Citrus Sinensis ID: 007584

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------
MIATEAVITKKKLKIKFGSQRIEAVPGSQPCEYGQQQSHVENWRHSSSVAESNQLMMSKPYRSSGGKKMIASEHSKERSSILPFNKRQAQEVIEGPKDKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCPKTPPLHSTLSSKKSKMSEEKAARSSYCARAVEVERAKPAQNLSSKLVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSATCGCNLPSDSTHASSDITSERSLGGDRACSTDASKPDCQVKSTSTSQMSKSDPDSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDVQMSPKKALRAAMLKSRFADTILKAQQRTLLDHGDKADPVKLQQEKERLEQRQREEKARIEAQIKAAEAASRMKAEIELKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCLSPHLLNGSEAQKRAFKEAHFKNPLERIGLFMKSDYLVEDEDEEILNLDGDGEEGEIFS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccHHHHHHcccccccccccccccccccccccccccccc
cccccHEEcccccccccccccEEcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHccEEccccccccccccccccccccccccEcc
MIATEAVITKKKLKIKFgsqrieavpgsqpceygqqqshvenwrhsssvaesnqlmmskpyrssggkkmiasehskerssilpfnkRQAQEviegpkdkrpkmdrgvtHQCSVILKSlmmhpagwvfnrpvdpvkldipdyfsiiskpmdlgtvktrldrnlysvsdEFVADVRLTFsnamlynppennvHKMAQELNNLFDIKWKSLEEkwssevpkaglgkilsgkmmevndtrqncpktpplhstlsskkskmseEKAARSSYCARAVEverakpaqnlsSKLVIKNLhkgtndggrlacnivnakpplspvackscgkcgsatcgcnlpsdsthassditserslggdracstdaskpdcqvkststsqmsksdpdsdgavsalddgnlcpssqltppatdsasaeewttplldvqmsPKKALRAAMLKSRFADTILKAQQRTLldhgdkadpvKLQQEKERLEQRQREEKARIEAQIKAAEAASRMKAEIELKKQREKEREAARVALQKMERTVEIEHNLEILKELEMlsgcclsphllngsEAQKRAFKEAHFKNPLERIglfmksdylvededeeilnldgdgeegeifs
miateavitkkklkikfgsqriEAVPGSQPCEYGQQQSHVENWRHSSSVAESNQLMMSKPYRSSGGKKMIASEhskerssilpfnkrqaqeviegpkdkrpkmdrgVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSiiskpmdlgtvKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEekwssevpkaglgkilsgKMMEVNDTrqncpktpplhstlsskkskmseeKAARSSYCARAVEverakpaqnlsskLVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSATCGCNLPSDSTHASSDITSERSLGGdracstdaskpdcqvkststsqmsksdpDSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDVQMSPKKALRAAMLKSRFADTILKAQQRTlldhgdkadpvklQQEKERLEQRQREEKARIEAQIKAAEAASRMKAEIELKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCLSPHLLNGSEAQKRAFKEahfknpleriGLFMKSDYLVEDEDEEilnldgdgeegeifs
MIATEAVITKKKLKIKFGSQRIEAVPGSQPCEYGQQQSHVENWRHSSSVAESNQLMMSKPYRSSGGKKMIASEHSKERSSILPFNKRQAQEVIEGPKDKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCPKTPPLHSTLsskkskmseekaarssYCARAVEVERAKPAQNLSSKLVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSATCGCNLPSDSTHASSDITSERSLGGDRACSTDASKPDCQVKSTSTSQMSKSDPDSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDVQMSPKKALRAAMLKSRFADTILKAQQRTLLDHGDKADPVklqqekerleqrqreekARIEAQIKAAEAASRMKAEIELKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCLSPHLLNGSEAQKRAFKEAHFKNPLERIGLFMKSDYLVEDEDEEILNLDGDGEEGEIFS
**********************************************************************************************************VTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVR**********************LNNLFDIKWKSLEEKW*************************************************************************LVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSATCGCN*******************************************************************************************************RFADTIL***************************************************************************RTVEIEHNLEILKELEMLSGCCLSPHLLNG******AFKEAHFKNPLERIGLFM***************************
**************************************************************************************************************CSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKS*******************************************************************************************************************************************************************************************************************************MLKSRFAD************************************************************************************H*LEILKELEMLSGC************************PLERIGLFMKSDYLVE************GEEGEIF*
MIATEAVITKKKLKIKFGSQRIEAVPGSQPCEYGQQQSHVENWRHSSSVAESNQLMMSKP*********************LPFNKRQAQEVIEGPKDKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCPKT*************************ARAVEVERAKPAQNLSSKLVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSATCGCNLPSD**************************************************SALDDGNLCPSSQ************EWTTPLLDVQMSPKKALRAAMLKSRFADTILKAQQRTLLDHGDKADPVKLQQEKERLEQRQREEKARIEAQIKAAEAASRMKAEIEL************VALQKMERTVEIEHNLEILKELEMLSGCCLSPHLLNGSEAQKRAFKEAHFKNPLERIGLFMKSDYLVEDEDEEILNLDGD********
*****************************************************************************************************KMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEE****************************************************************************************************************************************************************************************************************VQMSPKKALRAAMLKSRFADTILKAQQRTLLDHGDKADPVKLQQEKERLEQRQREEKARIEAQIKAAEAASR****************AARVALQKMERTVEIEHNLEILKELEMLSGCCLS************AFKEAHFKNPLERIGLFMKSD********EILNLD**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIATEAVITKKKLKIKFGSQRIEAVPGSQPCEYGQQQSHVENWRHSSSVAESNQLMMSKPYRSSGGKKMIASEHSKERSSILPFNKRQAQEVIEGPKDKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCPKTPPLHSTLSSKKSKMSEEKAARSSYCARAVEVERAKPAQNLSSKLVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSATCGCNLPSDSTHASSDITSERSLGGDRACSTDASKPDCQVKSTSTSQMSKSDPDSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDVQMSPKKALRAAMLKSRFADTILKAQQRTLLDHGDKADPVKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEIEHNLEILKELEMLSGCCLSPHLLNGSEAQKRAFKEAHFKNPLERIGLFMKSDYLVEDEDEEILNLDGDGEEGEIFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query597 2.2.26 [Sep-21-2011]
Q9LS28494 Transcription factor GTE1 yes no 0.649 0.785 0.368 1e-67
Q9LK27813 Transcription factor GTE8 no no 0.757 0.555 0.325 2e-50
Q93YS6688 Transcription factor GTE9 no no 0.118 0.103 0.605 4e-33
Q93ZB7620 Transcription factor GTE1 no no 0.152 0.146 0.567 2e-30
Q9FGW9 1061 Transcription factor GTE1 no no 0.130 0.073 0.523 4e-29
Q9S7T1461 Transcription factor GTE3 no no 0.182 0.236 0.526 6e-28
Q9LNC4766 Transcription factor GTE4 no no 0.216 0.168 0.433 1e-25
Q8H1D7487 Transcription factor GTE5 no no 0.182 0.223 0.464 2e-24
Q7Y214590 Transcription factor GTE7 no no 0.180 0.183 0.495 1e-22
Q9LXA7581 Transcription factor GTE2 no no 0.157 0.161 0.515 1e-20
>sp|Q9LS28|GTE12_ARATH Transcription factor GTE12 OS=Arabidopsis thaliana GN=GTE12 PE=2 SV=2 Back     alignment and function desciption
 Score =  258 bits (658), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 167/453 (36%), Positives = 255/453 (56%), Gaps = 65/453 (14%)

Query: 95  GPKD-------KRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISK 147
           GPK+       K+ ++D   + QC  +L+ LM H  GW+F  PVDPVK++IPDYF++I K
Sbjct: 50  GPKELDEVQPKKKQRLDCDWSSQCLALLRFLMEHRGGWLFKEPVDPVKMEIPDYFNVIQK 109

Query: 148 PMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKS 207
           PMDLGTVK++L +N+YS +DEF ADVRLTF+NAM YNP  N VH +A+E+N +F+++W+S
Sbjct: 110 PMDLGTVKSKLLKNVYSNADEFAADVRLTFANAMHYNPLWNEVHTIAKEINEIFEVRWES 169

Query: 208 LEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCPKTPPLHSTLSSKKSKMSEEKAARSSYC 267
           L +K           K+L    +  N+ R+   K  P+    S + S  +   +      
Sbjct: 170 LMKK-----------KVLR---LSWNEVREGY-KRQPVERDCSRRSSTGTSASSG----- 209

Query: 268 ARAVEVERAKPAQNLSSKLVIKNLHKGTNDGGRLACNIVNAKPPLSPVACKSCGKCGSAT 327
                V   KPA+        +N  KG+     +        P ++P A  +C KCG   
Sbjct: 210 -----VGLTKPAK--------ENSEKGSLSSKPVKVQSKKNTPAVTPKALATC-KCGRII 255

Query: 328 CGCNLPSDSTHASSDITSERSLGGDRACSTDASKPDCQVKSTSTSQMSKSDPDSDGAVSA 387
           C C            + S  S G D  CS      DCQ+K+ S +Q S+ DP S+G+ ++
Sbjct: 256 CIC------------LKSCSSFGSD-VCSLT----DCQLKNISGAQASELDPQSNGSDTS 298

Query: 388 LDDGNLCPSSQLTPPATDSASAEEWTTPLLDV-QMSPKKALRAAMLKSRFADTILKAQQR 446
             + N    SQL  P+       E  T    +  + P+KALRAA+LK+++A TI+KA+ R
Sbjct: 299 KKERNGSLKSQLDKPSNSDLLGNELKTAFPALPPVPPEKALRAAILKAQYAGTIIKAKHR 358

Query: 447 TLLDHGDKADPVKLQQEKERLEQRQREEKARIEAQIKAAEAASRMKAEIELKKQREKERE 506
            +L   +KAD +++Q EKE++E+ QREEKARIEA+++AA+ A RM+A+ ELK++RE +  
Sbjct: 359 IVLGQNNKADLIRIQIEKEQMERAQREEKARIEAEMRAAKVAERMRAQDELKQKRESQ-- 416

Query: 507 AARVALQKMERTVEIEHN--LEILKELEMLSGC 537
             R+ + KM++  + E N   ++ K+   + GC
Sbjct: 417 --RLEIAKMKKGFDFERNNHSKLKKKFVKVCGC 447

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LK27|GTE8_ARATH Transcription factor GTE8 OS=Arabidopsis thaliana GN=GTE8 PE=2 SV=2 Back     alignment and function description
>sp|Q93YS6|GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana GN=GTE9 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 Back     alignment and function description
>sp|Q9FGW9|GTE10_ARATH Transcription factor GTE10 OS=Arabidopsis thaliana GN=GTE10 PE=1 SV=2 Back     alignment and function description
>sp|Q9S7T1|GTE3_ARATH Transcription factor GTE3, chloroplastic OS=Arabidopsis thaliana GN=GTE3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LNC4|GTE4_ARATH Transcription factor GTE4 OS=Arabidopsis thaliana GN=GTE4 PE=2 SV=1 Back     alignment and function description
>sp|Q8H1D7|GTE5_ARATH Transcription factor GTE5, chloroplastic OS=Arabidopsis thaliana GN=GTE5 PE=1 SV=1 Back     alignment and function description
>sp|Q7Y214|GTE7_ARATH Transcription factor GTE7 OS=Arabidopsis thaliana GN=GTE7 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXA7|GTE2_ARATH Transcription factor GTE2 OS=Arabidopsis thaliana GN=GTE2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query597
255557483570 bromodomain-containing protein, putative 0.946 0.991 0.57 1e-173
224061031564 global transcription factor group [Popul 0.934 0.989 0.544 1e-158
224116480567 global transcription factor group [Popul 0.939 0.989 0.565 1e-156
359483574588 PREDICTED: transcription factor GTE9-lik 0.894 0.908 0.488 1e-154
147826573588 hypothetical protein VITISV_007433 [Viti 0.894 0.908 0.488 1e-154
297740594573 unnamed protein product [Vitis vinifera] 0.814 0.848 0.533 1e-150
255580043536 bromodomain-containing protein, putative 0.884 0.985 0.520 1e-146
356557783565 PREDICTED: transcription factor GTE8-lik 0.924 0.976 0.498 1e-139
356549150566 PREDICTED: transcription factor GTE8-lik 0.934 0.985 0.495 1e-137
255565481532 bromodomain-containing protein, putative 0.877 0.984 0.514 1e-131
>gi|255557483|ref|XP_002519772.1| bromodomain-containing protein, putative [Ricinus communis] gi|223541189|gb|EEF42745.1| bromodomain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  616 bits (1588), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 342/600 (57%), Positives = 418/600 (69%), Gaps = 35/600 (5%)

Query: 1   MIATEAVITKKKLKIKFGSQRIEAVPGSQPCEYGQQQSHVENWRHSSSVAESNQLMMSKP 60
           MI+TE V+ KK LKIKF S +I+ +     C+  +   +VE   HS              
Sbjct: 1   MISTEPVVAKK-LKIKFSSHKIDTISVKNACDMAR---NVEKNYHS-------------- 42

Query: 61  YRSSGGKKMIASEHSKERSSILPFNKRQAQEVIEGPKDKRPKMDRGVTHQCSVILKSLMM 120
                  ++   E+ K++ +     KR   +++EG + K+ KMDRGV HQC+ ++KSLM 
Sbjct: 43  -------QVCDIENMKQKLTECSAIKRGPSDMVEGQQQKKRKMDRGVIHQCTSLVKSLMN 95

Query: 121 HPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNA 180
           HP GWVF  PVDP KL+IPDYFS+I+ PMDLGTVK++L+ N Y  ++EF ADVRLTFSNA
Sbjct: 96  HPCGWVFKEPVDPEKLEIPDYFSVITNPMDLGTVKSKLENNQYFGAEEFAADVRLTFSNA 155

Query: 181 MLYNPPENNVHKMAQELNNLFDIKWKSLEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCP 240
           +LYNPP N VHKMA++L  +F+ +WK+LEEKW+ ++ K G GK  + +  EV DTRQ CP
Sbjct: 156 LLYNPPLNYVHKMAEKLKKIFETRWKALEEKWNYQIAKDGDGKPFNARPKEVGDTRQKCP 215

Query: 241 KTPPLHSTLSSKKSKMSEEKAARSSYCARAVEVERAKPAQNLSSKLVIKNLHKGTNDGGR 300
           +TPPLH     K+SK SE K  R S   RA EV+ +KPA+N +S+ + +N +KGT++GGR
Sbjct: 216 QTPPLHKAELPKRSKPSEVKLLRGSSNVRAAEVKLSKPAENCNSEELRQNSYKGTDNGGR 275

Query: 301 LACNIVNAKPPLSPVACKSCGKCGSATCGCNLPSDSTHASSDITSERSLGGDR-ACSTDA 359
            AC  VN KP    V  K CG CG + C C LPSDS  ASSDI+SE+S G D  ACSTD 
Sbjct: 276 NACGSVNVKPSSVSVVSK-CGTCGRSACQCILPSDSAQASSDISSEKSWGKDHHACSTDT 334

Query: 360 SKPDCQVKSTSTSQMSKSDPDSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDV 419
           SK D Q K  S  QMSKSDPDSDGAVSALD+ N+CPSSQL  PATD+ S E W  P+ DV
Sbjct: 335 SKMDVQGKCMSMLQMSKSDPDSDGAVSALDEENICPSSQLMTPATDANSVEGWRPPIFDV 394

Query: 420 QMSPKKALRAAMLKSRFADTILKAQQRTLLDHGDKADPVKLQQEKERLEQRQREEKARIE 479
           Q+SP KALRAAMLK RFADTILKAQ +TLLDHGDKADPVKLQ+EKERLE+RQ EEKARIE
Sbjct: 395 QLSPTKALRAAMLKRRFADTILKAQHKTLLDHGDKADPVKLQEEKERLEKRQLEEKARIE 454

Query: 480 AQIKAAEAASRMKAEIELKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCL 539
           AQI+AAEAASR + EIEL+KQREKEREAARVALQKME+T EIE NLEI+KELE LSGC L
Sbjct: 455 AQIRAAEAASRKREEIELRKQREKEREAARVALQKMEKTAEIEQNLEIVKELEKLSGCSL 514

Query: 540 SPHL---LNGSEAQKRAFKEAHFKNPLERIGLFMKSDYLVEDEDEEILNLDGDGEEGEIF 596
           S        G E  +     AH  + LER+GL MK D +   +D+EIL   GD EEGEIF
Sbjct: 515 SYSYSFGRRGPEIAEGDVGGAHSCSLLERLGLIMKDDTV---DDDEILI--GDEEEGEIF 569

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224061031|ref|XP_002300324.1| global transcription factor group [Populus trichocarpa] gi|222847582|gb|EEE85129.1| global transcription factor group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116480|ref|XP_002317311.1| global transcription factor group [Populus trichocarpa] gi|222860376|gb|EEE97923.1| global transcription factor group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483574|ref|XP_002269681.2| PREDICTED: transcription factor GTE9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826573|emb|CAN72911.1| hypothetical protein VITISV_007433 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740594|emb|CBI30776.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255580043|ref|XP_002530855.1| bromodomain-containing protein, putative [Ricinus communis] gi|223529579|gb|EEF31529.1| bromodomain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356557783|ref|XP_003547190.1| PREDICTED: transcription factor GTE8-like [Glycine max] Back     alignment and taxonomy information
>gi|356549150|ref|XP_003542960.1| PREDICTED: transcription factor GTE8-like [Glycine max] Back     alignment and taxonomy information
>gi|255565481|ref|XP_002523731.1| bromodomain-containing protein, putative [Ricinus communis] gi|223537035|gb|EEF38671.1| bromodomain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query597
TAIR|locus:2142305494 AT5G46550 "AT5G46550" [Arabido 0.222 0.269 0.517 1.2e-58
TAIR|locus:2086498 813 GTE8 "AT3G27260" [Arabidopsis 0.217 0.159 0.474 9.5e-52
TAIR|locus:2082289620 BET10 "AT3G01770" [Arabidopsis 0.174 0.167 0.567 1.6e-50
TAIR|locus:2158564 1061 NPX1 "nuclear protein X1" [Ara 0.175 0.098 0.523 1.1e-49
TAIR|locus:2032692461 GTE3 "AT1G73150" [Arabidopsis 0.192 0.249 0.508 2.5e-25
TAIR|locus:2038565766 GTE4 "AT1G06230" [Arabidopsis 0.276 0.215 0.393 1.9e-21
TAIR|locus:2030958487 AT1G17790 "AT1G17790" [Arabido 0.201 0.246 0.439 2.3e-21
TAIR|locus:2155715590 GTE7 "AT5G65630" [Arabidopsis 0.257 0.261 0.393 3.7e-20
UNIPROTKB|C9J1F7155 BRDT "Bromodomain testis-speci 0.189 0.729 0.398 2.4e-18
UNIPROTKB|C9JD82176 BRDT "Bromodomain testis-speci 0.189 0.642 0.398 2.4e-18
TAIR|locus:2142305 AT5G46550 "AT5G46550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 369 (135.0 bits), Expect = 1.2e-58, Sum P(2) = 1.2e-58
 Identities = 73/141 (51%), Positives = 103/141 (73%)

Query:    71 ASEHSKERSSILPFNKRQAQEVIEGPKDKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRP 130
             +SE SK+R    P   ++  EV   PK K+ ++D   + QC  +L+ LM H  GW+F  P
Sbjct:    41 SSEKSKKRGG--P---KELDEV--QPK-KKQRLDCDWSSQCLALLRFLMEHRGGWLFKEP 92

Query:   131 VDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNV 190
             VDPVK++IPDYF++I KPMDLGTVK++L +N+YS +DEF ADVRLTF+NAM YNP  N V
Sbjct:    93 VDPVKMEIPDYFNVIQKPMDLGTVKSKLLKNVYSNADEFAADVRLTFANAMHYNPLWNEV 152

Query:   191 HKMAQELNNLFDIKWKSLEEK 211
             H +A+E+N +F+++W+SL +K
Sbjct:   153 HTIAKEINEIFEVRWESLMKK 173
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2086498 GTE8 "AT3G27260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082289 BET10 "AT3G01770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158564 NPX1 "nuclear protein X1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032692 GTE3 "AT1G73150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038565 GTE4 "AT1G06230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030958 AT1G17790 "AT1G17790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155715 GTE7 "AT5G65630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9J1F7 BRDT "Bromodomain testis-specific protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JD82 BRDT "Bromodomain testis-specific protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query597
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 6e-52
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 2e-34
cd0436999 cd04369, Bromodomain, Bromodomain 8e-29
smart00297107 smart00297, BROMO, bromo domain 4e-28
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 6e-28
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 8e-27
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 5e-26
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-23
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 2e-23
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-22
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 4e-22
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 8e-18
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 8e-18
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 2e-16
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 1e-14
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-13
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 2e-13
COG5076371 COG5076, COG5076, Transcription factor involved in 6e-13
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 7e-13
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 3e-12
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 3e-12
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 2e-11
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 5e-11
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 6e-11
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 4e-10
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 4e-10
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 8e-10
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 1e-09
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 2e-09
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 8e-09
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 3e-07
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 5e-07
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 7e-07
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 6e-05
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 7e-05
PLN02316 1036 PLN02316, PLN02316, synthase/transferase 3e-04
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 0.003
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 0.003
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information 
 Score =  172 bits (439), Expect = 6e-52
 Identities = 60/99 (60%), Positives = 73/99 (73%)

Query: 107 VTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVS 166
           V  QC  +L+ LM H  GWVFN PVD V L +PDYF II KPMDLGTVK +L++  YS  
Sbjct: 1   VMKQCGTLLRKLMKHKWGWVFNAPVDVVALGLPDYFDIIKKPMDLGTVKKKLEKGEYSSP 60

Query: 167 DEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKW 205
           +EF ADVRLTF+NAM YNPP N+VH MA+EL  +F+ +W
Sbjct: 61  EEFAADVRLTFANAMRYNPPGNDVHTMAKELLKIFETRW 99

Might function as a global transcription factor. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 99
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|215180 PLN02316, PLN02316, synthase/transferase Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 597
KOG1474640 consensus Transcription initiation factor TFIID, s 99.97
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.94
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.94
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.94
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.93
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.93
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.93
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.92
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.92
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.92
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.92
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.92
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.92
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.92
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.92
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.92
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.92
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.91
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.9
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.9
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.9
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.9
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.88
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.88
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.88
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.88
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.87
smart00297107 BROMO bromo domain. 99.87
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.87
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.87
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.87
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.84
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.84
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.84
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.84
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.83
COG5076371 Transcription factor involved in chromatin remodel 99.74
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.73
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.69
KOG00081563 consensus Transcription initiation factor TFIID, s 99.56
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.45
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.28
KOG00081563 consensus Transcription initiation factor TFIID, s 99.27
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.01
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.94
KOG09551051 consensus PHD finger protein BR140/LIN-49 [General 98.93
KOG1827629 consensus Chromatin remodeling complex RSC, subuni 98.86
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.54
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 98.48
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 97.97
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 97.86
COG5076371 Transcription factor involved in chromatin remodel 97.79
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.17
PTZ00266 1021 NIMA-related protein kinase; Provisional 96.9
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.93
PTZ00266 1021 NIMA-related protein kinase; Provisional 95.62
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 95.57
PLN03086 567 PRLI-interacting factor K; Provisional 95.46
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 92.93
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 90.87
KOG3054299 consensus Uncharacterized conserved protein [Funct 89.19
KOG06441113 consensus Uncharacterized conserved protein, conta 89.1
PTZ00121 2084 MAEBL; Provisional 88.49
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 87.03
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 87.01
KOG2072 988 consensus Translation initiation factor 3, subunit 86.66
KOG07321080 consensus AAA+-type ATPase containing the bromodom 86.45
PTZ00121 2084 MAEBL; Provisional 85.94
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.44
KOG2891445 consensus Surface glycoprotein [General function p 84.69
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 83.93
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 82.39
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 82.38
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 82.28
PF05672171 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 81.43
KOG3054299 consensus Uncharacterized conserved protein [Funct 81.02
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 80.96
PRK06569155 F0F1 ATP synthase subunit B'; Validated 80.59
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 80.45
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information 
Probab=99.97  E-value=1.9e-30  Score=292.89  Aligned_cols=396  Identities=23%  Similarity=0.275  Sum_probs=228.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHcCCCCCCCCCCCCCCcCCCcchhhcCCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHH
Q 007584          100 RPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSN  179 (597)
Q Consensus       100 r~km~~~~~k~c~~IL~~L~~~~~s~pF~~PVdp~k~~vPDYy~IIk~PMDL~TIkkKL~~~~Y~S~~EF~~DV~LIF~N  179 (597)
                      ..++...++++|..||..|+.|+++|||..|||+..+++||||+||++||||+||++||.++.|.++.+|..||+|||.|
T Consensus       216 ~~~~~~~~lk~C~~iLk~l~~~k~awpF~~PVD~v~LgLpDY~~IIK~PMDLgTIK~kL~~~~Y~~~~eF~~DVRL~F~N  295 (640)
T KOG1474|consen  216 KSKLTVELLKQCLSILKRLMKHKHAWPFNEPVDVVKLGLPDYHDIIKHPMDLGTIKKKLEKGEYKSAEEFAADVRLTFDN  295 (640)
T ss_pred             cccccHHHHHHHHHHHHHHHhccCCCCcCCCcCHHhcCCcchhhhcCCCccHHHHHhhhcccccCCHHHHHHHHHHHHHH
Confidence            44567788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhCCCCCHHHHHHHHHHHHHHHHHHHhHHhhhccCCcCCccccccCcccccccccCCCCCCCCCCCCCCCCcccchhh
Q 007584          180 AMLYNPPENNVHKMAQELNNLFDIKWKSLEEKWSSEVPKAGLGKILSGKMMEVNDTRQNCPKTPPLHSTLSSKKSKMSEE  259 (597)
Q Consensus       180 A~~YN~~~S~I~~~A~~Lek~Fek~~k~i~~k~~~~~~~~~~~~~~s~~~~ei~~~~~~~~k~~P~~~~v~~K~~~~~~~  259 (597)
                      |++||+++++||.||..|+.+|+.+|..++..+............... ..........    .+.......+....+. 
T Consensus       296 cm~YNp~g~dV~~Ma~~L~~~Fe~rw~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~----~~~~~~~~~~~~~~~~-  369 (640)
T KOG1474|consen  296 CMTYNPEGSDVYAMAKKLQEVFEERWASMPLEIEESESAVKEEAGMAS-SDQIPSNSVE----GPRSSSFESRESASEP-  369 (640)
T ss_pred             HHhcCCCCCHHHHHHHHHHHHHHHHHhhcccccccccccccccccccc-cccccccccc----CcccccchhcccccCc-
Confidence            999999999999999999999999999988765433222110000000 0000000000    0000000000000000 


Q ss_pred             hhhccccchhHHHhhhccccccc---chHHHHHhh----cCCCCCCCcccccccCCCCC--CCccccccCCCCCCCCCCC
Q 007584          260 KAARSSYCARAVEVERAKPAQNL---SSKLVIKNL----HKGTNDGGRLACNIVNAKPP--LSPVACKSCGKCGSATCGC  330 (597)
Q Consensus       260 k~l~~~~d~~~~~~~lsk~le~l---~~~~~~~~~----~k~~~~~~~~~~~~~n~~p~--~~~~~~~~~~~~~~~~~~~  330 (597)
                        ....+. +......-..++.+   ....+...+    .+..........+.+....+  .+...  .+   ....-..
T Consensus       370 --~~~~~~-~~e~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~  441 (640)
T KOG1474|consen  370 --SSELMS-EEERKKLLAELKLLLKDVPPQLIALLQRPVSKPPRKIEEELESDKRPLVTGKLIKEK--NK---KEKAANE  441 (640)
T ss_pred             --cccccc-HHhhhhhHhhhhcchhhhhHHHHhhhhccccCccccccccccccccccchhhhhhhh--hc---ccccccc
Confidence              000010 01011111111111   111122221    11111111111111100000  00000  00   0000000


Q ss_pred             CCCCCCCCCCCCCcccccCCCCCCCCCCCCCCccccccccCCCCCCCCC-CCCCcccccccCCCCCCCCCCCCCCCCCcc
Q 007584          331 NLPSDSTHASSDITSERSLGGDRACSTDASKPDCQVKSTSTSQMSKSDP-DSDGAVSALDDGNLCPSSQLTPPATDSASA  409 (597)
Q Consensus       331 ~~~~~s~~~~s~~s~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~s~~~~-~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~  409 (597)
                      +.-.-+....   ..-..-..+.    -+  ++   +..+..+..  .+ ...+.+   . .+.+.. +..     ....
T Consensus       442 ~~r~~t~~~~---~~l~~~~~~~----~~--p~---~l~~~~~~~--~~~~~~~~l---~-~~~~~~-~~~-----~~~v  497 (640)
T KOG1474|consen  442 NKRDMTAPEK---AKLKELLQNL----LP--PN---KLESIVEIL--KPEKRQLDL---S-QNDDEI-ELD-----LDSV  497 (640)
T ss_pred             cccccccccc---ccchhhccCC----CC--Cc---cccCccccc--chhhhcccc---c-ccccch-hhc-----cccc
Confidence            0000000000   0000000000    00  00   000000000  00 000000   0 000000 000     0111


Q ss_pred             cccCCC-CccCCCChHHHHHHHHHhhhhhHHHHhhhh-hhhcccCCCCChhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007584          410 EEWTTP-LLDVQMSPKKALRAAMLKSRFADTILKAQQ-RTLLDHGDKADPVKLQQEKERLEQRQREEKARIEAQIKAAEA  487 (597)
Q Consensus       410 e~~~~~-~~~~~~sp~K~~RAA~lk~rfadtIlKA~~-k~ll~~g~k~dp~~~~~e~~~~e~~~~ee~ar~~a~~~a~e~  487 (597)
                      ++|... ....++..++.+++..+..+|++-+.+++. +.+.......+|+++.+..++.+.++..++++.++.-...+.
T Consensus       498 d~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~  577 (640)
T KOG1474|consen  498 DGSQSREPSSNPLEIETIRETLKLSTERELELSKASSSRSLMRNRSGSLPERLSRSISEEKLREKSEKSSSEASSSSSED  577 (640)
T ss_pred             ccccccCCCcccchhhhhhccccchhhHHHHHHHHhhhhhhccCcccccccchhhhhhHHhhhhhhHhhhhhhhhhhHHH
Confidence            111111 125578899999999999999999999999 776666777799999999999999999999999999999999


Q ss_pred             HHHHHHHHHH--HHHHHHHHHHHHHHHHHhhhhhhhhhhHHHHHHHHH
Q 007584          488 ASRMKAEIEL--KKQREKEREAARVALQKMERTVEIEHNLEILKELEM  533 (597)
Q Consensus       488 ~~~~~~~~~~--~~~r~~~~e~~r~~~~~~~~t~~~~~~~~~~~dle~  533 (597)
                      +++.++....  .+.+..+++.++.++..|..++++..+..+..+++.
T Consensus       578 ~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~s~~~~~~s~~~~~~~~  625 (640)
T KOG1474|consen  578 GENKAASSGSLSPSSSSLERESNNSAEANGSSSSESSSSSSSSSSEEG  625 (640)
T ss_pred             HhhccccccccCccccccccchhHHHHhcccCccccccccccchhhcc
Confidence            9888776554  455678899999999999999999999998888777

>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>PF05672 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 The organisation of microtubules varies with the cell type and is presumably controlled by tissue-specific microtubule-associated proteins (MAPs) Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query597
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 1e-18
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-18
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 2e-18
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 2e-18
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 3e-18
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 3e-18
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 3e-18
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 9e-18
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 1e-17
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 2e-17
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 3e-17
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 3e-17
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 5e-17
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 6e-17
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 7e-17
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 8e-17
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 8e-17
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 1e-16
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 4e-16
2e7n_A117 Solution Structure Of The Second Bromodomain From H 4e-16
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 5e-16
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 2e-15
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 3e-15
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 1e-14
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-14
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 3e-14
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 3e-14
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 3e-14
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 3e-14
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 3e-14
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 4e-14
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 8e-14
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 1e-13
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 4e-13
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 4e-13
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-13
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 5e-12
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 7e-12
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 1e-11
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-11
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 2e-11
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 8e-11
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 2e-10
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 2e-10
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 2e-10
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 3e-10
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 3e-10
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-10
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 5e-10
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 2e-09
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 4e-08
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 6e-08
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 9e-08
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 2e-07
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 5e-07
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 7e-07
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 7e-07
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 8e-07
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 1e-06
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 1e-06
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 2e-06
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 2e-06
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 2e-06
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 4e-06
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 1e-05
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 1e-05
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 2e-05
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 4e-05
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 4e-05
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 5e-05
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 4e-04
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure 
Iteration: 1

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 4/110 (3%)
Query: 96  PKDKRPKMDRGVTHQCS----VILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDL 151
           P+   P   +  T+Q      V+LK+L  H   W F +PVD VKL++PDY+ II  PMD+
Sbjct: 27  PETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDM 86
Query: 152 GTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLF 201
           GT+K RL+ N Y  + E + D    F+N  +YN P +++  MA+ L  LF
Sbjct: 87  GTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLF 136
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query597
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 5e-48
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 3e-47
4alg_A154 Bromodomain-containing protein 2; signaling protei 4e-47
3p1f_A119 CREB-binding protein; structural genomics consorti 2e-46
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 3e-46
3fkm_X166 Signaling protein; bromodomain, malaria, structura 2e-45
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 2e-44
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 1e-43
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-41
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 2e-41
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 3e-41
3d7c_A112 General control of amino acid synthesis protein 5; 1e-39
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-39
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 4e-38
2d9e_A121 Peregrin; four-helix bundle, transcription activat 5e-38
3nxb_A116 CAT eye syndrome critical region protein 2; struct 6e-38
3uv4_A158 Second bromodomain of human transcription initiat 2e-37
3rcw_A135 Bromodomain-containing protein 1; transcription, s 1e-36
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 3e-36
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 3e-35
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 1e-28
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-34
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-33
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-27
3dai_A130 ATPase family AAA domain-containing protein 2; anc 2e-33
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 3e-33
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 2e-32
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-31
2grc_A129 Probable global transcription activator SNF2L4; br 9e-31
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-30
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-30
2dat_A123 Possible global transcription activator SNF2L2; br 1e-29
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-28
2r0y_A311 Chromatin structure-remodeling complex protein RSC 4e-27
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-20
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 9e-26
2r10_A361 Chromatin structure-remodeling complex protein RSC 2e-25
2r10_A361 Chromatin structure-remodeling complex protein RSC 2e-17
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 6e-23
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-18
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-16
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-11
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 5e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 7e-04
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
 Score =  162 bits (413), Expect = 5e-48
 Identities = 43/116 (37%), Positives = 65/116 (56%)

Query: 96  PKDKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVK 155
             +K  +    + +   V+LK+L  H   W F +PVD VKL++PDY+ II  PMD+GT+K
Sbjct: 11  NPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIK 70

Query: 156 TRLDRNLYSVSDEFVADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEEK 211
            RL+ N Y  + E + D    F+N  +YN P +++  MA+ L  LF  K   L  +
Sbjct: 71  KRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE 126
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query597
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.95
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.95
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.95
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.95
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.94
3d7c_A112 General control of amino acid synthesis protein 5; 99.94
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.94
3p1f_A119 CREB-binding protein; structural genomics consorti 99.94
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.94
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.94
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.94
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.94
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.93
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.93
2dat_A123 Possible global transcription activator SNF2L2; br 99.93
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.93
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.93
2grc_A129 Probable global transcription activator SNF2L4; br 99.93
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.93
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.93
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.92
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.92
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.92
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.92
3uv4_A158 Second bromodomain of human transcription initiat 99.92
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.91
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.9
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.89
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.89
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.88
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.87
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.87
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.86
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.86
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.83
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.83
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.72
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.43
3fkm_X166 Signaling protein; bromodomain, malaria, structura 80.38
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
Probab=99.95  E-value=6.8e-28  Score=216.54  Aligned_cols=111  Identities=29%  Similarity=0.569  Sum_probs=103.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHcCCCCCCCCCCCCCCcCCCcchhhcCCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHH
Q 007584           98 DKRPKMDRGVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTF  177 (597)
Q Consensus        98 ~kr~km~~~~~k~c~~IL~~L~~~~~s~pF~~PVdp~k~~vPDYy~IIk~PMDL~TIkkKL~~~~Y~S~~EF~~DV~LIF  177 (597)
                      +++.+.+...+..|..||..|+.|+.+|+|..||++.  .+||||++|++||||+||++||.+|.|.++++|..||+|||
T Consensus         5 ~k~~~~~~~~~~~c~~il~~l~~~~~s~~F~~pv~~~--~~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~~f~~D~~li~   82 (117)
T 3g0l_A            5 KKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLK--LVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVF   82 (117)
T ss_dssp             CCCCCCCTTHHHHHHHHHHHHHTSTTCGGGSSCCCTT--TSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHH
T ss_pred             cCCCcCCHHHHHHHHHHHHHHHhCCCchhhcCcCChh--hcCChHHHcCCCCCHHHHHHHHhCCCCCCHHHHHHHHHHHH
Confidence            3344556678899999999999999999999999987  69999999999999999999999999999999999999999


Q ss_pred             HHHhhhCCCCCHHHHHHHHHHHHHHHHHHHhHH
Q 007584          178 SNAMLYNPPENNVHKMAQELNNLFDIKWKSLEE  210 (597)
Q Consensus       178 ~NA~~YN~~~S~I~~~A~~Lek~Fek~~k~i~~  210 (597)
                      .||++||+++|.++.+|..|+++|++.|+++..
T Consensus        83 ~Na~~yN~~~s~~~~~A~~L~~~f~~~~~~~~~  115 (117)
T 3g0l_A           83 DNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFK  115 (117)
T ss_dssp             HHHHHHSCSSSHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHc
Confidence            999999999999999999999999999998753
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 597
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 2e-29
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 1e-27
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 2e-27
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-27
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-25
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 3e-25
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: CREB-binding protein, CBP
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  110 bits (276), Expect = 2e-29
 Identities = 38/102 (37%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 111 CSVILKSLM-MHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEF 169
               L++L    P    F +PVDP  L IPDYF I+  PMDL T+K +LD   Y    ++
Sbjct: 11  LMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQY 70

Query: 170 VADVRLTFSNAMLYNPPENNVHKMAQELNNLFDIKWKSLEEK 211
           V DV L F+NA LYN   + V+K   +L  +F+ +   + + 
Sbjct: 71  VDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQS 112
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query597
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.93
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.93
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.93
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.93
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.92
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 83.23
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=9.5e-27  Score=202.71  Aligned_cols=100  Identities=32%  Similarity=0.608  Sum_probs=96.0

Q ss_pred             HHHHHHHHHHHHHHcCCCCCCCCCCCCCCcCCCcchhhcCCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCC
Q 007584          106 GVTHQCSVILKSLMMHPAGWVFNRPVDPVKLDIPDYFSIISKPMDLGTVKTRLDRNLYSVSDEFVADVRLTFSNAMLYNP  185 (597)
Q Consensus       106 ~~~k~c~~IL~~L~~~~~s~pF~~PVdp~k~~vPDYy~IIk~PMDL~TIkkKL~~~~Y~S~~EF~~DV~LIF~NA~~YN~  185 (597)
                      ++...|..||..|..|+.++||..||++.  .+||||++|++||||+||++||.+|.|.++.+|.+||+|||.||+.||+
T Consensus         2 ~L~~~l~~il~~l~~~~~s~~F~~pv~~~--~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~   79 (102)
T d3d7ca1           2 QLYTTLKNLLAQIKSHPSAWPFMEPVKKS--EAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNP   79 (102)
T ss_dssp             HHHHHHHHHHHHHHHSGGGGGGSSCCCTT--TSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSC
T ss_pred             hHHHHHHHHHHHHHhCCCCCccCCCCChh--hCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCC
Confidence            46789999999999999999999999975  7999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHH
Q 007584          186 PENNVHKMAQELNNLFDIKWKS  207 (597)
Q Consensus       186 ~~S~I~~~A~~Lek~Fek~~k~  207 (597)
                      ++|.++.+|..|+++|++.|++
T Consensus        80 ~~s~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          80 PDSEYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             TTSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHhc
Confidence            9999999999999999998864
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure