCEEEECCCCCCCCCCCCCCCCccCeeCcccCCHHHHHHHHHHHhCC-CCCcccccCCEEEEECcccc-
Confidence 9999999999999999999999999999999999999999999999999999999876 3332 23346666554431
Q ss_pred cCCchhhHHHHHHHHHHHHhCCCCCccccccccccc-cCcchhhhhhcCCCCCCchhHHHHHHHHHHHhhhhhhHhhHHH
Q 007401 258 SKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIAS-NVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYEFKTIYEE 336 (605)
Q Consensus 258 ~~~~~~~~~~~~~~a~~~l~g~~~~~~~~l~~~v~~-~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~e~~~~~~~ 336 (605)
...++++.++++++++.|+..+ +.|++ ..| +.+. ...+..+...|....+..
T Consensus 247 -~~~~~~v~~a~~~a~~~L~~~G--------~~v~~~~~p-~~~~-----------------~~~~~~~~~~e~~~~~~~ 299 (434)
T 2dc0_A 247 -GRLGVEVRKAFTRLLEDLPALR--------AEVREVSLP-LEGV-----------------YEVYTRLVRYEAARIHEK 299 (434)
T ss_dssp -TCSCHHHHHHHHHHHHHTTTTT--------CEEEECCCC-CTTH-----------------HHHHHHHHHHHHHHHSHH
T ss_pred -CCCCHHHHHHHHHHHHHHHHCC--------CEEEEeCCC-cHHH-----------------HHHHHHHHHHHHHHHHHH
Confidence 2346789999999999996433 33322 223 2211 111222334455556666
Q ss_pred HHHhcCCCCChhHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHHhCCCcEEEEeCCCCCCccCCccccc---c-hhhhh
Q 007401 337 WVKSAKPRLGYNVFERVLEAINTTQDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTY---S-AEFHD 412 (605)
Q Consensus 337 ~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~a~~~r~~~~~~~~~~~~~~Dvll~Pt~~~~ap~~~~~~~~---~-~~~~~ 412 (605)
++......++|.++.+++.+..++..+|.++++.|..+++.+.++|+++|+||+||+|.+||++++.... . .....
T Consensus 300 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~a~~~r~~~~~~~~~~~~~~D~ll~Pt~~~~a~~~~~~~~~~~~~~~~~~~ 379 (434)
T 2dc0_A 300 ALKEHPEGFSPQVREALLAGLALTEKDYRDAVAEREALRLELVKALRGVDALLLPVQPLPAPPLGTEEVELESGRKGHRE 379 (434)
T ss_dssp HHHHCGGGSCHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHTTSSEEEEESCSSSCCBTTCCEEEETTEEEEHHH
T ss_pred HHHhchhhcCHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhcCCEEEECCCCCCCccCcccccccccchhhhhh
Confidence 6666667799999999999999999999999999999999999999999999999999999999864211 0 11112
Q ss_pred chhhhcccccccCCceeeeecccCCCCCceeEEeeccCCchhHHhHHHHHHhH
Q 007401 413 RTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDS 465 (605)
Q Consensus 413 ~~~~~t~~~nl~G~PaisvP~G~~~glp~g~~~~~~~~~d~~ll~~a~~l~~~ 465 (605)
.+..||.++|++|+|++|||+|+.+|+|+|+|+++++++|..+++++..+++.
T Consensus 380 ~~~~~t~~~nl~G~PaisvP~g~~~GlPvGvqlvg~~~~d~~lL~~A~~lE~~ 432 (434)
T 2dc0_A 380 AFITLTLPFSLLGVPTLALPFAKVEGMPVGLQVVGAYGEDGKVLALGGWLEAR 432 (434)
T ss_dssp HHHTTTHHHHHTTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHTT
T ss_pred hhhhhhhhhhhhCCCeEEEecCCCCCCCeEEEEECCCCchHHHHHHHHHHHHh
Confidence 33568999999999999999999899999999999999999999999988763
|
| >3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} SCOP: c.117.1.1 PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A | Back alignment and structure |
|---|
| >3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* | Back alignment and structure |
|---|
| >3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A | Back alignment and structure |
|---|
| >3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A | Back alignment and structure |
|---|
| >2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* | Back alignment and structure |
|---|
| >3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A | Back alignment and structure |
|---|
| >3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 605 | ||||
| d2gi3a1 | 475 | c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransf | 1e-49 | |
| d2f2aa1 | 485 | c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransf | 8e-49 | |
| d1m22a_ | 490 | c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomon | 4e-29 | |
| d1ocka_ | 412 | c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium jap | 5e-24 | |
| d1mt5a_ | 537 | c.117.1.1 (A:) Fatty acid amide hydrolase (oleamid | 2e-21 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 1e-20 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 2e-17 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 1e-16 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 8e-16 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 4e-14 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 5e-14 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 3e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-12 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-12 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-12 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 9e-11 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-07 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-04 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 6e-13 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 4e-12 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 1e-07 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 1e-04 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 8e-12 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 5e-10 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 0.002 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 3e-09 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 2e-05 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 6e-09 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 1e-08 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 6e-04 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 8e-07 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 4e-06 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 8e-06 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 3e-04 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 1e-05 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 3e-05 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 2e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 5e-04 |
| >d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Amidase signature (AS) enzymes superfamily: Amidase signature (AS) enzymes family: Amidase signature (AS) enzymes domain: Glutamyl-tRNA(Gln) amidotransferase subunit A species: Thermotoga maritima [TaxId: 2336]
Score = 177 bits (449), Expect = 1e-49
Identities = 105/479 (21%), Positives = 186/479 (38%), Gaps = 58/479 (12%)
Query: 30 VLAETLRR--RRNPKLNGRVDFGAFLERFELIPFPQPPPPAARQ---PLAGLKFAIKDVF 84
+ +L R +P + AF+ E + + G+ AIKD
Sbjct: 25 LPQLSLETIKRLDPHVK------AFISVRE---------NVSVEKKGKFWGIPVAIKDNI 69
Query: 85 DVKGYVTGFGSPDWKRDHHEAERTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGT 144
G T S + ++E+ A VV + + G +GK LDEFA G + E +
Sbjct: 70 LTLGMRTTCASRILE--NYESVFDATVVKKMKEAGFVVVGKANLDEFAMGSSTERSAFFP 127
Query: 145 PVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDTIGCVRVPASFCGILGYRPSHGTVSM 204
NP +PGGSS GSA AV+A +V ALG+DT G VR PAS CG++GY+P++G VS
Sbjct: 128 TRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCGVVGYKPTYGLVSR 187
Query: 205 IGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVEPRRARRLIFADDIFQLSKVPKLK 264
G++ + SLD +G + + + ++ + + R + +
Sbjct: 188 YGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSEIEEGVSGMKF 247
Query: 265 TIH--------------VISKAIESLSGYQNPEHMNVGQYIASNVPSLKGLRA--QSTSP 308
+ +A++ L + +P +K A +P
Sbjct: 248 AVPEEIYEHDIEEGVSERFEEALKLLER-------LGAKVERVKIPHIKYSVATYYVIAP 300
Query: 309 ENGTATLKALSSVMLSLQRYEFKTIYEEWVKSAKPRLGYNVFERVLEAINT-----TQDN 363
++ L V L R + K + E ++K+ G V R++ T +
Sbjct: 301 AEASSNLARFDGVKYGL-RIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAAYYEAY 359
Query: 364 IKILYKVRNEMRAALQRLLKDDKILVIPTVSDPPLKLNTKKTYSAEFHDRTLVLSSIGSM 423
KVR ++ L +L ++ PT K+ K + + + ++
Sbjct: 360 FNKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYY--LMDIFTIPANL 417
Query: 424 SGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDSLQEQVNIASN-LVPLPD 481
+G +++P G N P+ + I D V + ++++ N + PLP+
Sbjct: 418 AGLPAISVPFGFSNNLPVGVQVIGRRFAD----GKVFRIARAIEKNSPYNENGMFPLPE 472
|
| >d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485 | Back information, alignment and structure |
|---|
| >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490 | Back information, alignment and structure |
|---|
| >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412 | Back information, alignment and structure |
|---|
| >d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 605 | |||
| d2gi3a1 | 475 | Glutamyl-tRNA(Gln) amidotransferase subunit A {The | 100.0 | |
| d1mt5a_ | 537 | Fatty acid amide hydrolase (oleamide hydrolase) {R | 100.0 | |
| d2f2aa1 | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta | 100.0 | |
| d1ocka_ | 412 | Malonamidase E2 {Bradyrhizobium japonicum [TaxId: | 100.0 | |
| d1m22a_ | 490 | Peptide amidase Pam {Stenotrophomonas maltophilia | 100.0 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.76 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.71 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.64 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.64 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.62 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.6 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.59 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.58 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.54 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.54 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.47 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.46 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.46 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.43 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.43 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.43 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.37 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.3 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.28 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.27 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.24 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.23 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.14 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.11 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.1 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.08 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.08 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.07 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.06 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.03 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.96 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.88 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.81 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.79 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.65 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.64 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.63 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.48 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.44 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.42 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.31 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.3 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.3 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.25 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.13 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.12 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.04 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.01 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.91 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.55 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.43 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.29 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 83.2 |
| >d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Amidase signature (AS) enzymes superfamily: Amidase signature (AS) enzymes family: Amidase signature (AS) enzymes domain: Glutamyl-tRNA(Gln) amidotransferase subunit A species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=3.5e-85 Score=703.95 Aligned_cols=411 Identities=23% Similarity=0.302 Sum_probs=320.6
Q ss_pred hhHHHHHHHHHhhcCcccCCCCcCceeeecccCCCCCCCCCCCCCCCCCceEEEeeccCCCCcccCCCchhhhhcCCCCC
Q 007401 27 GFVVLAETLRRRRNPKLNGRVDFGAFLERFELIPFPQPPPPAARQPLAGLKFAIKDVFDVKGYVTGFGSPDWKRDHHEAE 106 (605)
Q Consensus 27 ~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~a~~~a~~~~~~gpL~Gvp~~vKD~~~~~G~~tt~Gs~~~~~~~~~~~ 106 (605)
+.+|++||++.+++||+++||.+|||++..++.+++ .+||||||||+|||+|+++|++||+||+.|++ .++.
T Consensus 18 ~~~~~~~l~~~~l~ri~~~~~~lna~~~~~~~~a~~------~~gpL~GvPi~vKD~~~~~g~~tt~Gs~~~~~--~~~~ 89 (475)
T d2gi3a1 18 SEEEREKLPQLSLETIKRLDPHVKAFISVRENVSVE------KKGKFWGIPVAIKDNILTLGMRTTCASRILEN--YESV 89 (475)
T ss_dssp CHHHHTTHHHHHHHHHHHHHHHHCCEEEECCCCCCC------CCSTTTTCEEEEETTBCCSSSCCCTTCGGGTT--CCCC
T ss_pred CCCCHHHHHHHHHHHHHHHCCcCCEEEEcCHHHhhh------ccCCCCCCEEEEEcccCCCCCccCccChhhcC--CCCC
Confidence 459999999999999999999999999998877654 35899999999999999999999999999975 6789
Q ss_pred CChHHHHHHHhCCCeEeeecccccccccCCCCCCCCCCCCCCCCCCCCCCCCchHHHHHHHhcCCceeeccCCCCccchh
Q 007401 107 RTAVVVTLLLKNGATCIGKTVLDEFAFGITGENKHYGTPVNPQMPSHIPGGSSSGSAVAVAAQLVDFALGTDTIGCVRVP 186 (605)
Q Consensus 107 ~da~~V~rL~~aGai~~GKt~~~e~~~~~~~~n~~~G~~~NP~~~~~~~GGSSgGsaaaVAag~~~~a~GtD~gGSiR~P 186 (605)
+||++|+|||+|||||+||||||||+++.+|+|++||+|+||||++++|||||||||||||+|++|+|||||||||||+|
T Consensus 90 ~da~~v~~L~~aGaii~Gktn~~e~~~~~~~~~~~~G~t~nP~~~~~~~GGSSgGsaaavAag~~~~a~GtD~gGSiR~P 169 (475)
T d2gi3a1 90 FDATVVKKMKEAGFVVVGKANLDEFAMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQP 169 (475)
T ss_dssp SCCHHHHHHHHHTCEEEEEECCSGGGCCSSSTTCSSCCCCBTTBTTBCCCSSSHHHHHHHHTTSSSEEEEEESSSTTHHH
T ss_pred CCcceeeehhhcCCccccccchhhcccccccccchhcccccccccccccCcccccchhhhhhcCcceEeecCCCccchhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhcccccccCCCCCccCCCCccCCCCCccccccccCHHHHHHHHHHHccCCCCC----------------cccCceeee
Q 007401 187 ASFCGILGYRPSHGTVSMIGVLPNSQSLDTVGLLARNASILHRVGHVLLQLNAVE----------------PRRARRLIF 250 (605)
Q Consensus 187 Aa~~Gv~GlkPt~G~v~~~G~~p~~~~~d~~G~~ar~~~d~~~v~~~~~~~~~~~----------------~~~~~~l~~ 250 (605)
|+||||||||||+||||+.|++|+++++|++||||||++|++.+++++.+.+..+ ...+.++.+
T Consensus 170 A~~~Gv~G~kPt~G~i~~~g~~~~~~~~d~~GpmaRsv~D~alll~v~~g~d~~d~~s~~~~~~~~~~~~~~~~~~ri~~ 249 (475)
T d2gi3a1 170 ASLCGVVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSEIEEGVSGMKFAV 249 (475)
T ss_dssp HHHHTSEEEECCTTSBCCTTBCCSCTTTCEEEEEESSHHHHHHHHHHHBSCBTTBTTCCSCCCCSSTTTTSCCTTCEEEE
T ss_pred hHHhCceeecCCCCCCCCCCCCCCCCCCCccCCccCCHHHHHHHhhhhhccccccccccccccccchhccccccccceee
Confidence 9999999999999999999999999999999999999999999999987643211 112335555
Q ss_pred ccchhhhcCCchhhHHHHHHHHHHHHhCCCCCcccccccccc-ccCcchhhhhhcCCCCCCchhHHHHHHHHHHHhhhhh
Q 007401 251 ADDIFQLSKVPKLKTIHVISKAIESLSGYQNPEHMNVGQYIA-SNVPSLKGLRAQSTSPENGTATLKALSSVMLSLQRYE 329 (605)
Q Consensus 251 ~~~~~~~~~~~~~~~~~~~~~a~~~l~g~~~~~~~~l~~~v~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~e 329 (605)
..+.+ ....++++.++++++++.|+..+ +.|+ ...|.+.+....+ ......+....+..+.
T Consensus 250 ~~~~~--~~~~~~~v~~a~~~a~~~L~~~G--------~~V~ev~~p~~~~~~~~~--------~~i~~~e~~~~l~~~~ 311 (475)
T d2gi3a1 250 PEEIY--EHDIEEGVSERFEEALKLLERLG--------AKVERVKIPHIKYSVATY--------YVIAPAEASSNLARFD 311 (475)
T ss_dssp EGGGG--GSCCCHHHHHHHHHHHHHHHHTT--------CEEEEECCTTGGGHHHHH--------HHHHHHHHHTC-----
T ss_pred eeccc--cCCCCHHHHHHHHHHHHHHHHCC--------CEEEEeCCCchHHHHHHH--------HHHHHHHHHHHHHHhh
Confidence 54433 22345788999999999886333 2222 2334433211100 0000001000000000
Q ss_pred ---------hHhhHHHHHHhcCCCCChhHHHHHHHHhcCC-----HHHHHHHHHHHHHHHHHHHHHhCCCcEEEEeCCCC
Q 007401 330 ---------FKTIYEEWVKSAKPRLGYNVFERVLEAINTT-----QDNIKILYKVRNEMRAALQRLLKDDKILVIPTVSD 395 (605)
Q Consensus 330 ---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s-----~~~~~~a~~~r~~~~~~~~~~~~~~Dvll~Pt~~~ 395 (605)
.....+.+.......+++.++.++..+.... ...+.++.+.|..+++.+.++|+++|+||+||+|.
T Consensus 312 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~ll~Pt~~~ 391 (475)
T d2gi3a1 312 GVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAAYYEAYFNKAMKVRRKISDELNEVLSQYDAILTPTSPV 391 (475)
T ss_dssp -------------------CCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSEEEEESCSS
T ss_pred cchhhhhcccccHHHHHHhhhhcccCHHHHHHHHhcchhhchHHHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEeCCCCC
Confidence 0001111222223345677777766554333 33345677788888999999999999999999999
Q ss_pred CCccCCcccccchhhhhchhhhcccccccCCceeeeecccCCCCCceeEEeeccCCchhHHhHHHHHHhH
Q 007401 396 PPLKLNTKKTYSAEFHDRTLVLSSIGSMSGCCQVAIPIGKYNEHPISISFITYHGGDKFLLDTVLDLYDS 465 (605)
Q Consensus 396 ~ap~~~~~~~~~~~~~~~~~~~t~~~nl~G~PaisvP~G~~~glp~g~~~~~~~~~d~~ll~~a~~l~~~ 465 (605)
+||++++...... + ..+..||.++|++|+|++|||+|+++|||+|+|+++++++|..|++++..+|+.
T Consensus 392 ~a~~~~~~~~~~~-~-~~~~~~t~~~Nl~G~PaisvP~G~s~GlPvGvQlig~~~~D~~LL~~A~~~E~~ 459 (475)
T d2gi3a1 392 TAFKIGEIKDPLT-Y-YLMDIFTIPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFRIARAIEKN 459 (475)
T ss_dssp CCCBTTTCCCHHH-H-HTTTTTTHHHHHHTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHHH
T ss_pred CCCCcccccchHH-H-hhhhHHHHHHHHHCCCeEEEeCCCCCCCCEeEEEECCCCCHHHHHHHHHHHHHc
Confidence 9999986432221 1 123358999999999999999999999999999999999999999999999875
|
| >d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|