Citrus Sinensis ID: 007407


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-----
MVMLGSKGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTAPPSTIIGLPRPKPRDDDGEDDNDDDGNNGYQQNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRREARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDYSRRNKRKRFDSFVPVPDSLLQKARQEQQHVIALDPSSRAAGGAESVVTDLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHccccccHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccccccccHHccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccc
cEEEcccccccHcccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHcccccccccHHHcccHHcHcccccHHHHHHHHcccccEEEEccccccccccccccccHHHHHHHHHHHHHcEHHccccccccccEEccccccccHHHccccccccHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccc
mvmlgskgrldflnskppanyiagagrgassfttrsdigrtrtappstiiglprpkprdddgeddndddgnngyqqnfdhfegndaglfvnleyddedkeADAVWESIDKLMDSRRKSRREARLEEEIKnyryknptIREEFADLKGKLSTVkakeweripeigdysrrnkrkrfdsfvpvpdsLLQKARQEQQHVialdpssraaggaesVVTDltavgegrgKILTLKldgisdsvtgltvfdpsgyltrmndlkittNSELRDILKARKIVRAVtknspkkplgwIQAARLEELANEEAAARKLITKgcnmcpkneDVWLEACRlarpdeakSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTieigvdeedkkRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKekwlagdvpaTRDILQEAYaaipnseei
mvmlgskgrLDFLNSKPPanyiagagrgassfttrsdigrtrtappstiiglprpkprddDGEDDNDDDGNNGYQQNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKlmdsrrksrrearleeeiknyryknptireefadlkgklstvkakeweripeigdysrrnkrkrFDSFVPVPDSLLQKARQEQQHVIALdpssraaggaESVVtdltavgegrgkiltlkldgisdsvtgltvfdpsgyltrmndlkittnselRDILKARKIVravtknspkkplgwiQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARpdeaksvvakgvrqipksankIRALRMaldeipdsvRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSvlnkarkklpkERAIWIAAAkleangntsmvGKIIERgiralqgeevVIDRDTWMKEAevadragsvvtCVAIITntieigvdeedkkrTWVADVEeckkrgsietaraifspaCTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI
MVMLGSKGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTAPPSTIIGLPRPKPRdddgeddndddgnngYQQNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRREARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDYSRRNKRKRFDSFVPVPDSLLQKARQEQQHVIALDPSSRAAGGAESVVTDLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQaarleelaneeaaarKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI
*******************************************************************************HFEGNDAGLFVNLEYD********VW***************************Y****IREEFADLKGKLSTVKAKEWERIPEI************************************************VVTDLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAA*******
***************KPPANYIAGAGRGASSFTTRSDI***************************************FDHFEGNDAGLF***E**DEDKEADAVWES**************************************KGKLSTVKAKEWERIPEI*********KRFDSFVPVPDSLLQKA****************************************************TVFDPSGYLTRMNDLK********DILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIP*****
MVMLGSKGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTAPPSTIIGLPRPKPRDDDGEDDNDDDGNNGYQQNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLM*********ARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDYSRRNKRKRFDSFVPVPDSLLQKARQEQQHVIALDPSSRAAGGAESVVTDLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI
*VM*G*KGRLDFLNSKPPANYIAGAGRGASSFTTRSDI*R***********************************QNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRREARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDYSRRNKRKRFDSFVPVPDSLLQKARQEQQHVIALDPS******AESVVTDLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMLGSKGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTAPPSTIIGLPRPKPRDDDGEDDNDDDGNNGYQQNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRREARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDYSRRNKRKRFDSFVPVPDSLLQKARQEQQHVIALDPSSRAAGGAESVVTDLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKSANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query605 2.2.26 [Sep-21-2011]
A1A5S1 941 Pre-mRNA-processing facto yes no 0.991 0.637 0.469 1e-151
Q91YR7 941 Pre-mRNA-processing facto yes no 0.991 0.637 0.468 1e-151
O94906 941 Pre-mRNA-processing facto yes no 0.991 0.637 0.468 1e-151
Q2KJJ0 941 Pre-mRNA-processing facto yes no 0.991 0.637 0.466 1e-151
Q5RCC2 941 Pre-mRNA-processing facto yes no 0.991 0.637 0.465 1e-149
Q12381 906 Pre-mRNA-splicing factor yes no 0.966 0.645 0.407 1e-122
P19735 899 Pre-mRNA-splicing factor yes no 0.707 0.476 0.288 2e-45
Q4WT84 676 Pre-mRNA-splicing factor no no 0.396 0.355 0.293 3e-07
Q7SGD2 695 Pre-mRNA-splicing factor N/A no 0.396 0.345 0.266 6e-07
Q5BDX1 673 Pre-mRNA-splicing factor no no 0.396 0.356 0.289 2e-06
>sp|A1A5S1|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=2 SV=1 Back     alignment and function desciption
 Score =  536 bits (1381), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 302/643 (46%), Positives = 402/643 (62%), Gaps = 43/643 (6%)

Query: 6   SKGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTA-PPSTIIGLPRPKPRDDDGED 64
           +K +  FL    P  Y+ G GRGA+ FTTRSDIG  R A  P      P  K    D   
Sbjct: 2   NKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMK 61

Query: 65  DND---DDGNNGYQQNFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRRE 121
            N    DD  +    N+D F G    LF +  Y+ +D+EADA++ ++DK MD RRK RRE
Sbjct: 62  KNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERRE 121

Query: 122 ARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDY-SRRNKRKRFDSFVP 180
            R +EEI+ YR + P I+++F+DLK KL+ V  +EW  IPE+GD  ++R +  R++   P
Sbjct: 122 QREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTP 181

Query: 181 VPDSLLQKARQEQQHVIALDPSSRAAGGAESVVT-----------------------DLT 217
           VPDS   K  Q  ++  ++DP     GG  +                          D+ 
Sbjct: 182 VPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMR 241

Query: 218 AVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAV 277
            +G+ R  ++ ++L  +SDSV+G TV DP GYLT +N +  T   ++ DI KAR ++++V
Sbjct: 242 KIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSV 301

Query: 278 TKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSV 337
            + +P  P  WI +ARLEE+  +   AR LI KG  MCPK+EDVWLEA RL   D AK+V
Sbjct: 302 RETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAV 361

Query: 338 VAKGVRQIPKSAN--------------KIRALRMALDEIPDSVRLWKALVEISSEEEARI 383
           VA+ VR +P+S                K R LR AL+ +P+SVRLWKA VE+   E+ARI
Sbjct: 362 VAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARI 421

Query: 384 LLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLE-ANGNTS 442
           +L RAVECCP  VELWLAL RLETY  AR VLNKAR+ +P +R IWI AAKLE ANGNT 
Sbjct: 422 MLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQ 481

Query: 443 MVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKR 502
           MV KII+R I +L+   V I+R+ W+++AE  DRAGSV TC A++   I IG++EED+K 
Sbjct: 482 MVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKH 541

Query: 503 TWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAV 562
           TW+ D + C    ++E ARAI++ A  VF +KK++WL+AA  EK++G RESL ALL++AV
Sbjct: 542 TWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAV 601

Query: 563 TYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI 605
            +CP+AEVLWLMGAK KWLAGDVPA R IL  A+ A PNSEEI
Sbjct: 602 AHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEI 644




Involved in pre-mRNA splicing. May act in the tri-snRNP complex as a bridging factor between U5 and U4/U6 snRNPs in the late step of spliceosome assembly (By similarity). May be necessary for tri-snRNP formation (By similarity). Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but does not affect estrogen-induced transactivation.
Rattus norvegicus (taxid: 10116)
>sp|Q91YR7|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=2 SV=1 Back     alignment and function description
>sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1 Back     alignment and function description
>sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCC2|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1 Back     alignment and function description
>sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 Back     alignment and function description
>sp|P19735|PRP6_YEAST Pre-mRNA-splicing factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP6 PE=1 SV=1 Back     alignment and function description
>sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 Back     alignment and function description
>sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 Back     alignment and function description
>sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query605
449445509 1023 PREDICTED: pre-mRNA-processing factor 6- 0.990 0.585 0.686 0.0
374095607 1023 putative pre-mRNA splicing factor [Camel 0.990 0.585 0.681 0.0
255553813 1031 pre-mRNA splicing factor, putative [Rici 0.990 0.580 0.687 0.0
356543817 1041 PREDICTED: pre-mRNA-processing factor 6- 0.988 0.574 0.672 0.0
225446942 1023 PREDICTED: pre-mRNA-processing factor 6- 0.990 0.585 0.672 0.0
147774593 1023 hypothetical protein VITISV_024588 [Viti 0.990 0.585 0.672 0.0
356549920 1034 PREDICTED: pre-mRNA-processing factor 6- 0.988 0.578 0.674 0.0
413916649 956 hypothetical protein ZEAMMB73_917811 [Ze 0.986 0.624 0.676 0.0
414878219 962 TPA: hypothetical protein ZEAMMB73_41594 0.988 0.621 0.671 0.0
357140782 1074 PREDICTED: pre-mRNA-processing factor 6- 0.986 0.555 0.667 0.0
>gi|449445509|ref|XP_004140515.1| PREDICTED: pre-mRNA-processing factor 6-like [Cucumis sativus] gi|449514699|ref|XP_004164455.1| PREDICTED: pre-mRNA-processing factor 6-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/631 (68%), Positives = 498/631 (78%), Gaps = 32/631 (5%)

Query: 7   KGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTAP----------PSTIIGLPRPK 56
           K RLDFLNSKPP NY+AG GRGA+ FTTRSDIG  R AP                 P   
Sbjct: 88  KPRLDFLNSKPPPNYVAGLGRGATGFTTRSDIGPARAAPDLPDRSATTIGGAAAAPPGRG 147

Query: 57  PRDDDGEDDNDDDGNNGYQQN--FDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDS 114
                 E++ D+  + GY +N  FD FEGND GLF + EYD++DKEADAVWE+IDK MDS
Sbjct: 148 RGKGGEEEEEDEGEDKGYDENQKFDEFEGNDVGLFASAEYDEDDKEADAVWEAIDKRMDS 207

Query: 115 RRKSRREARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPEIGDYSRRNKRKR 174
           RRK RREARL+EEI+ YR  NP I E+FADLK KL T+ A+EWE IPEIGDYS RNK+KR
Sbjct: 208 RRKDRREARLKEEIEKYRASNPKITEQFADLKRKLYTLSAQEWESIPEIGDYSLRNKKKR 267

Query: 175 FDSFVPVPDSLLQKARQEQQHVIALDPSSRAAGG-----AESVVTDLTAVGEGRGKILTL 229
           F+SFVPVPD+LL+KARQEQ+HV ALDP SRAAGG     A++ VTDLTAVGEGRG +L+L
Sbjct: 268 FESFVPVPDTLLEKARQEQEHVTALDPKSRAAGGTETPWAQTPVTDLTAVGEGRGTVLSL 327

Query: 230 KLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWI 289
           KLD +SDSV+GLTV DP GYLT +  +KIT+++E+ DI KAR ++++VT+ +PK P GWI
Sbjct: 328 KLDRLSDSVSGLTVVDPKGYLTDLKSMKITSDAEISDIKKARLLLKSVTQTNPKHPPGWI 387

Query: 290 QAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLARPDEAKSVVAKGVRQIPKS- 348
            AARLEE+A +  AAR+LI KGC  CPKNEDVWLEACRLA PDEAK+V+AKG + IP S 
Sbjct: 388 AAARLEEVAGKIQAARQLIQKGCEECPKNEDVWLEACRLASPDEAKAVIAKGAKSIPNSV 447

Query: 349 -------------ANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLHRAVECCPLD 395
                        ANK R LR  L+ IPDSVRLWKA+VE+++EE+AR+LLHRAVECCPL 
Sbjct: 448 KLWLQAAKLEHDTANKSRVLRKGLEHIPDSVRLWKAVVELANEEDARLLLHRAVECCPLH 507

Query: 396 VELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLE-ANGNTSMVGKIIERGIRA 454
           VELWLAL RLETY  A+ VLN AR+KLPKE AIWI AAKLE ANGNT+MVGKIIE+GIRA
Sbjct: 508 VELWLALARLETYDRAKKVLNSAREKLPKEPAIWITAAKLEEANGNTAMVGKIIEKGIRA 567

Query: 455 LQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKR 514
           LQ   VVIDR+ WMKEAE A+RAGSV TC AII NTI +GV+EED+KRTWVAD EECKKR
Sbjct: 568 LQRVGVVIDREAWMKEAEAAERAGSVATCQAIIHNTIGVGVEEEDRKRTWVADAEECKKR 627

Query: 515 GSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTYCPQAEVLWLM 574
           GSIETARAI++ A TVFLTKK+IWLKAAQLEKS+G RESL ALLRKAVTY PQAEVLWLM
Sbjct: 628 GSIETARAIYAHALTVFLTKKSIWLKAAQLEKSHGSRESLDALLRKAVTYRPQAEVLWLM 687

Query: 575 GAKEKWLAGDVPATRDILQEAYAAIPNSEEI 605
           GAKEKWLAGDVPA R ILQEAYAAIPNSEEI
Sbjct: 688 GAKEKWLAGDVPAARSILQEAYAAIPNSEEI 718




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|374095607|gb|AEY85031.1| putative pre-mRNA splicing factor [Camellia sinensis] Back     alignment and taxonomy information
>gi|255553813|ref|XP_002517947.1| pre-mRNA splicing factor, putative [Ricinus communis] gi|223542929|gb|EEF44465.1| pre-mRNA splicing factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356543817|ref|XP_003540356.1| PREDICTED: pre-mRNA-processing factor 6-like [Glycine max] Back     alignment and taxonomy information
>gi|225446942|ref|XP_002267416.1| PREDICTED: pre-mRNA-processing factor 6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774593|emb|CAN65423.1| hypothetical protein VITISV_024588 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356549920|ref|XP_003543338.1| PREDICTED: pre-mRNA-processing factor 6-like [Glycine max] Back     alignment and taxonomy information
>gi|413916649|gb|AFW56581.1| hypothetical protein ZEAMMB73_917811 [Zea mays] Back     alignment and taxonomy information
>gi|414878219|tpg|DAA55350.1| TPA: hypothetical protein ZEAMMB73_415949 [Zea mays] Back     alignment and taxonomy information
>gi|357140782|ref|XP_003571942.1| PREDICTED: pre-mRNA-processing factor 6-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query605
MGI|MGI:1922946 941 Prpf6 "PRP6 pre-mRNA splicing 0.646 0.415 0.519 1.8e-142
RGD|1307103 941 Prpf6 "PRP6 pre-mRNA processin 0.646 0.415 0.519 1.8e-142
UNIPROTKB|O94906 941 PRPF6 "Pre-mRNA-processing fac 0.646 0.415 0.519 1.8e-142
UNIPROTKB|F1N9U0 945 PRPF6 "Uncharacterized protein 0.646 0.413 0.519 2.4e-142
UNIPROTKB|E2RPW8 941 PRPF6 "Uncharacterized protein 0.646 0.415 0.517 3e-142
UNIPROTKB|Q2KJJ0 941 PRPF6 "Pre-mRNA-processing fac 0.646 0.415 0.517 3e-142
ZFIN|ZDB-GENE-030131-2575 944 prpf6 "PRP6 pre-mRNA processin 0.646 0.414 0.517 3.4e-141
TAIR|locus:2128751 1029 EMB2770 "EMBRYO DEFECTIVE 2770 0.948 0.557 0.422 6.4e-115
UNIPROTKB|I3L7Q4 783 PRPF6 "Uncharacterized protein 0.613 0.473 0.434 3.8e-112
FB|FBgn0036828 931 CG6841 [Drosophila melanogaste 0.646 0.419 0.495 1.2e-99
MGI|MGI:1922946 Prpf6 "PRP6 pre-mRNA splicing factor 6 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 1053 (375.7 bits), Expect = 1.8e-142, Sum P(2) = 1.8e-142
 Identities = 211/406 (51%), Positives = 274/406 (67%)

Query:   215 DLTAVGEGRGKILTLKLDGISDSVTGLTVFDPSGYLTRMNDLKITTNSELRDILKARKIV 274
             D+  +G+ R  ++ ++L  +SDSV+G TV DP GYLT +N +  T   ++ DI KAR ++
Sbjct:   239 DMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLL 298

Query:   275 RAVTKNSPKKPLGWIQXXXXXXXXXXXXXXXKLITKGCNMCPKNEDVWLEACRLARPDEA 334
             ++V + +P  P  WI                 LI KG  MCPK+EDVWLEA RL   D A
Sbjct:   299 KSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTA 358

Query:   335 KSVVAKGVRQIPKSAN--------------KIRALRMALDEIPDSVRLWKALVEISSEEE 380
             K+VVA+ VR +P+S                K R LR AL+ +P+SVRLWKA VE+   E+
Sbjct:   359 KAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPED 418

Query:   381 ARILLHRAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLE-ANG 439
             ARI+L RAVECCP  VELWLAL RLETY  AR VLNKAR+ +P +R IWI AAKLE ANG
Sbjct:   419 ARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANG 478

Query:   440 NTSMVGKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEED 499
             NT MV KII+R I +L+   V I+R+ W+++AE  DRAGSV TC A++   I IG++EED
Sbjct:   479 NTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEED 538

Query:   500 KKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLR 559
             +K TW+ D + C    ++E ARAI++ A  VF +KK++WL+AA  EK++G RESL ALL+
Sbjct:   539 RKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQ 598

Query:   560 KAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI 605
             +AV +CP+AEVLWLMGAK KWLAGDVPA R IL  A+ A PNSEEI
Sbjct:   599 RAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEI 644


GO:0000244 "assembly of spliceosomal tri-snRNP" evidence=ISO
GO:0000398 "mRNA splicing, via spliceosome" evidence=IEA
GO:0003713 "transcription coactivator activity" evidence=ISO
GO:0003723 "RNA binding" evidence=ISO
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISO
GO:0005681 "spliceosomal complex" evidence=IEA
GO:0005682 "U5 snRNP" evidence=ISO
GO:0006396 "RNA processing" evidence=IEA
GO:0006397 "mRNA processing" evidence=IEA
GO:0006403 "RNA localization" evidence=ISO
GO:0008380 "RNA splicing" evidence=IEA
GO:0043021 "ribonucleoprotein complex binding" evidence=ISO
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO
GO:0046540 "U4/U6 x U5 tri-snRNP complex" evidence=ISO
GO:0050681 "androgen receptor binding" evidence=ISO
GO:0071001 "U4/U6 snRNP" evidence=ISO
GO:0071013 "catalytic step 2 spliceosome" evidence=ISO
RGD|1307103 Prpf6 "PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O94906 PRPF6 "Pre-mRNA-processing factor 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9U0 PRPF6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPW8 PRPF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJJ0 PRPF6 "Pre-mRNA-processing factor 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2575 prpf6 "PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2128751 EMB2770 "EMBRYO DEFECTIVE 2770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7Q4 PRPF6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0036828 CG6841 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
pfam06424131 pfam06424, PRP1_N, PRP1 splicing factor, N-termina 1e-46
>gnl|CDD|203444 pfam06424, PRP1_N, PRP1 splicing factor, N-terminal Back     alignment and domain information
 Score =  160 bits (406), Expect = 1e-46
 Identities = 72/153 (47%), Positives = 97/153 (63%), Gaps = 22/153 (14%)

Query: 17  PPANYIAGAGRGASSFTTRSDIGRTRTAPPSTIIGLPRPKPRDDDGEDDNDDDGNNGYQQ 76
            P  Y+AG GRGA+ FTTRSDIG               P     D +D+ D+D    YQ 
Sbjct: 1   APPGYVAGLGRGATGFTTRSDIG---------------PARDGVDIDDEEDEDPKR-YQ- 43

Query: 77  NFDHFEGNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRREARLEEEIKNYRYKNP 136
                +G++ GLF + +YDDED+EAD ++ESID+ MD RRK RRE + +EEI+ YR +NP
Sbjct: 44  -----DGDNEGLFSDGKYDDEDEEADRIYESIDERMDERRKKRREQKEKEEIEKYREENP 98

Query: 137 TIREEFADLKGKLSTVKAKEWERIPEIGDYSRR 169
            I+++FADLK  L+TV   EW  IPE+GDY+R+
Sbjct: 99  KIQQQFADLKRNLATVTEDEWANIPEVGDYTRK 131


This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N terminus of the RNA splicing factor encoded by prp1. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression. Length = 131

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 605
KOG0495 913 consensus HAT repeat protein [RNA processing and m 100.0
PF06424133 PRP1_N: PRP1 splicing factor, N-terminal; InterPro 100.0
KOG0495 913 consensus HAT repeat protein [RNA processing and m 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.96
KOG1915677 consensus Cell cycle control protein (crooked neck 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.93
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.93
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.8
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.8
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
PRK11788389 tetratricopeptide repeat protein; Provisional 99.79
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.79
KOG0547606 consensus Translocase of outer mitochondrial membr 99.78
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.75
KOG1126638 consensus DNA-binding cell division cycle control 99.73
PRK14574 822 hmsH outer membrane protein; Provisional 99.72
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.72
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.7
KOG2076 895 consensus RNA polymerase III transcription factor 99.69
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
PRK12370553 invasion protein regulator; Provisional 99.66
KOG0547606 consensus Translocase of outer mitochondrial membr 99.64
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.64
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.63
KOG1126638 consensus DNA-binding cell division cycle control 99.62
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.62
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.62
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.59
PRK12370553 invasion protein regulator; Provisional 99.58
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.55
KOG1125579 consensus TPR repeat-containing protein [General f 99.54
PLN03218 1060 maturation of RBCL 1; Provisional 99.53
KOG1258577 consensus mRNA processing protein [RNA processing 99.53
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.52
PRK11189296 lipoprotein NlpI; Provisional 99.52
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.51
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.51
KOG2076 895 consensus RNA polymerase III transcription factor 99.51
PLN03218 1060 maturation of RBCL 1; Provisional 99.5
PLN03077 857 Protein ECB2; Provisional 99.48
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.48
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.48
KOG1129478 consensus TPR repeat-containing protein [General f 99.48
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.48
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.48
PLN02789320 farnesyltranstransferase 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.47
KOG1125579 consensus TPR repeat-containing protein [General f 99.45
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.45
PRK11189296 lipoprotein NlpI; Provisional 99.43
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.43
PLN02789320 farnesyltranstransferase 99.41
PLN03077 857 Protein ECB2; Provisional 99.4
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.39
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.38
KOG1129478 consensus TPR repeat-containing protein [General f 99.37
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.36
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.35
PRK15359144 type III secretion system chaperone protein SscB; 99.34
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.33
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.33
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.32
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.32
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.32
PRK10370198 formate-dependent nitrite reductase complex subuni 99.3
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.27
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.27
PRK15359144 type III secretion system chaperone protein SscB; 99.25
KOG1258 577 consensus mRNA processing protein [RNA processing 99.25
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.24
KOG2003 840 consensus TPR repeat-containing protein [General f 99.24
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.23
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.22
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.21
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.2
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.19
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.15
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.15
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 99.11
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.09
KOG2003840 consensus TPR repeat-containing protein [General f 99.09
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.06
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.06
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.05
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.04
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 99.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.03
PRK10370198 formate-dependent nitrite reductase complex subuni 99.01
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.01
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.99
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.97
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.95
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 98.92
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.92
KOG0553304 consensus TPR repeat-containing protein [General f 98.92
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.91
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.91
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 98.9
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.88
KOG0553 304 consensus TPR repeat-containing protein [General f 98.87
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.85
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.84
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.81
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.78
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.76
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.74
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.74
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.73
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.73
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.68
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.68
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.67
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.64
PRK10803263 tol-pal system protein YbgF; Provisional 98.61
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.6
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.59
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.59
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.58
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 98.57
PRK04841 903 transcriptional regulator MalT; Provisional 98.56
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.52
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.49
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 98.48
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.48
PRK15331165 chaperone protein SicA; Provisional 98.48
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.48
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.46
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.43
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.4
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.39
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.39
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.38
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.36
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.35
PRK11906458 transcriptional regulator; Provisional 98.32
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.31
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.31
PF12688120 TPR_5: Tetratrico peptide repeat 98.3
PRK10803263 tol-pal system protein YbgF; Provisional 98.29
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.28
PF1337173 TPR_9: Tetratricopeptide repeat 98.27
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.26
PF1337173 TPR_9: Tetratricopeptide repeat 98.25
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.25
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.22
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.22
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.21
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.19
PF12688120 TPR_5: Tetratrico peptide repeat 98.18
PRK04841 903 transcriptional regulator MalT; Provisional 98.16
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.13
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.13
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.12
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.08
PRK15331165 chaperone protein SicA; Provisional 98.05
PRK11906458 transcriptional regulator; Provisional 98.03
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.01
PF13512142 TPR_18: Tetratricopeptide repeat 98.01
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.97
COG3898531 Uncharacterized membrane-bound protein [Function u 97.94
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.92
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.92
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.86
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.83
PF1342844 TPR_14: Tetratricopeptide repeat 97.82
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.8
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.79
PF1342844 TPR_14: Tetratricopeptide repeat 97.78
PF13512142 TPR_18: Tetratricopeptide repeat 97.74
KOG4555175 consensus TPR repeat-containing protein [Function 97.71
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.64
COG4700251 Uncharacterized protein conserved in bacteria cont 97.61
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.6
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.56
KOG1586288 consensus Protein required for fusion of vesicles 97.54
COG4700251 Uncharacterized protein conserved in bacteria cont 97.52
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.51
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.51
COG5191 435 Uncharacterized conserved protein, contains HAT (H 97.5
KOG4234271 consensus TPR repeat-containing protein [General f 97.47
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.46
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.43
KOG1585308 consensus Protein required for fusion of vesicles 97.41
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.41
KOG4234271 consensus TPR repeat-containing protein [General f 97.38
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.35
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.35
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.32
KOG4555175 consensus TPR repeat-containing protein [Function 97.31
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.31
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.3
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.29
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.28
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.22
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.22
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.22
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.19
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.16
PF1343134 TPR_17: Tetratricopeptide repeat 97.15
PF1343134 TPR_17: Tetratricopeptide repeat 97.13
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.09
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.07
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 96.99
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.97
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.93
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 96.87
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.86
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.8
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.49
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.47
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.44
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 96.43
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.37
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.34
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.31
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.2
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.15
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.07
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 96.06
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 96.05
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.05
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.86
KOG2422 665 consensus Uncharacterized conserved protein [Funct 95.75
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.69
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.66
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.65
KOG1586288 consensus Protein required for fusion of vesicles 95.65
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 95.48
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.46
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 95.46
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.43
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.43
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.42
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.35
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.3
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.24
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 95.22
KOG2300 629 consensus Uncharacterized conserved protein [Funct 95.06
KOG1585308 consensus Protein required for fusion of vesicles 94.98
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.97
KOG2422 665 consensus Uncharacterized conserved protein [Funct 94.93
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 94.91
KOG0530318 consensus Protein farnesyltransferase, alpha subun 94.68
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.64
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.63
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.5
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.44
PRK10941269 hypothetical protein; Provisional 94.39
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 94.25
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.21
KOG3616 1636 consensus Selective LIM binding factor [Transcript 94.18
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.06
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.06
KOG0530318 consensus Protein farnesyltransferase, alpha subun 94.05
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 94.0
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 93.73
PRK10941269 hypothetical protein; Provisional 93.71
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.7
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 93.27
COG4976 287 Predicted methyltransferase (contains TPR repeat) 93.07
KOG4507 886 consensus Uncharacterized conserved protein, conta 93.06
KOG2300 629 consensus Uncharacterized conserved protein [Funct 92.93
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.8
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.7
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 92.62
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 92.55
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.53
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.28
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.07
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 91.89
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 91.85
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 91.76
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 91.69
KOG2610 491 consensus Uncharacterized conserved protein [Funct 91.47
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 91.46
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.45
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.43
KOG2041 1189 consensus WD40 repeat protein [General function pr 91.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.19
KOG2471 696 consensus TPR repeat-containing protein [General f 91.09
PF09986214 DUF2225: Uncharacterized protein conserved in bact 90.95
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.76
COG3947361 Response regulator containing CheY-like receiver a 89.01
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.75
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 88.0
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 87.84
COG4976 287 Predicted methyltransferase (contains TPR repeat) 87.58
COG3629280 DnrI DNA-binding transcriptional activator of the 87.52
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 87.43
KOG3783546 consensus Uncharacterized conserved protein [Funct 87.17
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.05
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.95
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.94
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 86.23
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 86.17
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 86.04
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 85.98
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.55
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 85.55
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.36
KOG2471 696 consensus TPR repeat-containing protein [General f 85.03
COG4649221 Uncharacterized protein conserved in bacteria [Fun 84.39
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 83.99
COG3629280 DnrI DNA-binding transcriptional activator of the 83.62
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.06
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.91
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 82.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.82
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.7
COG2912269 Uncharacterized conserved protein [Function unknow 82.59
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 82.31
COG5159 421 RPN6 26S proteasome regulatory complex component [ 81.93
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 81.39
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 80.3
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=5.8e-148  Score=1158.05  Aligned_cols=596  Identities=56%  Similarity=0.915  Sum_probs=564.2

Q ss_pred             ccccCCCCCCCCCCCCCCccCCCCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 007407            3 MLGSKGRLDFLNSKPPANYIAGAGRGASSFTTRSDIGRTRTAPPSTIIGLPRPKPRDDDGEDDNDDDGNNGYQQNFDHFE   82 (605)
Q Consensus         3 ~~~~~~~~~fl~~~~p~~yv~g~grga~gf~tr~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (605)
                      .++++.|++||+|+||+|||||||||||||||||||||||++|+.+. +.++|.+|      ..++|++++++.+||+|+
T Consensus         8 ~~~~~~r~~Fl~~~pP~gYVaGlGRGATGFTTRsdigpArd~~~~~~-~~~~~~~~------~~e~d~e~~~~~~ydefe   80 (913)
T KOG0495|consen    8 AAMNKPRPDFLGMPPPSGYVAGLGRGATGFTTRSDIGPARDAPDLPS-GKAAPEKR------KSEDDEEDDNDINYDEFE   80 (913)
T ss_pred             cccCCCCccccCCCCCCCcCCCcCCCccCccchhhcCcccCCcccCC-Cccchhhh------hccchhhhcccCCccccc
Confidence            46779999999999999999999999999999999999998875431 11112111      112334577899999999


Q ss_pred             CCCCCCCCCCCCCCccHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHhhhcCCChhhhhHHhhhccCCCCHHHhccCCc
Q 007407           83 GNDAGLFVNLEYDDEDKEADAVWESIDKLMDSRRKSRREARLEEEIKNYRYKNPTIREEFADLKGKLSTVKAKEWERIPE  162 (605)
Q Consensus        83 ~~~~~~~~~~~~~~~d~ead~i~~~id~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~qf~dlkr~l~~v~~~~w~~~pe  162 (605)
                      ||++|||++++||+||+|||+||++||.|||+|||+|||+++++++|+|+.++||||+||+||||+|++||+|||.+|||
T Consensus        81 g~~~~lfa~~pyD~eDeEAd~Iy~sid~rld~rrK~rre~k~ke~iE~y~~e~pkv~~QFaDLKr~LatvTe~EW~~IPE  160 (913)
T KOG0495|consen   81 GNDGSLFASAPYDDEDEEADAIYDSIDLRLDERRKERREKKLKEEIEKYRKENPKVQQQFADLKRKLATVTEDEWDSIPE  160 (913)
T ss_pred             cccchhhcCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccChhHHHHHHHHHHHHhhcCHHHhhcCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhhhhhc-ccccccccchhHhHhhhhhhccccccCCCcccC-CCCcccccchhhhhhhhhhhhhhhccccccccCC
Q 007407          163 IGDYSRRNKRK-RFDSFVPVPDSLLQKARQEQQHVIALDPSSRAA-GGAESVVTDLTAVGEGRGKILTLKLDGISDSVTG  240 (605)
Q Consensus       163 ~~d~~~~~~~~-~~~~~~~~pd~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~i~~~R~~~l~~kld~~~~~~~~  240 (605)
                      +||+++||||+ |.|+|||+|||+++++.+.++..+++|+.++.. .-..+.++...+||++|++|++.+|++++++++|
T Consensus       161 vgD~r~r~krn~r~Ekf~p~pds~~~~~~~~~~~~~~ld~~~g~etp~~~g~~t~~~kig~ar~~l~~~kl~qvsdsvtg  240 (913)
T KOG0495|consen  161 VGDYRNRNKRNPRAEKFTPVPDSLLASAINENEDSSSLDPEGGLETPLQSGQMTPGVKIGQARNTLMDMKLNQVSDSVTG  240 (913)
T ss_pred             ccchhhhhhccchhhhcCCCchHHHHHhcccCccccccCccCCccCCCcCCCcCccchhhHHHHHHHhhhhhhccccCCC
Confidence            99999999998 889999999999999999999999999984332 1111245667799999999999999999999999


Q ss_pred             ccccCchhHHhhhhhhcccchhhhccHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCHH
Q 007407          241 LTVFDPSGYLTRMNDLKITTNSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNED  320 (605)
Q Consensus       241 ~~~~dp~~yl~~L~~~~~~~~~~~gd~~kAr~ll~~al~~~P~~~~~wia~Arle~~~g~~~~Ar~ll~~~l~~~P~~~~  320 (605)
                      ++++||+||||+|++|...+...++|+++||.+|++++++||+||++||++||+|+..|+++.|+++|++||+.||+|++
T Consensus       241 qtvvDpkgYLtdL~sm~p~~~~dl~DikKaR~llKSvretnP~hp~gWIAsArLEEvagKl~~Ar~~I~~GCe~cprSeD  320 (913)
T KOG0495|consen  241 QTVVDPKGYLTDLNSMIPTSGGDLEDIKKARLLLKSVRETNPKHPPGWIASARLEEVAGKLSVARNLIMKGCEECPRSED  320 (913)
T ss_pred             CcccCchHHHhHHHhcCCCccCcHHHHHHHHHHHHHHHhcCCCCCchHHHHHHHHHHhhHHHHHHHHHHHHHhhCCchHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCchhHHHHHHHHHhhCCCc--------------HHHHHHHHHHHHhCCCcHHHHHHHHHhCCHHHHHHHHH
Q 007407          321 VWLEACRLARPDEAKSVVAKGVRQIPKS--------------ANKIRALRMALDEIPDSVRLWKALVEISSEEEARILLH  386 (605)
Q Consensus       321 lwle~a~L~~~~~Ak~~l~~al~~~P~s--------------~~a~~vl~kAle~~P~~~~lw~~l~~le~~e~A~~~l~  386 (605)
                      +||+++||+.++.||.++++|++++|+|              .++++|++|||+++|+|++||+..++|+++++|+++|.
T Consensus       321 vWLeaiRLhp~d~aK~vvA~Avr~~P~Sv~lW~kA~dLE~~~~~K~RVlRKALe~iP~sv~LWKaAVelE~~~darilL~  400 (913)
T KOG0495|consen  321 VWLEAIRLHPPDVAKTVVANAVRFLPTSVRLWLKAADLESDTKNKKRVLRKALEHIPRSVRLWKAAVELEEPEDARILLE  400 (913)
T ss_pred             HHHHHHhcCChHHHHHHHHHHHHhCCCChhhhhhHHhhhhHHHHHHHHHHHHHHhCCchHHHHHHHHhccChHHHHHHHH
Confidence            9999999999999999999999999999              56899999999999999999999999999999999999


Q ss_pred             HHHHhCCCCHHHHHHHHHhhcHHHHHHHHHHHHHhCCCCHHHHHHHHHHH-HcCCHHHHHHHHHHHHHHhccCcccccHH
Q 007407          387 RAVECCPLDVELWLALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLE-ANGNTSMVGKIIERGIRALQGEEVVIDRD  465 (605)
Q Consensus       387 rAl~~~P~~~~lw~aLa~le~~e~A~~vL~~al~~~p~~~~iwi~~a~Le-~~g~~~~a~~i~~~al~~~p~~~~~~~~~  465 (605)
                      |||+|||.+.++|++|++|+.|++|+++||++++.+|++++||+.+++|| .+|+.+++.+++.+++..+..+|+..+++
T Consensus       401 rAveccp~s~dLwlAlarLetYenAkkvLNkaRe~iptd~~IWitaa~LEE~ngn~~mv~kii~rgl~~L~~ngv~i~rd  480 (913)
T KOG0495|consen  401 RAVECCPQSMDLWLALARLETYENAKKVLNKAREIIPTDREIWITAAKLEEANGNVDMVEKIIDRGLSELQANGVEINRD  480 (913)
T ss_pred             HHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhhcceeecHH
Confidence            99999999999999999999999999999999999999999999999999 99999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCchhhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCCCHHHHHHHHHHH
Q 007407          466 TWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLE  545 (605)
Q Consensus       466 ~wl~~A~~~e~~g~~~~A~~i~~~al~~~p~~~~~~~~~~~~a~~~~~~g~~~~A~~i~~~al~~~P~~~~~w~~la~l~  545 (605)
                      .|++.|+.|+..|.+.+|++|++.+|.++.++++...+|+..++.+...+.+++||++|.++|+.||.+.++|..+++++
T Consensus       481 qWl~eAe~~e~agsv~TcQAIi~avigigvEeed~~~tw~~da~~~~k~~~~~carAVya~alqvfp~k~slWlra~~~e  560 (913)
T KOG0495|consen  481 QWLKEAEACEDAGSVITCQAIIRAVIGIGVEEEDRKSTWLDDAQSCEKRPAIECARAVYAHALQVFPCKKSLWLRAAMFE  560 (913)
T ss_pred             HHHHHHHHHhhcCChhhHHHHHHHHHhhccccchhHhHHhhhHHHHHhcchHHHHHHHHHHHHhhccchhHHHHHHHHHH
Confidence            99999999999999999999999999999998899999999999999999999999999999999999999999999999


Q ss_pred             HHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHHCCCCCCC
Q 007407          546 KSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSEEI  605 (605)
Q Consensus       546 ~~~g~~e~A~~~lekAl~~~P~~~~l~l~~a~~~~~~gd~~~Ar~il~kAl~~~P~~~~I  605 (605)
                      ..||..++...+|++|+.+||+.+.+|+||++.+|..||+..||.+|.+||+.+|+|++|
T Consensus       561 k~hgt~Esl~Allqkav~~~pkae~lwlM~ake~w~agdv~~ar~il~~af~~~pnseei  620 (913)
T KOG0495|consen  561 KSHGTRESLEALLQKAVEQCPKAEILWLMYAKEKWKAGDVPAARVILDQAFEANPNSEEI  620 (913)
T ss_pred             HhcCcHHHHHHHHHHHHHhCCcchhHHHHHHHHHHhcCCcHHHHHHHHHHHHhCCCcHHH
Confidence            999999999999999999999999999999999999999999999999999999999876



>PF06424 PRP1_N: PRP1 splicing factor, N-terminal; InterPro: IPR010491 This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression) Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 8e-16
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-11
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-11
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 6e-10
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 7e-15
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-11
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 7e-09
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-08
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 8e-10
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 5e-07
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 2e-06
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 8e-09
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-07
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
 Score = 77.8 bits (191), Expect = 8e-16
 Identities = 30/256 (11%), Positives = 76/256 (29%), Gaps = 36/256 (14%)

Query: 363 PDSVRLWKALV----------EISSEEEARILLH--RAVECCPLDVELWLALVRLETYGV 410
              V +WK  +          E  +    R++    + +       ++W    +      
Sbjct: 5   AQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQY----- 59

Query: 411 ARSVLNKARKKLPKERAIWIAAAKLE-ANGNTSMVGKIIERGIRALQGEEVVIDRDTWMK 469
                      L +   +      +  A   +     I ER I  L  + +++    +  
Sbjct: 60  -----------LEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLL----YFA 104

Query: 470 EAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACT 529
            A+  +         +I    + I  ++ D    ++  ++  ++   I++ R IF  A  
Sbjct: 105 YADYEESRMKYEKVHSIYNRLLAI--EDIDPTLVYIQYMKFARRAEGIKSGRMIFKKARE 162

Query: 530 VFLTKKNIWLKAAQLE-KSYGCRESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPAT 588
              T+ ++++ AA +E      +     +    +          L          +   T
Sbjct: 163 DARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNT 222

Query: 589 RDILQEAYAAIPNSEE 604
           R + +    +     E
Sbjct: 223 RVLFERVLTSGSLPPE 238


>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query605
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.97
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.95
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.92
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.91
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.9
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.9
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.9
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 99.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.87
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.87
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.85
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.84
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.83
3u4t_A272 TPR repeat-containing protein; structural genomics 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
3u4t_A272 TPR repeat-containing protein; structural genomics 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.79
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.79
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.79
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.79
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.76
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.75
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.75
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.74
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.74
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.74
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.73
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.73
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.72
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.72
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.72
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.72
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.7
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.68
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.68
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.67
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.64
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.62
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.59
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.59
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.58
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.58
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.58
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.58
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.58
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.58
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.57
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.55
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.54
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.53
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.52
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.52
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.52
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.51
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.51
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.5
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.49
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.48
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.44
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.41
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.41
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.41
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.39
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.38
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.37
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.36
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.36
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.35
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.35
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.34
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.32
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.31
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.31
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.31
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.31
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.3
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.28
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.27
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.27
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.26
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.25
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.24
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.24
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.24
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.23
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.22
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.21
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.21
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.2
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.2
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.18
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.17
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.16
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.16
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.15
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.12
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.1
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.1
3k9i_A117 BH0479 protein; putative protein binding protein, 99.1
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.09
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.09
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.07
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.06
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.06
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.06
3k9i_A117 BH0479 protein; putative protein binding protein, 99.06
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.03
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.02
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.02
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.01
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.99
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.99
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.98
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.97
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.93
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.93
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.92
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.91
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.9
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.89
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.87
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.87
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.86
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.86
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.83
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.82
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.79
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.79
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.78
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.77
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.77
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.76
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.72
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.69
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.67
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.57
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.54
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.49
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.44
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.43
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.43
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.39
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.12
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.1
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.04
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.01
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.99
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.85
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.8
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.75
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.67
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.63
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.57
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.55
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.71
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.31
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 95.48
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.39
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.75
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 94.56
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.54
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 94.43
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.18
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.05
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.0
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 94.0
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.84
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 93.6
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 93.46
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.43
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 93.37
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 93.19
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 93.16
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 92.97
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.32
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 92.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.5
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.27
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 89.41
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 89.37
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 88.93
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 85.14
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 83.49
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 83.32
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 82.61
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 80.21
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=2.1e-30  Score=274.01  Aligned_cols=335  Identities=16%  Similarity=0.104  Sum_probs=300.1

Q ss_pred             hhhhccHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCHHHHHHHHhhcC----chhHHH
Q 007407          261 NSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLAR----PDEAKS  336 (605)
Q Consensus       261 ~~~~gd~~kAr~ll~~al~~~P~~~~~wia~Arle~~~g~~~~Ar~ll~~~l~~~P~~~~lwle~a~L~~----~~~Ak~  336 (605)
                      ..+.|++++|..+|.++++.+|+++..+..++.++...|+++.|..+++++++.+|.+..+|...+.++.    .+.|..
T Consensus         9 ~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~   88 (388)
T 1w3b_A            9 EYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIE   88 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHH
T ss_pred             HHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCCHHHHHH
Confidence            4567888888888888888888888888888888888888888888888888888888888877776542    257778


Q ss_pred             HHHHHHhhCCCc-----------------HHHHHHHHHHHHhCCCcHHHHHHHHH----hCCHHHHHHHHHHHHHhCCCC
Q 007407          337 VVAKGVRQIPKS-----------------ANKIRALRMALDEIPDSVRLWKALVE----ISSEEEARILLHRAVECCPLD  395 (605)
Q Consensus       337 ~l~~al~~~P~s-----------------~~a~~vl~kAle~~P~~~~lw~~l~~----le~~e~A~~~l~rAl~~~P~~  395 (605)
                      .|.+++...|++                 ..|...|+++++..|++...|..++.    ++++++|+.+|.++++..|.+
T Consensus        89 ~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~  168 (388)
T 1w3b_A           89 HYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNF  168 (388)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTC
T ss_pred             HHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCC
Confidence            888888888876                 45778899999999999988877654    458999999999999999999


Q ss_pred             HHHHHHHHHh----hcHHHHHHHHHHHHHhCCCCHHHHHHHHHHH-HcCCHHHHHHHHHHHHHHhccCcccccHHHHHHH
Q 007407          396 VELWLALVRL----ETYGVARSVLNKARKKLPKERAIWIAAAKLE-ANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKE  470 (605)
Q Consensus       396 ~~lw~aLa~l----e~~e~A~~vL~~al~~~p~~~~iwi~~a~Le-~~g~~~~a~~i~~~al~~~p~~~~~~~~~~wl~~  470 (605)
                      ...|..++.+    ++++.|...|+++++..|.+..+|..++.+. ..|++++|...|++++...|.     +...|...
T Consensus       169 ~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~-----~~~~~~~l  243 (388)
T 1w3b_A          169 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN-----HAVVHGNL  243 (388)
T ss_dssp             HHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT-----CHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcC-----CHHHHHHH
Confidence            9999988764    4789999999999999999999999999877 899999999999999998775     46789999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCchhhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHcCC
Q 007407          471 AEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGC  550 (605)
Q Consensus       471 A~~~e~~g~~~~A~~i~~~al~~~p~~~~~~~~~~~~a~~~~~~g~~~~A~~i~~~al~~~P~~~~~w~~la~l~~~~g~  550 (605)
                      +..+...|.++.|...+++++..+|.   ...+|..++..+...|++++|+.+|+++++.+|++..+|..++.++...|+
T Consensus       244 ~~~~~~~g~~~~A~~~~~~al~~~p~---~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~  320 (388)
T 1w3b_A          244 ACVYYEQGLIDLAIDTYRRAIELQPH---FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGN  320 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTCSS---CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHcCCHHHHHHHHHHHHhhCCC---CHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCC
Confidence            99999999999999999999999988   788899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHHCCCCC
Q 007407          551 RESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSE  603 (605)
Q Consensus       551 ~e~A~~~lekAl~~~P~~~~l~l~~a~~~~~~gd~~~Ar~il~kAl~~~P~~~  603 (605)
                      +++|+.+|+++++.+|++..+|..+|.++.+.|++++|...|+++++.+|++.
T Consensus       321 ~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~  373 (388)
T 1w3b_A          321 IEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFA  373 (388)
T ss_dssp             HHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCH
T ss_pred             HHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCH
Confidence            99999999999999999999999999999999999999999999999999864



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 605
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 1e-06
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-06
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 2e-04
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 48.4 bits (114), Expect = 1e-06
 Identities = 47/303 (15%), Positives = 94/303 (31%), Gaps = 63/303 (20%)

Query: 288 WIQAARLEELANEEAAARKLITKGCNM--------CPKNEDVWLEACRLARPDEAKSVVA 339
           W +  + E+        + LITK               + D+W EA +      +K +  
Sbjct: 11  WKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQY-LEQSSKLLAE 69

Query: 340 KGVRQIPK----SANKI--RALRMALDEIPDSVRLWKALVEISSE----EEARILLHRAV 389
           KG     K     A  I  RA+   L     ++ L+ A  +        E+   + +R +
Sbjct: 70  KGDMNNAKLFSDEAANIYERAISTLL---KKNMLLYFAYADYEESRMKYEKVHSIYNRLL 126

Query: 390 ECCPLDVELWL-----ALVRLETYGVARSVLNKARKKLPKERAIWIAAAKLEANGNTSMV 444
               +D  L          R E     R +  KAR+       +++ AA +E   +    
Sbjct: 127 AIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCS---- 182

Query: 445 GKIIERGIRALQGEEVVIDRDTWMKEAEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTW 504
                             D+    K  E+  +    +    +        ++E++  R  
Sbjct: 183 -----------------KDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVL 225

Query: 505 VADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGCRESLIALLRKAVTY 564
                           R + S +     + + IW +    E + G   S++ + ++  T 
Sbjct: 226 FE--------------RVLTSGSLPPEKSGE-IWARFLAFESNIGDLASILKVEKRRFTA 270

Query: 565 CPQ 567
             +
Sbjct: 271 FRE 273


>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query605
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.83
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.69
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.68
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.68
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.63
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.52
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.52
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.46
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.46
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.32
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.29
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.27
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.23
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.17
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.13
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.13
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.09
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.07
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.04
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.03
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.02
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.97
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.93
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.93
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.9
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.9
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.88
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.62
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.51
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.51
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.48
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.48
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.47
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.17
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.15
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.15
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.9
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.52
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.29
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.84
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.93
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.29
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 82.34
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 81.91
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.3e-28  Score=253.36  Aligned_cols=335  Identities=16%  Similarity=0.104  Sum_probs=292.7

Q ss_pred             hhhhccHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCHHHHHHHHhhcC----chhHHH
Q 007407          261 NSELRDILKARKIVRAVTKNSPKKPLGWIQAARLEELANEEAAARKLITKGCNMCPKNEDVWLEACRLAR----PDEAKS  336 (605)
Q Consensus       261 ~~~~gd~~kAr~ll~~al~~~P~~~~~wia~Arle~~~g~~~~Ar~ll~~~l~~~P~~~~lwle~a~L~~----~~~Ak~  336 (605)
                      ..+.|++++|..+|+++++.+|+++.+|..+|.++...|+++.|..+++++++.+|++.++|..++.++.    .+.|..
T Consensus         9 ~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~   88 (388)
T d1w3ba_           9 EYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIE   88 (388)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccc
Confidence            5688999999999999999999999999999999999999999999999999999999999998887653    367888


Q ss_pred             HHHHHHhhCCCcHH-----------------HHHHHHHHHHhCCCcHHHHHHHH----HhCCHHHHHHHHHHHHHhCCCC
Q 007407          337 VVAKGVRQIPKSAN-----------------KIRALRMALDEIPDSVRLWKALV----EISSEEEARILLHRAVECCPLD  395 (605)
Q Consensus       337 ~l~~al~~~P~s~~-----------------a~~vl~kAle~~P~~~~lw~~l~----~le~~e~A~~~l~rAl~~~P~~  395 (605)
                      .+..++...|....                 ............+.....+....    .......+...+.+.+...|.+
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  168 (388)
T d1w3ba_          89 HYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNF  168 (388)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTC
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcch
Confidence            89999988887721                 22223333344444443333322    2236688888999999999999


Q ss_pred             HHHHHHHHHh----hcHHHHHHHHHHHHHhCCCCHHHHHHHHHHH-HcCCHHHHHHHHHHHHHHhccCcccccHHHHHHH
Q 007407          396 VELWLALVRL----ETYGVARSVLNKARKKLPKERAIWIAAAKLE-ANGNTSMVGKIIERGIRALQGEEVVIDRDTWMKE  470 (605)
Q Consensus       396 ~~lw~aLa~l----e~~e~A~~vL~~al~~~p~~~~iwi~~a~Le-~~g~~~~a~~i~~~al~~~p~~~~~~~~~~wl~~  470 (605)
                      ..++..++.+    +.++.|...++++++..|.++.+|..++.+. ..|++++|...+++++...+.     ....|...
T Consensus       169 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~-----~~~~~~~l  243 (388)
T d1w3ba_         169 AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPN-----HAVVHGNL  243 (388)
T ss_dssp             HHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTT-----CHHHHHHH
T ss_pred             hHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhh-----HHHHHHHH
Confidence            9998887754    4688999999999999999999999999877 899999999999999887654     56778889


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCchhhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHcCC
Q 007407          471 AEVADRAGSVVTCVAIITNTIEIGVDEEDKKRTWVADVEECKKRGSIETARAIFSPACTVFLTKKNIWLKAAQLEKSYGC  550 (605)
Q Consensus       471 A~~~e~~g~~~~A~~i~~~al~~~p~~~~~~~~~~~~a~~~~~~g~~~~A~~i~~~al~~~P~~~~~w~~la~l~~~~g~  550 (605)
                      |..+...|.++.|...|++++..+|+   +..+|..++..+...|++.+|+..|+.++...|....+|..++.++...|+
T Consensus       244 ~~~~~~~~~~~~A~~~~~~al~~~p~---~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  320 (388)
T d1w3ba_         244 ACVYYEQGLIDLAIDTYRRAIELQPH---FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGN  320 (388)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHTCSS---CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHhCCC---CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCC
Confidence            99999999999999999999999988   788999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHHCCCCC
Q 007407          551 RESLIALLRKAVTYCPQAEVLWLMGAKEKWLAGDVPATRDILQEAYAAIPNSE  603 (605)
Q Consensus       551 ~e~A~~~lekAl~~~P~~~~l~l~~a~~~~~~gd~~~Ar~il~kAl~~~P~~~  603 (605)
                      +++|++.|+++++.+|+++.+|..+|.++...|++++|...|++|++++|+++
T Consensus       321 ~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~  373 (388)
T d1w3ba_         321 IEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFA  373 (388)
T ss_dssp             HHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCH
T ss_pred             HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCH
Confidence            99999999999999999999999999999999999999999999999999875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure