Citrus Sinensis ID: 007492

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-

MLLQLPRLTNSLREPFDIDQAYLQRKSILQNLQKPRNTTNSLDESETARKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGRPAEEEDNSVNRNIVEKKSKMQTLIGHAVSDASVYKVASLAQRLSKLQPSEHNVTLFSESLGNGSSDDFEFGSDLVFQAPARFLVDGSFEDGALMGDESIAPSSFHDGWYDGSDSMDYNSAADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLLKSEKTASNSQSRMPSYGTQVTVQTESERQIDKLRRKEEKRHRRGTEYAAENDVSSTSFSSLIEASERKNPLDGLIGSGQGSMAVTALPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLRQVYN

cccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccccccccccccccccEEcccccEEEccccEEEEEccccccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHHHccccccccEEEEEcccccccHHHHccccEEEEcccHHHHHHcccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHcc

ccccccHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHccHHcccHccccccccccccccEEEEccccHHccccccccccccccHHcccHHHHcccccccccccccccccHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccccccccccccccccccccccccccccccccccEcccccEEEccccEEEEEccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHccccccEcccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHcccEEEEccccccEEEcccccHHHHHEEEEEEEEHHHHcccccccHHHHHHHHHHHHHcc

mllqlprltnslrepfdiDQAYLQRKSILQnlqkprnttnsldesETARKIVYRWEEASTEVRQVYKQFIGAVVEfidgempseeFGEIALSAYhlfgrpaeeednsvnrNIVEKKSKMQTLIGHAVSDASVYKVASLAQRLsklqpsehnvTLFSeslgngssddfefgsdlvfqaparflvdgsfedgalmgdesiapssfhdgwydgsdsmdynsaadgrnfnLSWLRDACDRIVRQSISQLSRDDLAMAICRvldsdkpgeeiAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLLKsektasnsqsrmpsygtqvtvqteSERQIDKLRRKEEKRHrrgteyaaendvsstsfSSLIEaserknpldgligsgqgsmavtalpqgtvrkhlkgyeeviipptptaqmkpgekLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVyytnenilvcaptgagktNIAMISILHEIGQhfrdgylhkdefkIVYVAPMKALAAEVTRTfssrlsplNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEvhllnddrgpVIEALVARTLRQVYN

mllqlprltnslrepfdIDQAYLQRKSilqnlqkprnttnsldesetaRKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGrpaeeednsvnRNIVEKKSKMQTLIGHAVSDASVYKVASLAQRLSKLQPSEHNVTLFSESLGNGSSDDFEFGSDLVFQAPARFLVDGSFEDGALMGDESIAPSSFHDGWYDGSDSMDYNSAADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLLKSEKtasnsqsrmpsygtqvtvqteserqidklrrkeekrhrrgteyaaendvsstsFSSLIEASERKNPLDGLIGSGQGSMAVTALPQGTVRKHLKGYEEviipptptaqmkpGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTrtfssrlsplnMIVRELTGDMQLSRNELEEtqmivttpekwdvitRKSSDMSLSMLVKLLIIDEVhllnddrgpVIEALVARTLRQVYN

MLLQLPRLTNSLREPFDIDQAYLQRKSILQNLQKPRNTTNSLDESETARKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGRPAEEEDNSVNRNIVEKKSKMQTLIGHAVSDASVYKVASLAQRLSKLQPSEHNVTLFSESLGNGSSDDFEFGSDLVFQAPARFLVDGSFEDGALMGDESIAPSSFHDGWYDGSDSMDYNSAADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLLKSEKTASNSQSRMPSYGTQVTVQTESERQIDKLrrkeekrhrrGTEYAAENDVSSTSFSSLIEASERKNPLDGLIGSGQGSMAVTALPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLRQVYN

*********************Y**************************RKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFG**********************TLIGHAVSDASVYKVASLA***************************FEFGSDLVFQAPARFLVDGSFEDGALMGD*SIA*SSFHDGWYDGS**MDYNSAADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLL*************************************************************************************ALPQGTVRKHLKGYEEVIIP***********KLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQ*******ETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLR****

***QLPRLTNSLR**********************************ARKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGRPAEEED********EKKSKMQTLIGHAVSDASVYKVASLAQRLSKLQ***********************GSDLVFQAPAR********************************************FNLSWLRDACDRIVR**I***S*DDLAMAICRVLDS*****EIAGDLLDLVGDSAFETVQDLISHRKQLVDAIR**********************************************************************************************QGTVRKHLKGYEEVIIPP*************EIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLRQV**

MLLQLPRLTNSLREPFDIDQAYLQRKSILQNLQK***********ETARKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGRPAEEEDNSVNRNIVEKKSKMQTLIGHAVSDASVYKVASLAQRLSKLQPSEHNVTLFSESLGNGSSDDFEFGSDLVFQAPARFLVDGSFEDGALMGDESIAPSSFHDGWYDGSDSMDYNSAADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLLKSE*********************************************************LIEASERKNPLDGLIGSGQGSMAVTALPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLRQVYN

*LLQLPRLTNSLREPFDIDQAYLQRKSILQNLQKPRNTTNSLDESETARKIVYRWEEASTEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGRPAEEEDNSVNRNIVEKKSKMQTLIGHAVSDASVYKVASLAQRLSKLQPS******************FEFGSDLVFQAPA**L***********************************SAADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRHGMLLLKSEKTASNSQSRMPSYGTQVTVQTESERQIDKLRRKE***************************SERKNPLDGLIGSGQGSMAVTALPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLRQVYN

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		601	2.2.26 [Sep-21-2011]
E1BNG3		2201	Activating signal cointeg	yes	no	0.582	0.159	0.455	9e-86
E9PZJ8		2198	Activating signal cointeg	yes	no	0.742	0.202	0.397	4e-85
F1LPQ2		2197	Activating signal cointeg	yes	no	0.585	0.160	0.456	5e-85
F1NTD6		2211	Activating signal cointeg	yes	no	0.589	0.160	0.456	9e-85
Q8N3C0		2202	Activating signal cointeg	yes	no	0.585	0.159	0.460	1e-84
E7F8F4		1534	Activating signal cointeg	yes	no	0.362	0.142	0.622	6e-72
Q54G57		2195	Activating signal cointeg	yes	no	0.850	0.232	0.330	2e-71
Q9U2G0		2145	Putative U5 small nuclear	no	no	0.427	0.119	0.469	2e-63
Q9UT24		2176	Pre-mRNA-splicing factor	yes	no	0.364	0.100	0.531	3e-63
O60072		1935	Putative helicase mug81 O	no	no	0.600	0.186	0.371	6e-63

>sp\|E1BNG3\|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1	Back alignment and function desciption

 Score =  318 bits (814), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 179/393 (45%), Positives = 247/393 (62%), Gaps = 43/393 (10%)

Query: 248 DDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIR-----HGML 302
           +DL   +  +L S K G+E+  +L +L+G    E ++ L+ +R  +VD        H + 
Sbjct: 245 EDLCCTLYDMLASVKSGDELQDELFELLGPDGLELIEKLLQNRVTIVDRFLNSSNDHKLQ 304

Query: 303 LLKSEKTASNSQSRMPSYGTQVTVQTESERQIDKLRRKEEKRHRRGTEYAAENDVSSTSF 362
            L+        ++  P+YG QVT+Q+E E+Q+ K  R+EEKR  R  + A E+  ++   
Sbjct: 305 ALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDGEATEGL 364

Query: 363 -------------SSLIEASERKNPL----------------------DGLIGSGQGSMA 387
                         +L+ A  R  P+                      + +  S   + A
Sbjct: 365 LCFDPKELRIHREQALMNA--RNVPILSRQRDTDVEKIRYPHVYDSQAEAMRTSAFIAGA 422

Query: 388 VTALPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQS 447
              LP+G  R++ K YEEV IP T    +   EK + I++LDE  Q AF G + LNRIQS
Sbjct: 423 KMILPEGIQRENNKIYEEVKIPYTEPMPIGFEEKPVYIQDLDEIGQLAFKGMRRLNRIQS 482

Query: 448 RIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKAL 507
            +F+T Y TNEN+L+CAPTGAGKTNIAM+++LHEI QHF+ G + K+EFKIVYVAPMKAL
Sbjct: 483 IVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMKAL 542

Query: 508 AAEVTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKS-SDMSLS 566
           AAE+T  FS RL PL ++V+ELTGDMQLS+NE+  TQM+VTTPEKWDV+TRKS  D++LS
Sbjct: 543 AAEMTNYFSKRLEPLGIVVKELTGDMQLSKNEILRTQMLVTTPEKWDVVTRKSVGDVALS 602

Query: 567 MLVKLLIIDEVHLLNDDRGPVIEALVARTLRQV 599
            +VKLLI+DEVHLL++DRGPV+E++VARTLRQV
Sbjct: 603 QIVKLLILDEVHLLHEDRGPVLESIVARTLRQV 635

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3, enabling ALKHB3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2

>sp\|E9PZJ8\|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=2 SV=1	Back alignment and function description

>sp\|F1LPQ2\|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=2 SV=1	Back alignment and function description

>sp\|F1NTD6\|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2	Back alignment and function description

>sp\|Q8N3C0\|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3	Back alignment and function description

>sp\|E7F8F4\|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2	Back alignment and function description

>sp\|Q54G57\|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1	Back alignment and function description

>sp\|Q9U2G0\|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1	Back alignment and function description

>sp\|Q9UT24\|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1	Back alignment and function description

>sp\|O60072\|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		601
255547213		2100	activating signal cointegrator 1 complex	0.996	0.285	0.794	0.0
225457229		2093	PREDICTED: activating signal cointegrato	0.991	0.284	0.753	0.0
147855267		735	hypothetical protein VITISV_035896 [Viti	0.988	0.808	0.753	0.0
297793665		2112	hypothetical protein ARALYDRAFT_919354 [	0.983	0.279	0.722	0.0
30697481		2146	U5 small nuclear ribonucleoprotein helic	0.983	0.275	0.714	0.0
334188537		2157	U5 small nuclear ribonucleoprotein helic	0.983	0.273	0.714	0.0
356516857		2088	PREDICTED: activating signal cointegrato	0.988	0.284	0.729	0.0
357457339		1465	Activating signal cointegrator 1 complex	0.990	0.406	0.705	0.0
449439311		2093	PREDICTED: activating signal cointegrato	0.985	0.282	0.702	0.0
449487073		2067	PREDICTED: LOW QUALITY PROTEIN: activati	0.916	0.266	0.710	0.0

>gi\|255547213\|ref\|XP_002514664.1\| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis] gi\|223546268\|gb\|EEF47770.1\| activating signal cointegrator 1 complex subunit 3, helc1, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/602 (79%), Positives = 523/602 (86%), Gaps = 3/602 (0%)

Query: 1   MLLQLPRLTNSLREPFDIDQAYLQRKSILQNLQ-KPRNTTNSLDESETARKIVYRWEEAS 59
           ML+QLPRLTNSLREPFDIDQAYLQRK ILQN   KPRN  NSL+ESE ARKIV RWEEAS
Sbjct: 1   MLMQLPRLTNSLREPFDIDQAYLQRKIILQNYHLKPRNNANSLNESELARKIVDRWEEAS 60

Query: 60  TEVRQVYKQFIGAVVEFIDGEMPSEEFGEIALSAYHLFGRPAEEEDNSVNRNIVEKKSKM 119
           TEVRQ YKQFIGAVVE +DGE+PSEEF E+AL+AY LF  P   E++ V  N +  KS++
Sbjct: 61  TEVRQAYKQFIGAVVELVDGEVPSEEFREVALTAYRLFAGPGPGEEDIVRSNFLNNKSEL 120

Query: 120 QTLIGHAVSDASVYKVASLAQRLSKLQPSEHNVTLFSESLGNGSSDDFEFGSDLVFQAPA 179
           Q +IGHA SDA + KVA+LAQRL  LQP+     L  ES  NG+ DD EFG+DLVFQAPA
Sbjct: 121 QKIIGHAFSDAKLQKVATLAQRLYNLQPTNSGAALVPESHVNGTGDDIEFGADLVFQAPA 180

Query: 180 RFLVDGSFEDGALMGDESIAPSSFHDGWYDGSDSMDYNSAADGRNFNLSWLRDACDRIVR 239
           RFLVD + EDG L+GDE+  PSSF +GWYD SD    +  A G  F+LSWL+DACD IVR
Sbjct: 181 RFLVDITLEDGELLGDETAGPSSFREGWYDNSDYDRNHFVAKGGTFDLSWLKDACDHIVR 240

Query: 240 QSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRH 299
           +S SQLSRDDLAMAICRVLDSDKPGEEIA +LLDLVGDSAF+TVQDLISHR +LVDAI  
Sbjct: 241 ESTSQLSRDDLAMAICRVLDSDKPGEEIASELLDLVGDSAFDTVQDLISHRSELVDAIHR 300

Query: 300 GMLLLKSEKTASNSQSRMPSYGTQVTVQTESERQIDKLRRKEEKRHRRGTEYAAENDVSS 359
           G+ +LKS+K AS++QSRMPSYGTQVTVQTESE+QIDKLRRKEEKRHRRGTE+ AEND  +
Sbjct: 301 GLAILKSDKMASSTQSRMPSYGTQVTVQTESEKQIDKLRRKEEKRHRRGTEHIAENDALA 360

Query: 360 TSFSSLIEASERKNPLDGLIGSGQG--SMAVTALPQGTVRKHLKGYEEVIIPPTPTAQMK 417
             FSSL++ASERK P+D LIGSG G  S++VTALPQGT RKH KGYEEVIIP TPTAQ+K
Sbjct: 361 ARFSSLLQASERKKPIDDLIGSGSGPQSLSVTALPQGTTRKHHKGYEEVIIPSTPTAQLK 420

Query: 418 PGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMIS 477
           PGEKLIEIKELD+FAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMIS
Sbjct: 421 PGEKLIEIKELDDFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKTNIAMIS 480

Query: 478 ILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTGDMQLSR 537
           ILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVT TFS RLSPLNM+VRELTGDMQLS+
Sbjct: 481 ILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTSTFSHRLSPLNMVVRELTGDMQLSK 540

Query: 538 NELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLR 597
           NELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLR
Sbjct: 541 NELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLR 600

Query: 598 QV 599
           QV
Sbjct: 601 QV 602

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225457229\|ref\|XP_002284129.1\| PREDICTED: activating signal cointegrator 1 complex subunit 3 [Vitis vinifera] gi\|297733882\|emb\|CBI15129.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147855267\|emb\|CAN79622.1\| hypothetical protein VITISV_035896 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297793665\|ref\|XP_002864717.1\| hypothetical protein ARALYDRAFT_919354 [Arabidopsis lyrata subsp. lyrata] gi\|297310552\|gb\|EFH40976.1\| hypothetical protein ARALYDRAFT_919354 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|30697481\|ref\|NP_200922.2\| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gi\|332010042\|gb\|AED97425.1\| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334188537\|ref\|NP_001190584.1\| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gi\|9759460\|dbj\|BAB10376.1\| RNA helicase [Arabidopsis thaliana] gi\|332010043\|gb\|AED97426.1\| U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356516857\|ref\|XP_003527109.1\| PREDICTED: activating signal cointegrator 1 complex subunit 3 [Glycine max]	Back alignment and taxonomy information

>gi\|357457339\|ref\|XP_003598950.1\| Activating signal cointegrator 1 complex subunit [Medicago truncatula] gi\|355487998\|gb\|AES69201.1\| Activating signal cointegrator 1 complex subunit [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449439311\|ref\|XP_004137429.1\| PREDICTED: activating signal cointegrator 1 complex subunit 3-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449487073\|ref\|XP_004157488.1\| PREDICTED: LOW QUALITY PROTEIN: activating signal cointegrator 1 complex subunit 3-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		601
MGI\|MGI:1925237		2198	Ascc3 "activating signal coint	0.347	0.095	0.657	1e-78
UNIPROTKB\|E2QVY0		1925	ASCC3 "Uncharacterized protein	0.347	0.108	0.647	1.5e-78
UNIPROTKB\|F6Y2F0		2202	ASCC3 "Uncharacterized protein	0.347	0.094	0.647	3.1e-78
UNIPROTKB\|E1BNG3		2201	ascc3 "Activating signal coint	0.347	0.094	0.652	5e-78
RGD\|1307995		2197	Ascc3 "activating signal coint	0.347	0.095	0.652	5.5e-78
UNIPROTKB\|Q8N3C0		2202	ASCC3 "Activating signal coint	0.347	0.094	0.647	4.6e-77
UNIPROTKB\|F1NTD6		2211	ascc3 "Activating signal coint	0.347	0.094	0.652	1.5e-75
DICTYBASE\|DDB_G0290389		2195	ascc3 "activating signal coint	0.625	0.171	0.407	3e-73
WB\|WBGene00013189		2017	Y54E2A.4 [Caenorhabditis elega	0.347	0.103	0.584	7.2e-65
FB\|FBgn0038344		2183	CG5205 [Drosophila melanogaste	0.357	0.098	0.576	4e-64

MGI\|MGI:1925237 Ascc3 "activating signal cointegrator 1 complex subunit 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

 Score = 697 (250.4 bits), Expect = 1.0e-78, Sum P(2) = 1.0e-78
 Identities = 138/210 (65%), Positives = 170/210 (80%)

Query:   391 LPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIF 450
             LP+G  R++ K YEEV IP      +   EK + IK+LDE  Q AF G K LNRIQS +F
Sbjct:   427 LPEGIQRENTKLYEEVRIPYGEPMPVGFEEKPVYIKDLDEVGQLAFKGMKRLNRIQSIVF 486

Query:   451 QTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAE 510
             +T Y TNEN+L+CAPTGAGKTNIAM++ILHEI QHF  G + K+EFKIVYVAPMKALAAE
Sbjct:   487 ETAYNTNENMLICAPTGAGKTNIAMLTILHEIRQHFHQGVIKKNEFKIVYVAPMKALAAE 546

Query:   511 VTRTFSSRLSPLNMIVRELTGDMQLSRNELEETQMIVTTPEKWDVITRKS-SDMSLSMLV 569
             +T  FS RL PL ++V+ELTGDMQLS++E+  TQM+VTTPEKWDV+TRKS  D++LS +V
Sbjct:   547 MTNYFSKRLEPLGIVVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVALSQIV 606

Query:   570 KLLIIDEVHLLNDDRGPVIEALVARTLRQV 599
             KLLI+DEVHLL++DRGPV+E++VARTLRQV
Sbjct:   607 KLLILDEVHLLHEDRGPVLESIVARTLRQV 636

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0006200 "ATP catabolic process" evidence=ISO

GO:0006281 "DNA repair" evidence=IEA

GO:0006307 "DNA dealkylation involved in DNA repair" evidence=ISO

GO:0006351 "transcription, DNA-dependent" evidence=IEA

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA

GO:0006974 "response to DNA damage stimulus" evidence=IEA

GO:0008026 "ATP-dependent helicase activity" evidence=IEA

GO:0008283 "cell proliferation" evidence=ISO

GO:0016787 "hydrolase activity" evidence=IEA

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0032508 "DNA duplex unwinding" evidence=ISO

GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=ISO

UNIPROTKB\|E2QVY0 ASCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F6Y2F0 ASCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BNG3 ascc3 "Activating signal cointegrator 1 complex subunit 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1307995 Ascc3 "activating signal cointegrator 1 complex subunit 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8N3C0 ASCC3 "Activating signal cointegrator 1 complex subunit 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NTD6 ascc3 "Activating signal cointegrator 1 complex subunit 3" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0290389 ascc3 "activating signal cointegrator 1 complex subunit" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

WB\|WBGene00013189 Y54E2A.4 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

FB\|FBgn0038344 CG5205 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00016213001	SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (2066 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00028826001	SubName- Full=Chromosome chr1 scaffold_46, whole genome shotgun sequence; (563 aa)	•	•	•	0.421

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		601
COG1204		766	COG1204, COG1204, Superfamily II helicase [General	2e-49
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	3e-29
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	9e-22
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	5e-16
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	3e-13
PRK00254		720	PRK00254, PRK00254, ski2-like helicase; Provisiona	8e-13
PRK02362		737	PRK02362, PRK02362, ski2-like helicase; Provisiona	1e-12
COG1205		851	COG1205, COG1205, Distinct helicase family with a	1e-11
PRK01172		674	PRK01172, PRK01172, ski2-like helicase; Provisiona	6e-11
COG1202		830	COG1202, COG1202, Superfamily II helicase, archaea	3e-10
COG4581		1041	COG4581, COG4581, Superfamily II RNA helicase [DNA	8e-10
PRK13767		876	PRK13767, PRK13767, ATP-dependent helicase; Provis	3e-09
PRK13766		773	PRK13766, PRK13766, Hef nuclease; Provisional	2e-08
TIGR04121		803	TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA	4e-08
COG1111		542	COG1111, MPH1, ERCC4-like helicases [DNA replicati	5e-07
COG1203		733	COG1203, COG1203, CRISPR-associated helicase Cas3	2e-05
PRK09751		1490	PRK09751, PRK09751, putative ATP-dependent helicas	2e-04
cd09639		353	cd09639, Cas3_I, CRISPR/Cas system-associated prot	3e-04
cd00268		203	cd00268, DEADc, DEAD-box helicases	8e-04
TIGR01587		358	TIGR01587, cas3_core, CRISPR-associated helicase C	8e-04
COG1061		442	COG1061, SSL2, DNA or RNA helicases of superfamily	0.002

>gnl\|CDD\|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only]	Back alignment and domain information

 Score =  182 bits (465), Expect = 2e-49
 Identities = 71/191 (37%), Positives = 104/191 (54%), Gaps = 21/191 (10%)

Query: 412 PTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQSRIFQTVYYTNENILVCAPTGAGKT 471
            T+++K  ++++EI + D   +         N  Q  + +    ++EN+L+ APTG+GKT
Sbjct: 10  ATSKVKLDDRVLEILKGDGIDEL-------FNPQQEAVEK-GLLSDENVLISAPTGSGKT 61

Query: 472 NIAMISILHEIGQHFRDGYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMIVRELTG 531
            IA+++IL  +          +   K+VY+ P+KALA E    FS RL  L + V   TG
Sbjct: 62  LIALLAILSTLL---------EGGGKVVYIVPLKALAEEKYEEFS-RLEELGIRVGISTG 111

Query: 532 DMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDD-RGPVIEA 590
           D  L    L    +IVTTPEK D +TRK    S    V L++IDE+HLL D  RGPV+E+
Sbjct: 112 DYDLDDERLARYDVIVTTPEKLDSLTRKRP--SWIEEVDLVVIDEIHLLGDRTRGPVLES 169

Query: 591 LVARTLRQVYN 601
           +VAR  R    
Sbjct: 170 IVARMRRLNEL 180

Length = 766

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234702 PRK00254, PRK00254, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|235032 PRK02362, PRK02362, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|100801 PRK01172, PRK01172, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|237496 PRK13766, PRK13766, Hef nuclease; Provisional	Back alignment and domain information

>gnl\|CDD\|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated	Back alignment and domain information

>gnl\|CDD\|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>gnl\|CDD\|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3	Back alignment and domain information

>gnl\|CDD\|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		601
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	100.0
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	100.0
COG1204		766	Superfamily II helicase [General function predicti	99.95
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	99.93
PRK02362		737	ski2-like helicase; Provisional	99.93
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	99.92
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	99.92
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	99.91
PRK00254		720	ski2-like helicase; Provisional	99.91
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	99.91
PTZ00110		545	helicase; Provisional	99.9
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	99.9
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	99.9
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	99.9
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	99.9
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	99.89
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	99.89
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	99.89
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	99.89
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.89
PRK01172		674	ski2-like helicase; Provisional	99.88
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	99.88
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	99.88
PRK13767		876	ATP-dependent helicase; Provisional	99.88
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	99.88
PTZ00424		401	helicase 45; Provisional	99.87
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	99.86
KOG0343		758	consensus RNA Helicase [RNA processing and modific	99.86
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.86
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	99.86
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.85
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.85
KOG0347		731	consensus RNA helicase [RNA processing and modific	99.85
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	99.84
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	99.84
COG1205		851	Distinct helicase family with a unique C-terminal	99.83
KOG0346		569	consensus RNA helicase [RNA processing and modific	99.82
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	99.82
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	99.82
COG1202		830	Superfamily II helicase, archaea-specific [General	99.81
KOG0334		997	consensus RNA helicase [RNA processing and modific	99.79
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	99.76
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.76
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	99.76
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.74
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.74
PRK09401		1176	reverse gyrase; Reviewed	99.73
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	99.73
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.73
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.72
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.72
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.72
KOG4284		980	consensus DEAD box protein [Transcription]	99.72
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.71
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.71
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.7
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.7
PRK14701		1638	reverse gyrase; Provisional	99.69
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	99.68
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.68
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.68
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.68
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.67
PHA02558		501	uvsW UvsW helicase; Provisional	99.67
PRK10689		1147	transcription-repair coupling factor; Provisional	99.67
KOG0327		397	consensus Translation initiation factor 4F, helica	99.66
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.66
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.63
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	99.61
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.6
KOG0354		746	consensus DEAD-box like helicase [General function	99.58
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.58
PRK13766		773	Hef nuclease; Provisional	99.55
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.53
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.5
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.49
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.48
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.48
PRK05580		679	primosome assembly protein PriA; Validated	99.48
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.48
PHA02653		675	RNA helicase NPH-II; Provisional	99.42
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.4
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	99.36
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.35
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.35
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.34
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.34
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.34
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.31
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.23
PRK09694		878	helicase Cas3; Provisional	99.23
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.22
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.21
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.19
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.19
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.16
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.15
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.15
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.09
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.07
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.04
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.04
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.04
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.03
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.0
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	98.99
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	98.95
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	98.95
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	98.87
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	98.85
COG1198		730	PriA Primosomal protein N' (replication factor Y)	98.84
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	98.74
COG4096		875	HsdR Type I site-specific restriction-modification	98.74
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	98.68
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	98.68
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	98.65
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	98.61
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	98.6
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	98.55
PRK12326		764	preprotein translocase subunit SecA; Reviewed	98.54
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	98.52
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	98.49
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.43
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.42
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.4
PRK04914		956	ATP-dependent helicase HepA; Validated	98.27
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	98.25
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	98.15
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.13
PRK14873		665	primosome assembly protein PriA; Provisional	98.13
COG4889		1518	Predicted helicase [General function prediction on	98.13
CHL00122		870	secA preprotein translocase subunit SecA; Validate	98.11
KOG1123		776	consensus RNA polymerase II transcription initiati	98.07
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	98.03
PRK15483		986	type III restriction-modification system StyLTI en	97.96
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.9
KOG1803		649	consensus DNA helicase [Replication, recombination	97.9
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	97.73
PF13245		76	AAA_19: Part of AAA domain	97.71
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	97.66
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	97.64
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.63
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	97.57
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	97.55
COG0610		962	Type I site-specific restriction-modification syst	97.55
KOG4439		901	consensus RNA polymerase II transcription terminat	97.52
PRK10536		262	hypothetical protein; Provisional	97.5
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.48
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	97.46
TIGR00376		637	DNA helicase, putative. The gene product may repre	97.37
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	97.35
KOG0387		923	consensus Transcription-coupled repair protein CSB	97.22
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	97.19
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	97.18
PRK10875		615	recD exonuclease V subunit alpha; Provisional	97.16
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.16
KOG2340		698	consensus Uncharacterized conserved protein [Funct	97.13
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	97.07
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	97.05
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	97.02
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.99
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	96.99
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	96.93
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	96.86
COG3587		985	Restriction endonuclease [Defense mechanisms]	96.85
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	96.82
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.82
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	96.74
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	96.71
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	96.67
PRK11054		684	helD DNA helicase IV; Provisional	96.67
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.6
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.56
smart00382		148	AAA ATPases associated with a variety of cellular	96.43
PRK13889		988	conjugal transfer relaxase TraA; Provisional	96.42
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	96.4
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	96.25
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	96.23
PRK13826		1102	Dtr system oriT relaxase; Provisional	96.23
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	96.23
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	96.23
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	96.17
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	96.15
PRK06526		254	transposase; Provisional	96.12
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.08
PRK04296		190	thymidine kinase; Provisional	96.05
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	96.0
KOG1805		1100	consensus DNA replication helicase [Replication, r	95.92
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	95.89
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	95.85
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	95.77
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	95.62
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	95.54
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	95.54
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.51
PRK13833		323	conjugal transfer protein TrbB; Provisional	95.49
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	95.43
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	95.29
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	95.24
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	95.23
PRK08903		227	DnaA regulatory inactivator Hda; Validated	95.09
KOG1131		755	consensus RNA polymerase II transcription initiati	95.09
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	95.02
PTZ00112		1164	origin recognition complex 1 protein; Provisional	94.97
COG3973		747	Superfamily I DNA and RNA helicases [General funct	94.9
PRK08181		269	transposase; Validated	94.89
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	94.85
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	94.85
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	94.79
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	94.74
PRK08727		233	hypothetical protein; Validated	94.67
PHA02533		534	17 large terminase protein; Provisional	94.66
PRK00411		394	cdc6 cell division control protein 6; Reviewed	94.65
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	94.54
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.52
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	94.5
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	94.44
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	94.41
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	94.37
PRK14087		450	dnaA chromosomal replication initiation protein; P	94.28
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	94.2
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	94.18
PRK13851		344	type IV secretion system protein VirB11; Provision	94.14
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	94.14
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	94.14
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	94.13
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	94.09
PRK05298		652	excinuclease ABC subunit B; Provisional	94.05
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	94.03
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	93.88
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	93.86
PHA03333		752	putative ATPase subunit of terminase; Provisional	93.8
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	93.73
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.72
PRK00149		450	dnaA chromosomal replication initiation protein; R	93.71
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	93.71
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	93.7
COG1484		254	DnaC DNA replication protein [DNA replication, rec	93.7
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	93.64
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	93.64
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	93.63
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	93.59
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	93.52
PRK11823		446	DNA repair protein RadA; Provisional	93.48
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	93.47
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	93.36
PRK12402		337	replication factor C small subunit 2; Reviewed	93.3
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	93.24
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	93.2
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	93.19
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	93.08
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	93.07
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	93.02
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	93.02
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	92.94
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	92.93
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	92.83
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	92.82
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	92.81
PRK14088		440	dnaA chromosomal replication initiation protein; P	92.79
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	92.77
PRK04328		249	hypothetical protein; Provisional	92.75
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	92.71
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	92.71
PRK12377		248	putative replication protein; Provisional	92.7
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	92.66
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	92.66
PHA03368		738	DNA packaging terminase subunit 1; Provisional	92.61
PRK08116		268	hypothetical protein; Validated	92.54
PRK10436		462	hypothetical protein; Provisional	92.53
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	92.51
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	92.43
PRK09354		349	recA recombinase A; Provisional	92.42
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	92.4
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	92.34
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	92.33
cd00983		325	recA RecA is a bacterial enzyme which has roles in	92.32
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	92.29
PRK05973		237	replicative DNA helicase; Provisional	92.28
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	92.23
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	92.17
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	92.1
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	92.07
PRK07952		244	DNA replication protein DnaC; Validated	92.07
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	92.06
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	92.02
PLN03025		319	replication factor C subunit; Provisional	91.99
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	91.9
PF12846		304	AAA_10: AAA-like domain	91.84
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	91.82
PRK06067		234	flagellar accessory protein FlaH; Validated	91.7
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	91.69
PRK09183		259	transposase/IS protein; Provisional	91.67
KOG0298		1394	consensus DEAD box-containing helicase-like transc	91.55
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	91.53
TIGR02533		486	type_II_gspE general secretory pathway protein E.	91.48
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	91.45
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	91.23
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	91.17
TIGR00064		272	ftsY signal recognition particle-docking protein F	91.12
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	91.11
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	91.11
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	91.05
KOG2028		554	consensus ATPase related to the helicase subunit o	90.87
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	90.78
KOG1001		674	consensus Helicase-like transcription factor HLTF/	90.65
PRK14974		336	cell division protein FtsY; Provisional	90.64
PRK04195		482	replication factor C large subunit; Provisional	90.61
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	90.54
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	90.52
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	90.47
PRK14086		617	dnaA chromosomal replication initiation protein; P	90.31
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	90.3
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	90.22
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	90.19
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	90.15
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	90.13
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	90.06
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	90.04
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	89.86
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	89.69
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	89.68
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	89.66
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	89.62
PRK06835		329	DNA replication protein DnaC; Validated	89.56
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	89.54
TIGR00665		434	DnaB replicative DNA helicase. This model describe	89.51
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	89.42
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	89.2
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	89.18
TIGR03744		893	traC_PFL_4706 conjugative transfer ATPase, PFL_470	89.0
PHA02544		316	44 clamp loader, small subunit; Provisional	88.99
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	88.93
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	88.92
PRK13764		602	ATPase; Provisional	88.9
PRK05748		448	replicative DNA helicase; Provisional	88.75
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	88.69
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	88.59
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	88.51
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	88.34
PRK08533		230	flagellar accessory protein FlaH; Reviewed	88.3
PRK06921		266	hypothetical protein; Provisional	88.23
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	88.21
PRK05707		328	DNA polymerase III subunit delta'; Validated	88.19
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	88.15
TIGR02784		1141	addA_alphas double-strand break repair helicase Ad	88.13
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	88.07
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	88.05
TIGR00767		415	rho transcription termination factor Rho. Members	87.98
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	87.95
PRK13897		606	type IV secretion system component VirD4; Provisio	87.87
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	87.84
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	87.71
PRK10263		1355	DNA translocase FtsK; Provisional	87.44
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	87.41
PRK00440		319	rfc replication factor C small subunit; Reviewed	87.17
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	87.11
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	86.94
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	86.71
PRK13850		670	type IV secretion system protein VirD4; Provisiona	86.62
PRK10689		1147	transcription-repair coupling factor; Provisional	86.56
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	86.55
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	86.52
PRK08760		476	replicative DNA helicase; Provisional	86.42
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	86.4
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	86.35
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	86.23
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	86.2
TIGR03743		634	SXT_TraD conjugative coupling factor TraD, SXT/TOL	86.14
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	86.07
TIGR02237		209	recomb_radB DNA repair and recombination protein R	85.82
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	85.75
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	85.72
cd01127		410	TrwB Bacterial conjugation protein TrwB, ATP bindi	85.64
CHL00176		638	ftsH cell division protein; Validated	85.57
PRK09112		351	DNA polymerase III subunit delta'; Validated	85.53
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	85.46
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	85.4
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	85.4
PF10412		386	TrwB_AAD_bind: Type IV secretion-system coupling p	85.32
PRK05642		234	DNA replication initiation factor; Validated	85.28
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	85.17
PF13555		62	AAA_29: P-loop containing region of AAA domain	85.13
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	85.05
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	85.04
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	84.98
TIGR03754		643	conj_TOL_TraD conjugative coupling factor TraD, TO	84.93
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	84.74
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	84.7
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	84.67
PRK09519		790	recA DNA recombination protein RecA; Reviewed	84.54
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	84.53
PRK13880		636	conjugal transfer coupling protein TraG; Provision	84.47
PHA00729		226	NTP-binding motif containing protein	84.4
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	84.35
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	84.34
TIGR00959		428	ffh signal recognition particle protein. This mode	84.31
PRK08084		235	DNA replication initiation factor; Provisional	84.27
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	84.06
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	84.03
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	84.02
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	83.98
PF00154		322	RecA: recA bacterial DNA recombination protein; In	83.96
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	83.93
COG4626		546	Phage terminase-like protein, large subunit [Gener	83.92
cd01394		218	radB RadB. The archaeal protein radB shares simila	83.89
PRK09376		416	rho transcription termination factor Rho; Provisio	83.73
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	83.72
TIGR02759		566	TraD_Ftype type IV conjugative transfer system cou	83.61
PRK10867		433	signal recognition particle protein; Provisional	83.53
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	83.45
PRK05636		505	replicative DNA helicase; Provisional	83.37
TIGR02746		797	TraC-F-type type-IV secretion system protein TraC.	83.31
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	83.3
PRK13695		174	putative NTPase; Provisional	83.24
COG0606		490	Predicted ATPase with chaperone activity [Posttran	83.23
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	82.92
PRK06904		472	replicative DNA helicase; Validated	82.8
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	82.76
PRK05595		444	replicative DNA helicase; Provisional	82.72
PRK10416		318	signal recognition particle-docking protein FtsY;	82.69
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	82.67
PRK07471		365	DNA polymerase III subunit delta'; Validated	82.58
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	82.35
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	82.25
COG2109		198	BtuR ATP:corrinoid adenosyltransferase [Coenzyme m	82.01
COG3598		402	RepA RecA-family ATPase [DNA replication, recombin	81.92
CHL00095		821	clpC Clp protease ATP binding subunit	81.9
PHA02244		383	ATPase-like protein	81.9
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	81.89
PRK13822		641	conjugal transfer coupling protein TraG; Provision	81.65
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	81.6
PRK00771		437	signal recognition particle protein Srp54; Provisi	81.46
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	81.37
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	81.32
PRK06893		229	DNA replication initiation factor; Validated	81.23
PRK14729		300	miaA tRNA delta(2)-isopentenylpyrophosphate transf	81.09
PRK08506		472	replicative DNA helicase; Provisional	81.07
cd03115		173	SRP The signal recognition particle (SRP) mediates	80.99
PRK08699		325	DNA polymerase III subunit delta'; Validated	80.85
PRK08939		306	primosomal protein DnaI; Reviewed	80.84
cd01128		249	rho_factor Transcription termination factor rho is	80.84

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=4e-60  Score=531.24  Aligned_cols=370  Identities=38%  Similarity=0.581  Sum_probs=300.6

Q ss_pred             CCCCcCcHHHHHHHHHHHhhhhcccCCHHHHHHHHHHHhccCCChhHHHHHHHHhhCCCchHHHHHHHHhHHHHHHHHHh
Q 007492          220 ADGRNFNLSWLRDACDRIVRQSISQLSRDDLAMAICRVLDSDKPGEEIAGDLLDLVGDSAFETVQDLISHRKQLVDAIRH  299 (601)
Q Consensus       220 ~~~~~id~~wL~r~~~~~~~~~~~~~~~~~l~~~i~~~L~s~~~~~e~e~~L~~llg~~~~~~i~~l~~~r~~i~~~~~~  299 (601)
                      ..+++||++||||.++++|++  +. ..++....+..+|....+..++++.|+.+++|++|.||..|.+||..|+||+++
T Consensus        87 t~~~dIda~~LQR~irk~yel--a~-~~Qe~~~k~~~ilr~~~~~~~lE~~L~~ll~~e~~slV~~l~kNr~~i~~~t~L  163 (1674)
T KOG0951|consen   87 TRESDIDAPWLQRKIRKVYEL--AS-RLQEKERKAAEILRTASDDGDLEPKLVVLLQFEKISLVEFLRKNRLGIVWCTRL  163 (1674)
T ss_pred             cchhhhhHHHHHHHHHHHHhc--ch-hhHHHHHHHHHhHhhccCchhhhHHHHHhhhhhhhHHHHHHHhhcchhhHHHHh
Confidence            347899999999999999986  22 345555666667766557889999999999999999999999999999999987


Q ss_pred             hhhhhhhhhhhhccccCCCCCCccccccchHHHHHHHHHH--------HH-HHhhhcCccc-cccccccccchhhhHHhh
Q 007492          300 GMLLLKSEKTASNSQSRMPSYGTQVTVQTESERQIDKLRR--------KE-EKRHRRGTEY-AAENDVSSTSFSSLIEAS  369 (601)
Q Consensus       300 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~-~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  369 (601)
                      ..+  ..+.++..+++.|+..|...+      ..+.+...        ++ +++..++... .........+...+ ...
T Consensus       164 ~~a--aresE~~siEe~m~~lgp~l~------d~V~~~~a~~~~~~~qeek~~~l~~~e~~~~~~~~ls~td~~~v-~~~  234 (1674)
T KOG0951|consen  164 ARA--ARESERLSIEEIMRFLGPELN------DIVAKYIATRQTKSEQEEKEKKLEKREELLVSVIALSKTDVLGV-LEM  234 (1674)
T ss_pred             hhh--hccchhccHHHHHhhcChhhH------HHHHHHHhhhcccccchhhhhhhhccchhhhhhhhhcccccccc-ccc
Confidence            654  334456677888887763210      01111100        00 0111000000 00000000111111 111


Q ss_pred             hccCCCccccccCCC---CCccccCCcchhhcccCCcceEecCCCCCCCCCCCccccchhhhHHHHHHHhcCCCCCcHHH
Q 007492          370 ERKNPLDGLIGSGQG---SMAVTALPQGTVRKHLKGYEEVIIPPTPTAQMKPGEKLIEIKELDEFAQAAFHGYKSLNRIQ  446 (601)
Q Consensus       370 ~~~~~~~~~~~~~~~---~~~~~~lp~~~~~~~~~~~~e~~vp~~~~~~~~~~~~l~~i~~L~~~~~~~f~g~~~l~~iQ  446 (601)
                      ....+++.+.+.+++   .+..|.||+|+++...++|++++||++++.|+..++++..++++|+|++.+|.|..+||++|
T Consensus       235 ~~~iDLekt~ftEGe~lm~e~~c~lP~GS~rl~kk~yeevhVPa~~~~pf~~~Ekl~~iselP~Wnq~aF~g~~sLNrIQ  314 (1674)
T KOG0951|consen  235 RPVIDLEKTCFTEGEELMQEGKCKLPQGSFRLKKKGYEEVHVPAPSYFPFHKEEKLVKISELPKWNQPAFFGKQSLNRIQ  314 (1674)
T ss_pred             CcccchhhhhhhhhhhhhccCceecCCccEEEecCCceEEeCCCCCCCCCCccceeEeecCCcchhhhhcccchhhhHHH
Confidence            222347777766655   67889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCceeEeccCCCchHHHHHHHHHHHHhhhccc-CCCCCCCcEEEEEccChhHHHHHHHHHHhhcCCCCcE
Q 007492          447 SRIFQTVYYTNENILVCAPTGAGKTNIAMISILHEIGQHFRD-GYLHKDEFKIVYVAPMKALAAEVTRTFSSRLSPLNMI  525 (601)
Q Consensus       447 ~~~i~~~l~~~~n~lv~ApTGsGKT~va~l~il~~l~~~~~~-~~~~~~~~kvl~laPtraLa~Q~~~~~~~~l~~~~i~  525 (601)
                      ++++++++...+|+++|||||+||||+|+++||+.+..|.+. |......++++|++||++||+++++.|++++.++||+
T Consensus       315 S~v~daAl~~~EnmLlCAPTGaGKTNVAvLtiLqel~~h~r~dgs~nl~~fKIVYIAPmKaLvqE~VgsfSkRla~~GI~  394 (1674)
T KOG0951|consen  315 SKVYDAALRGDENMLLCAPTGAGKTNVAVLTILQELGNHLREDGSVNLAPFKIVYIAPMKALVQEMVGSFSKRLAPLGIT  394 (1674)
T ss_pred             HHHHHHHhcCcCcEEEeccCCCCchHHHHHHHHHHHhcccccccceecccceEEEEeeHHHHHHHHHHHHHhhccccCcE
Confidence            999999998899999999999999999999999999998763 6666778999999999999999999999999999999


Q ss_pred             EEEEeCCCccchhhcCCccEEEEChhhHHHHHccCCCCCccCCccEEEeccCcccCCCChHHHHHHHHHHHhhhcC
Q 007492          526 VRELTGDMQLSRNELEETQMIVTTPEKWDVITRKSSDMSLSMLVKLLIIDEVHLLNDDRGPVIEALVARTLRQVYN  601 (601)
Q Consensus       526 V~~l~Gd~~~~~~~~~~~~IiVtTPekld~l~r~~~~~~~~~~v~llIiDEaH~l~d~rg~~le~iv~r~~r~~e~  601 (601)
                      |.++|||.+++..++.+++|||||||+||+++|++.+..+.+.|+++||||+|++||+|||++|+||+|+.|+.|+
T Consensus       395 V~ElTgD~~l~~~qieeTqVIV~TPEK~DiITRk~gdraY~qlvrLlIIDEIHLLhDdRGpvLESIVaRt~r~ses  470 (1674)
T KOG0951|consen  395 VLELTGDSQLGKEQIEETQVIVTTPEKWDIITRKSGDRAYEQLVRLLIIDEIHLLHDDRGPVLESIVARTFRRSES  470 (1674)
T ss_pred             EEEecccccchhhhhhcceeEEeccchhhhhhcccCchhHHHHHHHHhhhhhhhcccccchHHHHHHHHHHHHhhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999875

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10263 DNA translocase FtsK; Provisional	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13850 type IV secretion system protein VirD4; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK13880 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02746 TraC-F-type type-IV secretion system protein TraC	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism]	Back alignment and domain information

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>PRK13822 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

Homologous Structure Templates