Citrus Sinensis ID: 007530


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600
MKSLLRYKHKFYYKSFSSSAIASASANANATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIKGKRNHPRIAEIYSKLEKLVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW
ccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccEEEEcccccccccccccccccccc
ccHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEccccccccccccEcccccc
mksllrykhkfyyksfssSAIASASANANATELSTLQATLQSCArerapvrgkvCHAKIIgmglnndtltsNILINFYSKCGLISGARkvfdempqrCIVSWNTIIGSYTTNGREQEAVALFINMLregktpyseftVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRvfesmpernevtWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKtgfgsnmfAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMqqaglhpneqTYISVLSACSHIGMVEKGKSYFDLMVKQHnvlpnvfhYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLfgmepdnagnhLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIkgkrnhprIAEIYSKLEKLVEEMKKlgykpetehdlhdvedsRKQELLIHHSEKLALTFGlmclcpgvpirimknlricgDCHSFMKFASRIAGRETIVRDLNrfhhftngscscwdfw
MKSLLRYKHKFYYKSFSSSAIASASANANATELSTLQATLQSCARERAPVRGKVCHAKIigmglnndtLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARklirdsevkkekskswveikgkrnhpriaeIYSKLEKLVEEMKKLGykpetehdlhdVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFhhftngscscwdfw
MKSLLRYKHKFYYKsfsssaiasasananaTELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIRDsevkkekskswveikGKRNHPRIAEIYSkleklveemkklGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW
****LRYKHKFYYKSF*******************LQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLI*************V*I*******RIAEIYSKLEKLV**************************LLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDF*
*KS*L**KHKFYYKSFS****************STLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIKGKRNHPRIAEIYSKLEKLVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW
MKSLLRYKHKFYYKSFSSSAIASASANANATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIR************VEIKGKRNHPRIAEIYSKLEKLVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW
MKSLLRYKHKFYYKSFSSSAIASASANANATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIKGKRNHPRIAEIYSKLEKLVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSLLRYKHKFYYKSFSSSAIASASANANATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIKGKRNHPRIAEIYSKLEKLVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query600 2.2.26 [Sep-21-2011]
Q9LZ19635 Pentatricopeptide repeat- yes no 0.975 0.921 0.595 0.0
Q9LIQ7633 Pentatricopeptide repeat- no no 0.931 0.883 0.418 1e-138
Q9LW63715 Putative pentatricopeptid no no 0.981 0.823 0.379 1e-127
Q9SY02781 Pentatricopeptide repeat- no no 0.868 0.667 0.408 1e-126
Q9SI53630 Pentatricopeptide repeat- no no 0.958 0.912 0.404 1e-126
Q9SR82685 Putative pentatricopeptid no no 0.941 0.824 0.388 1e-125
Q0WSH6684 Pentatricopeptide repeat- no no 0.941 0.826 0.411 1e-124
Q7Y211890 Pentatricopeptide repeat- no no 0.943 0.635 0.388 1e-124
Q9LIC3628 Putative pentatricopeptid no no 0.938 0.896 0.393 1e-123
Q9LTF4588 Putative pentatricopeptid no no 0.93 0.948 0.419 1e-123
>sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protein At5g04780 OS=Arabidopsis thaliana GN=PCMP-H16 PE=2 SV=2 Back     alignment and function desciption
 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/594 (59%), Positives = 452/594 (76%), Gaps = 9/594 (1%)

Query: 15  SFSSSAIASASANANATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNIL 74
           S+    ++    +   +  + +   LQ CAR  A +  K CH KII + L  D    N+L
Sbjct: 43  SYDQEEVSPGRYSNEFSNRNLVHEILQLCARNGAVMEAKACHGKIIRIDLEGDVTLLNVL 102

Query: 75  INFYSKCGLISGARKVFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYS 134
           IN YSKCG +  AR+VFD M +R +VSWNT+IG YT N  E EA+ +F+ M  EG   +S
Sbjct: 103 INAYSKCGFVELARQVFDGMLERSLVSWNTMIGLYTRNRMESEALDIFLEMRNEG-FKFS 161

Query: 135 EFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFE 194
           EFT+SSVL AC    D  ECK+LH  ++K  +D N++VGTALLD+YAKCG+I DA +VFE
Sbjct: 162 EFTISSVLSACGVNCDALECKKLHCLSVKTCIDLNLYVGTALLDLYAKCGMIKDAVQVFE 221

Query: 195 SMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQ 254
           SM +++ VTWSSMVAG+VQN+ YEEAL+L+RRAQ + LE NQFT+SSVICAC+ LAALI+
Sbjct: 222 SMQDKSSVTWSSMVAGYVQNKNYEEALLLYRRAQRMSLEQNQFTLSSVICACSNLAALIE 281

Query: 255 GKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSR 314
           GKQ+HAV+CK+GFGSN+F ASS VDMYAKCG + ++Y +FS ++EKN+ LWNT+ISGF++
Sbjct: 282 GKQMHAVICKSGFGSNVFVASSAVDMYAKCGSLRESYIIFSEVQEKNLELWNTIISGFAK 341

Query: 315 HARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVF 374
           HAR  EVMILFEKMQQ G+HPNE T+ S+LS C H G+VE+G+ +F LM   + + PNV 
Sbjct: 342 HARPKEVMILFEKMQQDGMHPNEVTFSSLLSVCGHTGLVEEGRRFFKLMRTTYGLSPNVV 401

Query: 375 HYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGM 434
           HYSCM+DILGRAGL+ EAY+LI ++PFD TAS+WGSLLASCR Y+NLELAE+AA++LF +
Sbjct: 402 HYSCMVDILGRAGLLSEAYELIKSIPFDPTASIWGSLLASCRVYKNLELAEVAAEKLFEL 461

Query: 435 EPDNAGNHLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIK--------GKRN 486
           EP+NAGNH+LLSNIYAAN++WEE+A++RKL+RD +VKK + KSW++IK        G+  
Sbjct: 462 EPENAGNHVLLSNIYAANKQWEEIAKSRKLLRDCDVKKVRGKSWIDIKDKVHTFSVGESG 521

Query: 487 HPRIAEIYSKLEKLVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLC 546
           HPRI EI S L+ LV + +K GYKP  EH+LHDVE  +K+ELL+ HSEKLAL FGLMCL 
Sbjct: 522 HPRIREICSTLDNLVIKFRKFGYKPSVEHELHDVEIGKKEELLMQHSEKLALVFGLMCLP 581

Query: 547 PGVPIRIMKNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW 600
              P+RIMKNLRIC DCH FMK AS    R  IVRD+NRFHHF++G CSC DFW
Sbjct: 582 ESSPVRIMKNLRICVDCHEFMKAASMATRRFIIVRDVNRFHHFSDGHCSCGDFW 635





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H87 PE=2 SV=1 Back     alignment and function description
>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32 PE=3 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protein At2g03880, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H44 PE=2 SV=1 Back     alignment and function description
>sp|Q9SR82|PP219_ARATH Putative pentatricopeptide repeat-containing protein At3g08820 OS=Arabidopsis thaliana GN=PCMP-H84 PE=3 SV=1 Back     alignment and function description
>sp|Q0WSH6|PP312_ARATH Pentatricopeptide repeat-containing protein At4g14850 OS=Arabidopsis thaliana GN=LOI1 PE=1 SV=1 Back     alignment and function description
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H85 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containing protein At5g52630 OS=Arabidopsis thaliana GN=PCMP-H52 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query600
296084465621 unnamed protein product [Vitis vinifera] 0.95 0.917 0.720 0.0
225464414594 PREDICTED: pentatricopeptide repeat-cont 0.95 0.959 0.720 0.0
449494221638 PREDICTED: pentatricopeptide repeat-cont 0.98 0.921 0.647 0.0
147864762641 hypothetical protein VITISV_010661 [Viti 0.903 0.845 0.725 0.0
449446466638 PREDICTED: pentatricopeptide repeat-cont 0.98 0.921 0.646 0.0
356575510618 PREDICTED: pentatricopeptide repeat-cont 0.945 0.917 0.636 0.0
334187432635 pentatricopeptide repeat-containing prot 0.975 0.921 0.595 0.0
297806459637 binding protein [Arabidopsis lyrata subs 0.951 0.896 0.605 0.0
356534396632 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.943 0.895 0.600 0.0
7413540 864 putative protein [Arabidopsis thaliana] 0.908 0.630 0.617 0.0
>gi|296084465|emb|CBI25024.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/579 (72%), Positives = 479/579 (82%), Gaps = 9/579 (1%)

Query: 30  ATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARK 89
           AT +S LQ  LQS AR RA + G  CHA+II +GL  DT+TSN+L+N YSKCGL+  ARK
Sbjct: 44  ATHVSELQHLLQSSARNRAAIEGMACHAQIIRVGLRADTITSNMLMNMYSKCGLVESARK 103

Query: 90  VFDEMPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKR 149
           +FDEMP R +VSWNT++GS+T NG  ++A+ LF+ M +EG T  SEFTVSSV+CACAAK 
Sbjct: 104 LFDEMPVRSLVSWNTMVGSHTQNGDCEKALVLFMQMQKEG-TSCSEFTVSSVVCACAAKC 162

Query: 150 DVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVA 209
            VFECKQLH FALK A+D NVFVGTALLDVYAKCGL+ DA+ VFE MPER++VTWSSMVA
Sbjct: 163 CVFECKQLHGFALKTALDSNVFVGTALLDVYAKCGLVKDANLVFECMPERSDVTWSSMVA 222

Query: 210 GFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGS 269
           G+VQNELYEEAL+LF RAQ +GLE+NQFTISS + ACA  AALI+GKQV AV CKTG GS
Sbjct: 223 GYVQNELYEEALVLFHRAQAMGLEHNQFTISSALSACAARAALIEGKQVQAVSCKTGIGS 282

Query: 270 NMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQ 329
           N+F  SSL+DMYAKCG + +AY VFS +EEKNVVLWN ++SGFSRH RS+E MI FEKMQ
Sbjct: 283 NIFVISSLIDMYAKCGIIEEAYTVFSSVEEKNVVLWNAILSGFSRHVRSLEAMIYFEKMQ 342

Query: 330 QAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLI 389
           Q G+ PN+ TYISVLSACSH+G+VEKG+ YFDLM++ HNV PNV HYSCM+DILGRAGL+
Sbjct: 343 QMGICPNDITYISVLSACSHLGLVEKGRKYFDLMIRVHNVSPNVLHYSCMVDILGRAGLL 402

Query: 390 HEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIY 449
           HEA D I  MPFDATASMWGSLLASCR YRNLELAE+AAK LF +EP NAGNH+LLSNIY
Sbjct: 403 HEAKDFIDRMPFDATASMWGSLLASCRIYRNLELAEVAAKHLFEIEPHNAGNHVLLSNIY 462

Query: 450 AANRRWEEVARARKLIRDSEVKKEKSKSWVEIK--------GKRNHPRIAEIYSKLEKLV 501
           AAN RWEEVARAR L+++S+ KKE+ KSW+EIK        G+RNHPRI EIY KLE LV
Sbjct: 463 AANDRWEEVARARNLLKESKAKKERGKSWIEIKHKVHSFMVGERNHPRIVEIYLKLEDLV 522

Query: 502 EEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICG 561
            EMKK+GYK +TEHDLHDVE+SRKQELL HHSEKLALTFG+M L  G PIRIMKNLRICG
Sbjct: 523 GEMKKIGYKAKTEHDLHDVEESRKQELLRHHSEKLALTFGIMVLPHGAPIRIMKNLRICG 582

Query: 562 DCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW 600
           DCHSFMK AS I  RE IVRD NRFHHF NG CSC +FW
Sbjct: 583 DCHSFMKLASSITEREIIVRDTNRFHHFKNGYCSCGEFW 621




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225464414|ref|XP_002269452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449494221|ref|XP_004159483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147864762|emb|CAN84062.1| hypothetical protein VITISV_010661 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449446466|ref|XP_004140992.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356575510|ref|XP_003555883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] Back     alignment and taxonomy information
>gi|334187432|ref|NP_196098.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635619|sp|Q9LZ19.2|PP364_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g04780 gi|332003400|gb|AED90783.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806459|ref|XP_002871113.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297316950|gb|EFH47372.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356534396|ref|XP_003535741.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] Back     alignment and taxonomy information
>gi|7413540|emb|CAB86020.1| putative protein [Arabidopsis thaliana] gi|9758453|dbj|BAB08982.1| selenium-binding protein-like [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query600
TAIR|locus:2149664588 MEF1 "mitochondrial RNA editin 0.93 0.948 0.396 4.1e-113
TAIR|locus:2056794630 REME1 "required for efficiency 0.935 0.890 0.394 4.9e-108
TAIR|locus:2055919786 AT2G22070 "AT2G22070" [Arabido 0.711 0.543 0.396 5.7e-107
TAIR|locus:2130389684 LOI1 "lovastatin insensitive 1 0.941 0.826 0.394 1.2e-106
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.898 0.690 0.384 1.5e-106
TAIR|locus:2077878685 AT3G08820 "AT3G08820" [Arabido 0.941 0.824 0.369 2.5e-106
TAIR|locus:2091546628 AT3G13770 [Arabidopsis thalian 0.936 0.894 0.380 4e-106
TAIR|locus:2124137871 DOT4 "DEFECTIVELY ORGANIZED TR 0.94 0.647 0.369 2.2e-105
TAIR|locus:2103483890 OTP84 "ORGANELLE TRANSCRIPT PR 0.941 0.634 0.370 4.6e-105
TAIR|locus:2178188995 MEF7 "AT5G09950" [Arabidopsis 0.941 0.567 0.387 7.5e-105
TAIR|locus:2149664 MEF1 "mitochondrial RNA editing factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1116 (397.9 bits), Expect = 4.1e-113, P = 4.1e-113
 Identities = 226/570 (39%), Positives = 341/570 (59%)

Query:    40 LQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCI 99
             L S AR R+ ++G   H  ++  GL+   L +N LINFYSK  L   +R+ F++ PQ+  
Sbjct:    22 LLSSARTRSTIKGLQLHGYVVKSGLSLIPLVANNLINFYSKSQLPFDSRRAFEDSPQKSS 81

Query:   100 VSWNTIIGSYTTNGREQEAVAL-FINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLH 158
              +W++II  +  N  E   ++L F+  +  G     +  + S   +CA        + +H
Sbjct:    82 TTWSSIISCFAQN--ELPWMSLEFLKKMMAGNLRPDDHVLPSATKSCAILSRCDIGRSVH 139

Query:   159 VFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQNELYE 218
               ++K   D +VFVG++L+D+YAKCG I  A ++F+ MP+RN VTWS M+ G+ Q    E
Sbjct:   140 CLSMKTGYDADVFVGSSLVDMYAKCGEIVYARKMFDEMPQRNVVTWSGMMYGYAQMGENE 199

Query:   219 EALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLV 278
             EAL LF+ A    L  N ++ SSVI  CA    L  G+Q+H +  K+ F S+ F  SSLV
Sbjct:   200 EALWLFKEALFENLAVNDYSFSSVISVCANSTLLELGRQIHGLSIKSSFDSSSFVGSSLV 259

Query:   279 DMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQ 338
              +Y+KCG    AY VF+ +  KN+ +WN M+  +++H+ + +V+ LF++M+ +G+ PN  
Sbjct:   260 SLYSKCGVPEGAYQVFNEVPVKNLGIWNAMLKAYAQHSHTQKVIELFKRMKLSGMKPNFI 319

Query:   339 TYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILN 398
             T+++VL+ACSH G+V++G+ YFD M K+  + P   HY+ ++D+LGRAG + EA ++I N
Sbjct:   320 TFLNVLNACSHAGLVDEGRYYFDQM-KESRIEPTDKHYASLVDMLGRAGRLQEALEVITN 378

Query:   399 MPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRRWEEV 458
             MP D T S+WG+LL SC  ++N ELA  AA ++F + P ++G H+ LSN YAA+ R+E+ 
Sbjct:   379 MPIDPTESVWGALLTSCTVHKNTELAAFAADKVFELGPVSSGMHISLSNAYAADGRFEDA 438

Query:   459 ARARKLIRDXXXXXXXXXX--------XXXXXGKRNHPRIAEIYSXXXXXXXXXXXXGYK 510
             A+ARKL+RD                       G+R H +  EIY             GY 
Sbjct:   439 AKARKLLRDRGEKKETGLSWVEERNKVHTFAAGERRHEKSKEIYEKLAELGEEMEKAGYI 498

Query:   511 PETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFA 570
              +T + L +V+   K + + +HSE+LA+ FGL+      PIR+MKNLR+CGDCH+ +KF 
Sbjct:   499 ADTSYVLREVDGDEKNQTIRYHSERLAIAFGLITFPADRPIRVMKNLRVCGDCHNAIKFM 558

Query:   571 SRIAGRETIVRDLNRFHHFTNGSCSCWDFW 600
             S    R  IVRD NRFH F +G CSC D+W
Sbjct:   559 SVCTRRVIIVRDNNRFHRFEDGKCSCNDYW 588


GO:0005739 "mitochondrion" evidence=ISM
GO:0016554 "cytidine to uridine editing" evidence=IMP
TAIR|locus:2056794 REME1 "required for efficiency of mitochondrial editing 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055919 AT2G22070 "AT2G22070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130389 LOI1 "lovastatin insensitive 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077878 AT3G08820 "AT3G08820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091546 AT3G13770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LZ19PP364_ARATHNo assigned EC number0.59590.9750.9212yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00013819001
SubName- Full=Chromosome undetermined scaffold_100, whole genome shotgun sequence; (665 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query600
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-173
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-150
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-64
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-54
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-36
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 2e-20
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
pfam0153531 pfam01535, PPR, PPR repeat 0.003
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
 Score =  509 bits (1311), Expect = e-173
 Identities = 220/575 (38%), Positives = 338/575 (58%), Gaps = 9/575 (1%)

Query: 34  STLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDE 93
           ST  A +++C   ++    K  +  +   G   D    N ++  + KCG++  AR++FDE
Sbjct: 124 STYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDE 183

Query: 94  MPQRCIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFE 153
           MP+R + SW TIIG     G  +EA ALF  M  +G       T   +L A A       
Sbjct: 184 MPERNLASWGTIIGGLVDAGNYREAFALFREMWEDGSDAEPR-TFVVMLRASAGLGSARA 242

Query: 154 CKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSMVAGFVQ 213
            +QLH   LK  +  + FV  AL+D+Y+KCG I DA  VF+ MPE+  V W+SM+AG+  
Sbjct: 243 GQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIEDARCVFDGMPEKTTVAWNSMLAGYAL 302

Query: 214 NELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFA 273
           +   EEAL L+   +  G+  +QFT S +I   + LA L   KQ HA L +TGF  ++ A
Sbjct: 303 HGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVA 362

Query: 274 ASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGL 333
            ++LVD+Y+K G + DA  VF  +  KN++ WN +I+G+  H R  + + +FE+M   G+
Sbjct: 363 NTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGV 422

Query: 334 HPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAY 393
            PN  T+++VLSAC + G+ E+G   F  M + H + P   HY+CMI++LGR GL+ EAY
Sbjct: 423 APNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAY 482

Query: 394 DLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANR 453
            +I   PF  T +MW +LL +CR ++NLEL  +AA++L+GM P+   N+++L N+Y ++ 
Sbjct: 483 AMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYNSSG 542

Query: 454 RWEEVARARKLIRDSEVKKEKSKSWVEIK--------GKRNHPRIAEIYSKLEKLVEEMK 505
           R  E A+  + ++   +    + +W+E+K        G R HP+  EIY KL++L++E+ 
Sbjct: 543 RQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMKEIS 602

Query: 506 KLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHS 565
           + GY  E    L DV++  ++    +HSEKLA+ FGL+      P++I ++ RIC DCH 
Sbjct: 603 EYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHK 662

Query: 566 FMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW 600
            +KF + +  RE +VRD +RFHHF  G CSC D+W
Sbjct: 663 VIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW 697


Length = 697

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 600
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.84
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.8
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.8
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.78
PRK14574 822 hmsH outer membrane protein; Provisional 99.73
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.69
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.66
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.66
KOG2003840 consensus TPR repeat-containing protein [General f 99.61
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.56
KOG1915677 consensus Cell cycle control protein (crooked neck 99.56
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.55
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.55
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
KOG2076 895 consensus RNA polymerase III transcription factor 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.51
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.51
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.48
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.47
KOG2076 895 consensus RNA polymerase III transcription factor 99.46
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.45
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.44
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.43
KOG1915677 consensus Cell cycle control protein (crooked neck 99.42
KOG1126638 consensus DNA-binding cell division cycle control 99.42
KOG0547606 consensus Translocase of outer mitochondrial membr 99.4
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.39
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
KOG2003840 consensus TPR repeat-containing protein [General f 99.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.32
PF1304150 PPR_2: PPR repeat family 99.29
PF1304150 PPR_2: PPR repeat family 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.23
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.21
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.18
KOG0547606 consensus Translocase of outer mitochondrial membr 99.17
KOG2376652 consensus Signal recognition particle, subunit Srp 99.16
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.14
PRK12370553 invasion protein regulator; Provisional 99.13
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.12
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.12
PRK12370553 invasion protein regulator; Provisional 99.12
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.1
PRK11189296 lipoprotein NlpI; Provisional 99.02
KOG1129478 consensus TPR repeat-containing protein [General f 99.01
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.96
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.96
PRK11189296 lipoprotein NlpI; Provisional 98.93
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.93
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.91
KOG1129478 consensus TPR repeat-containing protein [General f 98.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.86
KOG1125579 consensus TPR repeat-containing protein [General f 98.83
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.83
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.81
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.78
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.77
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.77
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.77
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.76
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.74
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.73
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.73
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.71
PRK04841903 transcriptional regulator MalT; Provisional 98.7
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.69
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.68
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.65
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.65
PF1285434 PPR_1: PPR repeat 98.61
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.61
PF1285434 PPR_1: PPR repeat 98.59
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.57
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.57
KOG2376652 consensus Signal recognition particle, subunit Srp 98.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.51
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.49
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.48
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.43
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.43
PRK04841903 transcriptional regulator MalT; Provisional 98.43
PRK10370198 formate-dependent nitrite reductase complex subuni 98.43
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.41
PRK15359144 type III secretion system chaperone protein SscB; 98.4
PRK15359144 type III secretion system chaperone protein SscB; 98.35
KOG1128777 consensus Uncharacterized conserved protein, conta 98.34
PLN02789320 farnesyltranstransferase 98.32
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.32
KOG1128777 consensus Uncharacterized conserved protein, conta 98.27
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.25
KOG1125579 consensus TPR repeat-containing protein [General f 98.25
PRK10370198 formate-dependent nitrite reductase complex subuni 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.22
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.22
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.2
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.19
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.19
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.15
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.15
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.14
PLN02789320 farnesyltranstransferase 98.13
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.12
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.11
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.08
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.06
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.04
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.01
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.99
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.98
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.97
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.84
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.84
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.82
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.82
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.81
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.79
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.77
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.77
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.73
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.71
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.67
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.66
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.64
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.63
KOG0553304 consensus TPR repeat-containing protein [General f 97.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.55
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.54
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.5
KOG20411189 consensus WD40 repeat protein [General function pr 97.44
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.43
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.42
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.42
PRK15331165 chaperone protein SicA; Provisional 97.41
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.4
KOG0553304 consensus TPR repeat-containing protein [General f 97.37
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.36
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.35
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.33
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.31
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.31
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.29
COG4700251 Uncharacterized protein conserved in bacteria cont 97.28
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.25
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.24
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.22
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.21
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.21
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.2
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.19
PF1337173 TPR_9: Tetratricopeptide repeat 97.18
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.17
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.16
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.13
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.13
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.1
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.09
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.08
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.07
COG4700251 Uncharacterized protein conserved in bacteria cont 97.05
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.04
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.99
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.99
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.96
PF1343134 TPR_17: Tetratricopeptide repeat 96.94
PF12688120 TPR_5: Tetratrico peptide repeat 96.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.72
PF12688120 TPR_5: Tetratrico peptide repeat 96.63
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.63
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.62
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.62
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.61
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.6
PRK10803263 tol-pal system protein YbgF; Provisional 96.57
COG3898531 Uncharacterized membrane-bound protein [Function u 96.55
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.55
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.54
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.49
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.47
PF1342844 TPR_14: Tetratricopeptide repeat 96.46
PRK10803263 tol-pal system protein YbgF; Provisional 96.19
COG3898531 Uncharacterized membrane-bound protein [Function u 96.15
PF1337173 TPR_9: Tetratricopeptide repeat 96.13
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.09
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.05
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.01
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.99
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.98
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.89
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.87
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.71
KOG3941406 consensus Intermediate in Toll signal transduction 95.49
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.47
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.34
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.3
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.23
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.99
KOG1258577 consensus mRNA processing protein [RNA processing 94.96
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.91
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.9
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 94.86
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.78
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.76
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.73
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.69
KOG20411189 consensus WD40 repeat protein [General function pr 94.59
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.55
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.43
smart00299140 CLH Clathrin heavy chain repeat homology. 94.37
smart00299140 CLH Clathrin heavy chain repeat homology. 94.33
PF13512142 TPR_18: Tetratricopeptide repeat 94.3
KOG1585308 consensus Protein required for fusion of vesicles 94.25
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.23
KOG4555175 consensus TPR repeat-containing protein [Function 94.17
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.78
PRK11906458 transcriptional regulator; Provisional 93.74
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.64
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.55
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.54
PRK15331165 chaperone protein SicA; Provisional 93.53
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.47
PF13512142 TPR_18: Tetratricopeptide repeat 93.32
KOG3941406 consensus Intermediate in Toll signal transduction 93.09
PRK11906458 transcriptional regulator; Provisional 93.03
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.02
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.0
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.98
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.95
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.91
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.91
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.69
KOG4555175 consensus TPR repeat-containing protein [Function 92.62
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.49
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.44
KOG4234271 consensus TPR repeat-containing protein [General f 92.28
PRK11619 644 lytic murein transglycosylase; Provisional 92.13
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.06
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.62
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.26
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.08
PF1342844 TPR_14: Tetratricopeptide repeat 90.83
COG3629280 DnrI DNA-binding transcriptional activator of the 90.46
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.29
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.88
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.88
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 89.78
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.73
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.63
KOG1585308 consensus Protein required for fusion of vesicles 89.22
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.13
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 89.05
COG3629280 DnrI DNA-binding transcriptional activator of the 89.0
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.99
KOG1941518 consensus Acetylcholine receptor-associated protei 88.77
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.67
PRK09687280 putative lyase; Provisional 88.59
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.53
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.53
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.47
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.4
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.82
PF1343134 TPR_17: Tetratricopeptide repeat 87.22
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.34
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.26
COG4649221 Uncharacterized protein conserved in bacteria [Fun 85.08
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 84.86
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.68
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 84.64
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 84.62
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.39
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.37
PRK12798421 chemotaxis protein; Reviewed 84.06
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.79
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.38
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.86
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 82.69
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 82.64
KOG4648 536 consensus Uncharacterized conserved protein, conta 81.82
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 81.79
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.74
PRK11619644 lytic murein transglycosylase; Provisional 81.69
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.33
KOG3364149 consensus Membrane protein involved in organellar 81.3
KOG4570418 consensus Uncharacterized conserved protein [Funct 80.84
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-117  Score=967.23  Aligned_cols=572  Identities=38%  Similarity=0.682  Sum_probs=564.8

Q ss_pred             CCCCCHhHHHHHHHHHhccCCchhHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHccCCCCCcchHHHHHH
Q 007530           28 ANATELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEMPQRCIVSWNTIIG  107 (600)
Q Consensus        28 ~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~~~~~~~~~~~li~  107 (600)
                      +..||..+|+.++.+|++.++++.|.++|..|.+.|+.||+.+||.|+++|+++|++++|+++|++|++||+++||++|.
T Consensus       118 ~~~~~~~t~~~ll~a~~~~~~~~~a~~l~~~m~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~~~~t~n~li~  197 (697)
T PLN03081        118 PFTLPASTYDALVEACIALKSIRCVKAVYWHVESSGFEPDQYMMNRVLLMHVKCGMLIDARRLFDEMPERNLASWGTIIG  197 (697)
T ss_pred             CCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCcchHHHHHHHHHHhcCCCHHHHHHHHhcCCCCCeeeHHHHHH
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCChhHHHHHHHHHHHcCCCCCChhhHHHHHHHHhcCCChHHHHHHHHHHHHhCCCCChhHHHHHHHHHHHcCCHH
Q 007530          108 SYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLIS  187 (600)
Q Consensus       108 ~~~~~g~~~~A~~~~~~m~~~g~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~  187 (600)
                      +|++.|++++|+++|++|.+.| +.||..||+.++.+|+..|+.+.+.++|..+.+.|+.+|..++|+|+++|+++|+++
T Consensus       198 ~~~~~g~~~~A~~lf~~M~~~g-~~p~~~t~~~ll~a~~~~~~~~~~~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~  276 (697)
T PLN03081        198 GLVDAGNYREAFALFREMWEDG-SDAEPRTFVVMLRASAGLGSARAGQQLHCCVLKTGVVGDTFVSCALIDMYSKCGDIE  276 (697)
T ss_pred             HHHHCcCHHHHHHHHHHHHHhC-CCCChhhHHHHHHHHhcCCcHHHHHHHHHHHHHhCCCccceeHHHHHHHHHHCCCHH
Confidence            9999999999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHccCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCchHHHHHHHHHHHHhCC
Q 007530          188 DASRVFESMPERNEVTWSSMVAGFVQNELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGF  267 (600)
Q Consensus       188 ~A~~~f~~m~~~d~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~  267 (600)
                      +|.++|++|+++|+++||+||.+|++.|++++|+++|++|.+.|+.||..||++++.+|++.|.++.|.++|..|.+.|+
T Consensus       277 ~A~~vf~~m~~~~~vt~n~li~~y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~  356 (697)
T PLN03081        277 DARCVFDGMPEKTTVAWNSMLAGYALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGF  356 (697)
T ss_pred             HHHHHHHhCCCCChhHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCchhHHHHHHHHHHhhCCHHHHHHHHhcCCCcCHhHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHH
Q 007530          268 GSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSAC  347 (600)
Q Consensus       268 ~~~~~~~~~l~~~y~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~  347 (600)
                      +||..++++|+++|+++|++++|.++|++|.++|+++||+||.+|+++|+.++|+++|++|.+.|+.||..||+.++.+|
T Consensus       357 ~~d~~~~~~Li~~y~k~G~~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~  436 (697)
T PLN03081        357 PLDIVANTALVDLYSKWGRMEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSAC  436 (697)
T ss_pred             CCCeeehHHHHHHHHHCCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HccCCHHHHHHHHHHHHHhcCCCccHHHHHHHHHHHHhcCCHHHHHHHHHcCCCCCCHHHHHHHHHHHHHcCChHHHHHH
Q 007530          348 SHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLIHEAYDLILNMPFDATASMWGSLLASCRNYRNLELAEIA  427 (600)
Q Consensus       348 ~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~p~~~~~~~ll~~~~~~~~~~~a~~~  427 (600)
                      ++.|++++|.++|+.|.+++|+.|+..+|++|+++|++.|++++|.+++++|+..|+..+|++|+.+|+.+|+++.|+.+
T Consensus       437 ~~~g~~~~a~~~f~~m~~~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~  516 (697)
T PLN03081        437 RYSGLSEQGWEIFQSMSENHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLA  516 (697)
T ss_pred             hcCCcHHHHHHHHHHHHHhcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHH
Confidence            99999999999999998888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCCcchHHHHHHHHHhcCChHHHHHHHHHhhhCCCccCCceEEEEEcCc--------ccCcchHHHHHHHHH
Q 007530          428 AKQLFGMEPDNAGNHLLLSNIYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIKGK--------RNHPRIAEIYSKLEK  499 (600)
Q Consensus       428 ~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~~i~~~--------~~~~~~~~~~~~l~~  499 (600)
                      ++++++++|++..+|..|+++|++.|+|++|.++++.|+++|+++.|++||+++.+.        ..||+.+++++.+.+
T Consensus       517 ~~~l~~~~p~~~~~y~~L~~~y~~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~~  596 (697)
T PLN03081        517 AEKLYGMGPEKLNNYVVLLNLYNSSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDE  596 (697)
T ss_pred             HHHHhCCCCCCCcchHHHHHHHHhCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999998765        579999999999999


Q ss_pred             HHHHHHHCCCccCCcccccccchhHHhhHhhHHHHHHHHHHccccCCCCCcEEEEecccccCCchhHHHHHhhhcCCcEE
Q 007530          500 LVEEMKKLGYKPETEHDLHDVEDSRKQELLIHHSEKLALTFGLMCLCPGVPIRIMKNLRICGDCHSFMKFASRIAGRETI  579 (600)
Q Consensus       500 l~~~m~~~g~~pd~~~~~~~~~~~~~~~~l~~h~~~~a~~~~~~~~~~~~~~~~~~~~~~c~~~~~a~~~~~~~~~~~~~  579 (600)
                      +..+|++.||.||+..++|++++++++..+.+|||+||++|||+.+|+|.||||+||+|+|+|||+|+|+||++.+|+||
T Consensus       597 l~~~~~~~gy~~~~~~~~~~~~~~~~~~~~~~hsekla~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~  676 (697)
T PLN03081        597 LMKEISEYGYVAEENELLPDVDEDEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIV  676 (697)
T ss_pred             HHHHHHHcCCCCCcchhhccccHHHHHHHHHhccHHHHHHhhCccCCCCCeEEEecCCEECCCchhhHHHHhhhcceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCcccccccccccCCCCC
Q 007530          580 VRDLNRFHHFTNGSCSCWDFW  600 (600)
Q Consensus       580 ~~d~~~~h~~~~g~csc~~~w  600 (600)
                      |||.+|||||+||+|||+|||
T Consensus       677 ~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        677 VRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             EecCCccccCCCCcccccccC
Confidence            999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query600
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 69.5 bits (169), Expect = 2e-12
 Identities = 99/597 (16%), Positives = 169/597 (28%), Gaps = 208/597 (34%)

Query: 148 KRDVFECKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESMPERNEVTWSSM 207
             + F+CK +        M +++     +  +      +S   R+F ++  + E     M
Sbjct: 30  VDN-FDCKDV------QDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQE----EM 78

Query: 208 VAGFVQNEL------------------------YEEAL-ILFRRAQVLGLEYNQFTISSV 242
           V  FV+  L                        Y E    L+   QV   +YN   +   
Sbjct: 79  VQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFA-KYNVSRLQPY 137

Query: 243 ICACAGLAALIQGKQV--HAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIEEK 300
           +     L  L   K V    VL   G G    A    +    +C         F      
Sbjct: 138 LKLRQALLELRPAKNVLIDGVL---GSGKTWVALDVCLSYKVQCK------MDFK----- 183

Query: 301 NVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGM-VEKGKSY 359
             + W  +     ++  S E ++   +M Q  L+  +  + S     S+I + +   ++ 
Sbjct: 184 --IFWLNL-----KNCNSPETVL---EMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAE 233

Query: 360 FD--LMVKQHN----VLPNV--------FHYSCMI----------DILGRAGLIH----- 390
               L  K +     VL NV        F+ SC I          D L  A   H     
Sbjct: 234 LRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDH 293

Query: 391 --------EAYDL---ILNM-----PFDATA------SMWGSLLAS--CR--NYR----- 419
                   E   L    L+      P +         S+    +        N++     
Sbjct: 294 HSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCD 353

Query: 420 -----------NLELAEIAAKQLF---GMEPDNAGNHLLLSNIYAA--NRRWEEVARARK 463
                       LE AE   +++F    + P +A       +I     +  W +V +   
Sbjct: 354 KLTTIIESSLNVLEPAEY--RKMFDRLSVFPPSA-------HIPTILLSLIWFDVIK--- 401

Query: 464 LIRDSE--VKKEKSKSWVEIKGKRNHPRIAEIYSKLEKLVEEMKKL------GYKPETEH 515
              D    V K    S VE + K +   I  IY +L+  +E    L       Y      
Sbjct: 402 --SDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTF 459

Query: 516 DLHDV----EDSRKQELLIHH------SEK--------LALTF--------GLMCLCPGV 549
           D  D+     D      + HH       E+        L   F               G 
Sbjct: 460 DSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGS 519

Query: 550 PIRIMKNLR-----ICGDCHSFMKFASRIAGRETIVRDLNRF-----HHFTNGSCSC 596
            +  ++ L+     IC +   +          E +V  +  F      +      + 
Sbjct: 520 ILNTLQQLKFYKPYICDNDPKY----------ERLVNAILDFLPKIEENLICSKYTD 566


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query600
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.57
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.51
3u4t_A272 TPR repeat-containing protein; structural genomics 99.51
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.47
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.47
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.46
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.45
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.44
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.44
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.43
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.43
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.42
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.4
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.38
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.38
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.37
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.37
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.29
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.24
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.22
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.19
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.18
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.14
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.03
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.99
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.98
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.92
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.91
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.89
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.88
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.88
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.87
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.87
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.86
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.81
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.71
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.7
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.7
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.69
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.68
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.67
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.66
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.65
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.65
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.63
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.61
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.6
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.6
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.58
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.58
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.56
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.56
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.56
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.55
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.53
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.5
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.48
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.46
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.42
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.36
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.34
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.34
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.34
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.33
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.29
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.29
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.27
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.25
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.25
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.24
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.22
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.21
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.2
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.17
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.15
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.12
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.1
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.08
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.03
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.99
3k9i_A117 BH0479 protein; putative protein binding protein, 97.96
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.96
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.94
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.92
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.92
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.92
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.9
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.88
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.84
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.84
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.84
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.83
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.81
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.79
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.78
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.74
3k9i_A117 BH0479 protein; putative protein binding protein, 97.73
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.71
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.71
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.65
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.58
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.54
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.48
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.41
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.41
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.32
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.32
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.12
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.1
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.03
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.03
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.96
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.9
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.84
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.81
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.73
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.69
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.59
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.56
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.5
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.72
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.59
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.47
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.4
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.35
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.19
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.9
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.61
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 94.59
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.35
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.43
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.2
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.14
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.61
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.19
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.08
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.58
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 90.54
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.37
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.76
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.02
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.2
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 87.26
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.9
2uwj_G115 Type III export protein PSCG; virulence, chaperone 86.75
2p58_C116 Putative type III secretion protein YSCG; type III 86.35
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 86.13
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 85.6
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.5
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.23
2p58_C116 Putative type III secretion protein YSCG; type III 83.12
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.92
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 80.5
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2.8e-39  Score=348.86  Aligned_cols=430  Identities=10%  Similarity=-0.003  Sum_probs=385.7

Q ss_pred             CCHhHHHHHHHHHhccCCchhHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHccC--CCCCcchHHHHHHH
Q 007530           31 TELSTLQATLQSCARERAPVRGKVCHAKIIGMGLNNDTLTSNILINFYSKCGLISGARKVFDEM--PQRCIVSWNTIIGS  108 (600)
Q Consensus        31 p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~~--~~~~~~~~~~li~~  108 (600)
                      ++...|+.++..+.+.|+++.|..+++.+.+.  .|+..++..++.+|.+.|++++|..+|+.+  ..++..+|+.++.+
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~  159 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFC  159 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHH
Confidence            57788999999999999999999999999854  578889999999999999999999999998  46789999999999


Q ss_pred             HHcCCChhHHHHHHHHHHHc---------------CCCCCChhhHHHHHHHHhcCCChHHHHHHHHHHHHhCCCCChhHH
Q 007530          109 YTTNGREQEAVALFINMLRE---------------GKTPYSEFTVSSVLCACAAKRDVFECKQLHVFALKAAMDRNVFVG  173 (600)
Q Consensus       109 ~~~~g~~~~A~~~~~~m~~~---------------g~~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~  173 (600)
                      |.+.|++++|+++|+++...               | .+++..+|+.++.++.+.|++++|.++|+.+.+.++. +...+
T Consensus       160 ~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~  237 (597)
T 2xpi_A          160 LVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGG-IKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAF  237 (597)
T ss_dssp             HHHTTCHHHHHHHHCSSCTTC----------CCCSS-CCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHH
T ss_pred             HHHHhhHHHHHHHHhccCCccccccccccccccccc-cchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHH
Confidence            99999999999999853222               2 3446889999999999999999999999999998643 33333


Q ss_pred             --------------------------------------HHHHHHHHHcCCHHHHHHHHccCCC--CCHHHHHHHHHHHHh
Q 007530          174 --------------------------------------TALLDVYAKCGLISDASRVFESMPE--RNEVTWSSMVAGFVQ  213 (600)
Q Consensus       174 --------------------------------------~~li~~y~~~g~~~~A~~~f~~m~~--~d~~~~~~li~~~~~  213 (600)
                                                            +.++.+|.+.|++++|.++|+++.+  ++..+|+.++.+|.+
T Consensus       238 ~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~  317 (597)
T 2xpi_A          238 DQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFV  317 (597)
T ss_dssp             HHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTGGGCHHHHHHHHHHHHH
T ss_pred             HHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcCCchHHHHHHHHHHHHH
Confidence                                                  3336677789999999999999988  799999999999999


Q ss_pred             CCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCchHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhhCCHHHHHHH
Q 007530          214 NELYEEALILFRRAQVLGLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFV  293 (600)
Q Consensus       214 ~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~y~~~g~~~~A~~~  293 (600)
                      .|++++|+++|++|...+ +.+..++..++.++.+.|++++|..++..+.+.. +.+..+++.++.+|.++|++++|.++
T Consensus       318 ~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~  395 (597)
T 2xpi_A          318 RSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRY  395 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             hcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHH
Confidence            999999999999999765 3477889999999999999999999999999764 66889999999999999999999999


Q ss_pred             HhcCC---CcCHhHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHhcCCC
Q 007530          294 FSGIE---EKNVVLWNTMISGFSRHARSVEVMILFEKMQQAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVL  370 (600)
Q Consensus       294 ~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~  370 (600)
                      |+++.   ..+..+|+.++.+|.+.|++++|+++|++|.+.+ +++..++..++.+|.+.|++++|.++|+.+.+..  +
T Consensus       396 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~--~  472 (597)
T 2xpi_A          396 FSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF--Q  472 (597)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC--C
T ss_pred             HHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--C
Confidence            99875   3568899999999999999999999999999863 4578899999999999999999999999997543  3


Q ss_pred             ccHHHHHHHHHHHHhcCCHHHHHHHHHcC-------CCCCC--HHHHHHHHHHHHHcCChHHHHHHHHHHhcCCCCCcch
Q 007530          371 PNVFHYSCMIDILGRAGLIHEAYDLILNM-------PFDAT--ASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGN  441 (600)
Q Consensus       371 p~~~~~~~li~~~~~~g~~~~A~~~~~~m-------~~~p~--~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~p~~~~~  441 (600)
                      .+..+|..++.+|.+.|++++|.++|+++       +..|+  ..+|..++.+|...|++++|...++++++.+|+++.+
T Consensus       473 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~  552 (597)
T 2xpi_A          473 YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANV  552 (597)
T ss_dssp             CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHH
T ss_pred             CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHH
Confidence            46789999999999999999999999987       45777  7899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCChHHHHHHHHHhhhCC
Q 007530          442 HLLLSNIYAANRRWEEVARARKLIRDSE  469 (600)
Q Consensus       442 ~~~l~~~~~~~g~~~~a~~~~~~m~~~~  469 (600)
                      |..++.+|.+.|++++|.+.++++.+..
T Consensus       553 ~~~l~~~~~~~g~~~~A~~~~~~~l~~~  580 (597)
T 2xpi_A          553 HTAIALVYLHKKIPGLAITHLHESLAIS  580 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHhCCHHHHHHHHHHHHhcC
Confidence            9999999999999999999999998653



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 600
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.7 bits (86), Expect = 0.003
 Identities = 32/238 (13%), Positives = 77/238 (32%), Gaps = 26/238 (10%)

Query: 273 AASSLVDMYAKCGCVVDAYFVFS---GIEEKNVVLWNTMISGFSRHARSVEVMILFEKMQ 329
           A S+L  ++   G +  A   F     ++   +  +  + +           +  + +  
Sbjct: 171 AWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRAL 230

Query: 330 QAGLHPNEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRAGLI 389
                 +   + ++       G+++     +   ++     P+   Y  + + L   G +
Sbjct: 231 SLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDA--YCNLANALKEKGSV 287

Query: 390 HEA--YDLILNMPFDATASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSN 447
            EA              A    +L    R   N+E A    ++   + P+ A  H  L++
Sbjct: 288 AEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLAS 347

Query: 448 IYAANRRWEEVARARKLIRDSEVKKEKSKSWVEIKGKRNHPRIAEIYSKLEKLVEEMK 505
           +     + +E   A    +               +  R  P  A+ YS +   ++EM+
Sbjct: 348 VLQQQGKLQE---ALMHYK---------------EAIRISPTFADAYSNMGNTLKEMQ 387


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query600
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.02
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.98
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.93
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.83
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.66
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.47
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.46
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.41
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.4
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.31
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.29
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.25
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.19
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.18
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.13
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.06
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.01
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.96
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.92
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.92
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.91
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.9
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.86
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.81
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.8
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.74
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.56
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.29
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.28
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.17
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.17
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.95
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.92
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.92
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.91
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.52
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.13
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.89
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.38
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.22
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.57
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.5
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.59
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.42
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=2.2e-20  Score=186.23  Aligned_cols=369  Identities=12%  Similarity=0.038  Sum_probs=251.8

Q ss_pred             HHHhcCChHHHHHHHccCCC--C-CcchHHHHHHHHHcCCChhHHHHHHHHHHHcCCCCCChhhHHHHHHHHhcCCChHH
Q 007530           77 FYSKCGLISGARKVFDEMPQ--R-CIVSWNTIIGSYTTNGREQEAVALFINMLREGKTPYSEFTVSSVLCACAAKRDVFE  153 (600)
Q Consensus        77 ~y~~~g~~~~A~~~~~~~~~--~-~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~p~~~t~~~ll~~~~~~~~~~~  153 (600)
                      .+.+.|++++|.+.|+++.+  | +..+|..+...|.+.|++++|+..|++.++.  .|.+..++..+..++...|++++
T Consensus         8 ~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~--~p~~~~a~~~l~~~~~~~g~~~~   85 (388)
T d1w3ba_           8 REYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--NPLLAEAYSNLGNVYKERGQLQE   85 (388)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHHTCHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHhhhhccccc
Confidence            34445555666555555431  2 3445555555566666666666666665554  23344555555666666666666


Q ss_pred             HHHHHHHHHHhCCCCChhHHHHHHHHHHHcCCHHHHHHHHccC---CCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHc
Q 007530          154 CKQLHVFALKAAMDRNVFVGTALLDVYAKCGLISDASRVFESM---PERNEVTWSSMVAGFVQNELYEEALILFRRAQVL  230 (600)
Q Consensus       154 a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~f~~m---~~~d~~~~~~li~~~~~~g~~~~A~~~~~~m~~~  230 (600)
                      |...+....+.... +..........+...+....+.......   .......+..........+....+...+.+....
T Consensus        86 A~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (388)
T d1w3ba_          86 AIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIET  164 (388)
T ss_dssp             HHHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHH
T ss_pred             cccccccccccccc-cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhcc
Confidence            66666665555432 2233333333333333333332222211   1233444555555566666777777666666544


Q ss_pred             CCCCCHHHHHHHHHHHHccCchHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhhCCHHHHHHHHhcCC---CcCHhHHHH
Q 007530          231 GLEYNQFTISSVICACAGLAALIQGKQVHAVLCKTGFGSNMFAASSLVDMYAKCGCVVDAYFVFSGIE---EKNVVLWNT  307 (600)
Q Consensus       231 g~~p~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~y~~~g~~~~A~~~~~~~~---~~~~~~~~~  307 (600)
                      . +-+...+..+...+...|.++.|...+..+++.. +.+...+..+...|...|++++|...|+...   ..+...|..
T Consensus       165 ~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~  242 (388)
T d1w3ba_         165 Q-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN  242 (388)
T ss_dssp             C-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHH
T ss_pred             C-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHH
Confidence            2 2244555666666777777777777777777654 4456677778888888888888888887654   345677888


Q ss_pred             HHHHHHhcCChHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHHccCCHHHHHHHHHHHHHhcCCCccHHHHHHHHHHHHhc
Q 007530          308 MISGFSRHARSVEVMILFEKMQQAGLHP-NEQTYISVLSACSHIGMVEKGKSYFDLMVKQHNVLPNVFHYSCMIDILGRA  386 (600)
Q Consensus       308 li~~~~~~g~~~~A~~l~~~m~~~g~~p-~~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~  386 (600)
                      +...+.+.|++++|+..|++..+.  .| +..++..+...+...|++++|.+.++......  +.+...+..+...+.+.
T Consensus       243 l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~--~~~~~~~~~l~~~~~~~  318 (388)
T d1w3ba_         243 LACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQ  318 (388)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHTT
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC--CccchhhhHHHHHHHHC
Confidence            888899999999999999998875  44 46778888889999999999999999886543  45677888889999999


Q ss_pred             CCHHHHHHHHHcC-CCCCC-HHHHHHHHHHHHHcCChHHHHHHHHHHhcCCCCCcchHHHHHHHHHhcCC
Q 007530          387 GLIHEAYDLILNM-PFDAT-ASMWGSLLASCRNYRNLELAEIAAKQLFGMEPDNAGNHLLLSNIYAANRR  454 (600)
Q Consensus       387 g~~~~A~~~~~~m-~~~p~-~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  454 (600)
                      |++++|.+.|++. ...|+ ..+|..+...+...|++++|...++++++++|+++..|..|+.+|.+.|+
T Consensus       319 ~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         319 GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999875 45554 67888999999999999999999999999999999999999999988775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure