Citrus Sinensis ID: 007648

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTGA
cccccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHcccccccccHHHHHHHHccccc
ccccHHccccHccHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcHHHHccccHHHHHHHccHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEEEEEccccccccEEEEEEEEEEccccc
maiskelypseddlLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVknlpithpeyetLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRalcalpvtqhDRIWEIYLRFVeqegipietSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVlnddqfysikgktKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKmakpdlsveeeeddeehgsaededirlDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLlrqnphnveQWHRRVKifegnptkqiltyteavrtvdpmkavgkpHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRvaadgnepvqMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLhvpftfsglcmFTFFFTVSCCTGA
maiskelypseddLLYEEELLRNPFSLKLWWRYLVAKreapfkkrFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLrfveqegipietsLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLAsvlnddqfysiKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEeeeddeehgsaededirlDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRrvkifegnptkqiLTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRrataepsvevrrrvaadgnepvqmklhkslRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTGA
MAISKelypseddllyeeellRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVeeeeddeehgsaededIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTGA
*************LLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMV****************************RLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMR*********************VQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCT**
****KELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTG*
MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAK******************DEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTGA
*AISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSV************EDEDIRLDVNLSMAEFV**VLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTGA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTLLHVFLLHVPFTFSGLCMFTFFFTVSCCTGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query594 2.2.26 [Sep-21-2011]
Q9HCS7 855 Pre-mRNA-splicing factor yes no 0.845 0.587 0.536 1e-165
Q9DCD2 855 Pre-mRNA-splicing factor yes no 0.845 0.587 0.536 1e-165
Q99PK0 855 Pre-mRNA-splicing factor yes no 0.845 0.587 0.536 1e-165
Q54Z08 850 Pre-mRNA-splicing factor yes no 0.861 0.602 0.444 1e-144
Q7SAK5 829 Pre-mRNA-splicing factor N/A no 0.861 0.617 0.452 1e-131
Q4WVF4 839 Pre-mRNA-splicing factor yes no 0.867 0.613 0.446 1e-130
Q52DF3 832 Pre-mRNA-splicing factor N/A no 0.863 0.616 0.444 1e-130
Q5BH69 851 Pre-mRNA-splicing factor yes no 0.868 0.606 0.432 1e-128
Q9P7R9 790 Pre-mRNA-splicing factor yes no 0.850 0.639 0.419 1e-123
Q6CAR6 736 Pre-mRNA-splicing factor yes no 0.818 0.660 0.349 3e-86
>sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens GN=XAB2 PE=1 SV=2 Back     alignment and function desciption
 Score =  582 bits (1501), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/541 (53%), Positives = 382/541 (70%), Gaps = 39/541 (7%)

Query: 20  LLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPI 79
           ++RN FS+K W RY+  K+ AP  +   +YERALK LP SYKLW+ YL  R + VK+  +
Sbjct: 28  IMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCV 87

Query: 80  THPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDR 139
           T P YE +NN  ERA V MHKMPR+W+ Y + L  Q  +T  RRTFDRAL ALP+TQH R
Sbjct: 88  TDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSR 147

Query: 140 IWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLND 199
           IW +YLRF+    +P ET++R YRR+LK  P   E++IE+L  S    EAA+RLA+V+ND
Sbjct: 148 IWPLYLRFLRSHPLP-ETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVND 206

Query: 200 DQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYY 259
           ++F S  GK+ ++LW ELCDL++ +  ++  LNVDAIIRGG+ +FTD++G+LW SLADYY
Sbjct: 207 ERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQLGKLWCSLADYY 266

Query: 260 IRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEE 319
           IR   FEKARD++EE + TV+TVRDF+ +FDSY+QFEE M++AKM          E   E
Sbjct: 267 IRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYAQFEESMIAAKM----------ETASE 316

Query: 320 HGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLR 379
            G  E++D+                         D++LRLAR E L++RRP L NSVLLR
Sbjct: 317 LGREEEDDV-------------------------DLELRLARFEQLISRRPLLLNSVLLR 351

Query: 380 QNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDI 439
           QNPH+V +WH+RV + +G P + I TYTEAV+TVDP KA GKPHTLWVAFAK YE    +
Sbjct: 352 QNPHHVHEWHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQL 411

Query: 440 ANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRV 499
            +ARVI +KA +VN+K VD LAS+WC+  E+ELRH+N+  AL L+R+ATA P+   RR  
Sbjct: 412 DDARVILEKATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPA---RRAE 468

Query: 500 AADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLL 559
             DG+EPVQ +++KSL++W+   DLEESLG  +ST+AVY+RILDLRIATPQI+INYA+ L
Sbjct: 469 YFDGSEPVQNRVYKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFL 528

Query: 560 E 560
           E
Sbjct: 529 E 529
Involved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
Homo sapiens (taxid: 9606)
>sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=2 SV=1 Back     alignment and function description
>sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 Back     alignment and function description
>sp|Q54Z08|SYF1_DICDI Pre-mRNA-splicing factor SYF1 OS=Dictyostelium discoideum GN=xab2 PE=3 SV=1 Back     alignment and function description
>sp|Q7SAK5|SYF1_NEUCR Pre-mRNA-splicing factor syf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=syf-1 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVF4|SYF1_ASPFU Pre-mRNA-splicing factor syf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf1 PE=3 SV=1 Back     alignment and function description
>sp|Q52DF3|SYF1_MAGO7 Pre-mRNA-splicing factor SYF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF1 PE=3 SV=2 Back     alignment and function description
>sp|Q5BH69|SYF1_EMENI Pre-mRNA-splicing factor syf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf1 PE=3 SV=1 Back     alignment and function description
>sp|Q9P7R9|SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf3 PE=1 SV=1 Back     alignment and function description
>sp|Q6CAR6|SYF1_YARLI Pre-mRNA-splicing factor SYF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SYF1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
255560840 916 XPA-binding protein, putative [Ricinus c 0.937 0.608 0.858 0.0
449433880 912 PREDICTED: pre-mRNA-splicing factor SYF1 0.941 0.612 0.856 0.0
224076810 908 predicted protein [Populus trichocarpa] 0.937 0.613 0.846 0.0
147766668 920 hypothetical protein VITISV_003952 [Viti 0.941 0.607 0.848 0.0
356555040 918 PREDICTED: pre-mRNA-splicing factor SYF1 0.942 0.610 0.831 0.0
356549407 919 PREDICTED: pre-mRNA-splicing factor SYF1 0.942 0.609 0.829 0.0
297808885 928 hypothetical protein ARALYDRAFT_489660 [ 0.942 0.603 0.826 0.0
15241911 917 pre-mRNA-splicing factor SYF1 [Arabidops 0.942 0.610 0.825 0.0
357446341 925 Pre-mRNA-splicing factor SYF1 [Medicago 0.941 0.604 0.796 0.0
359496732 816 PREDICTED: pre-mRNA-splicing factor syf1 0.907 0.660 0.808 0.0
>gi|255560840|ref|XP_002521433.1| XPA-binding protein, putative [Ricinus communis] gi|223539332|gb|EEF40923.1| XPA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/560 (85%), Positives = 519/560 (92%), Gaps = 3/560 (0%)

Query: 1   MAISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSY 60
           M+I +ELYPS+DDLLYEEELLRNPFSLKLWWRYLVA+RE+PFKKRF+IYERALKALPGSY
Sbjct: 1   MSIPRELYPSQDDLLYEEELLRNPFSLKLWWRYLVARRESPFKKRFIIYERALKALPGSY 60

Query: 61  KLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITK 120
           KLWHAYL ERL IV+NLP+TH +YETLNNTFERALVTMHKMPRIWIMYL+ LT+QK IT+
Sbjct: 61  KLWHAYLTERLEIVRNLPVTHSQYETLNNTFERALVTMHKMPRIWIMYLQILTNQKLITR 120

Query: 121 ARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFL 180
            R+ FDRALCALPVTQHDRIWE+YLRFV QEGIPIETSLRVYRRYLKYDPSHIEDFIEFL
Sbjct: 121 TRKNFDRALCALPVTQHDRIWELYLRFVSQEGIPIETSLRVYRRYLKYDPSHIEDFIEFL 180

Query: 181 VKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGG 240
           V S LWQEAAERLASVLNDDQFYSIKGKTKH LWLELCDLLT HA E+SGLNVDAIIRGG
Sbjct: 181 VNSHLWQEAAERLASVLNDDQFYSIKGKTKHSLWLELCDLLTRHAKEVSGLNVDAIIRGG 240

Query: 241 IRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMV 300
           IRKFTDEVGRLWTSLADYYIRR LFEKARDIFEEGM TVVTVRDFSVIFD+YSQFEE MV
Sbjct: 241 IRKFTDEVGRLWTSLADYYIRRGLFEKARDIFEEGMTTVVTVRDFSVIFDAYSQFEESMV 300

Query: 301 SAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLA 360
           + KM   DLS +E E  EE G  +DED+RL+VN   ++F KK+LNGFWLH+  DVDL LA
Sbjct: 301 AHKMESLDLSDDEGEALEESGDEKDEDVRLEVN---SKFEKKMLNGFWLHEDNDVDLMLA 357

Query: 361 RLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVG 420
           RLE+LM+RRPELANSVLLRQNPHNVEQWHRRVK+FEGNPTKQILTYTEAVRTVDPMKAVG
Sbjct: 358 RLEYLMDRRPELANSVLLRQNPHNVEQWHRRVKLFEGNPTKQILTYTEAVRTVDPMKAVG 417

Query: 421 KPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGA 480
           KPHTLWVAFAKLYE + D+ NARVIFDKAVQVNYKTVD+LASIWCEWAEMELRH+NF GA
Sbjct: 418 KPHTLWVAFAKLYENHNDLVNARVIFDKAVQVNYKTVDNLASIWCEWAEMELRHQNFSGA 477

Query: 481 LELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYER 540
           LEL+RRATAEPSVEV+RRVAADGNEPVQMK+HK LRLWTFYVDLEE LG+LESTRAVYER
Sbjct: 478 LELLRRATAEPSVEVKRRVAADGNEPVQMKVHKCLRLWTFYVDLEEGLGDLESTRAVYER 537

Query: 541 ILDLRIATPQIIINYALLLE 560
           ILDL+IATPQIIIN+ALLLE
Sbjct: 538 ILDLKIATPQIIINFALLLE 557

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449433880|ref|XP_004134724.1| PREDICTED: pre-mRNA-splicing factor SYF1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224076810|ref|XP_002305003.1| predicted protein [Populus trichocarpa] gi|222847967|gb|EEE85514.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147766668|emb|CAN65069.1| hypothetical protein VITISV_003952 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555040|ref|XP_003545847.1| PREDICTED: pre-mRNA-splicing factor SYF1-like [Glycine max] Back     alignment and taxonomy information
>gi|356549407|ref|XP_003543085.1| PREDICTED: pre-mRNA-splicing factor SYF1-like [Glycine max] Back     alignment and taxonomy information
>gi|297808885|ref|XP_002872326.1| hypothetical protein ARALYDRAFT_489660 [Arabidopsis lyrata subsp. lyrata] gi|297318163|gb|EFH48585.1| hypothetical protein ARALYDRAFT_489660 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15241911|ref|NP_198226.1| pre-mRNA-splicing factor SYF1 [Arabidopsis thaliana] gi|7682783|gb|AAF67364.1| Hypothetical protein T32B20.g [Arabidopsis thaliana] gi|332006447|gb|AED93830.1| pre-mRNA-splicing factor SYF1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357446341|ref|XP_003593448.1| Pre-mRNA-splicing factor SYF1 [Medicago truncatula] gi|355482496|gb|AES63699.1| Pre-mRNA-splicing factor SYF1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|359496732|ref|XP_003635315.1| PREDICTED: pre-mRNA-splicing factor syf1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
TAIR|locus:2184236 917 AT5G28740 [Arabidopsis thalian 0.942 0.610 0.791 9.6e-242
ZFIN|ZDB-GENE-040426-685 851 xab2 "XPA binding protein 2" [ 0.474 0.331 0.575 1.9e-155
MGI|MGI:1914689 855 Xab2 "XPA binding protein 2" [ 0.474 0.329 0.554 4.5e-152
RGD|621217 855 Xab2 "XPA binding protein 2" [ 0.474 0.329 0.554 4.5e-152
UNIPROTKB|F5H315 852 XAB2 "Pre-mRNA-splicing factor 0.474 0.330 0.554 5.7e-152
UNIPROTKB|Q9HCS7 855 XAB2 "Pre-mRNA-splicing factor 0.474 0.329 0.554 5.7e-152
UNIPROTKB|F6RY07 855 XAB2 "Uncharacterized protein" 0.474 0.329 0.554 9.3e-152
UNIPROTKB|F1SCH5 855 XAB2 "Uncharacterized protein" 0.474 0.329 0.554 9.3e-152
UNIPROTKB|E2RPV4 855 XAB2 "Uncharacterized protein" 0.474 0.329 0.554 1.5e-151
UNIPROTKB|J9PAI6 799 XAB2 "Uncharacterized protein" 0.474 0.352 0.554 1.5e-151
TAIR|locus:2184236 AT5G28740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2313 (819.3 bits), Expect = 9.6e-242, Sum P(2) = 9.6e-242
 Identities = 443/560 (79%), Positives = 480/560 (85%)

Query:     1 MAISKXXXXXXXXXXXXXXXXRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSY 60
             MAISK                RN FSLKLWWRYL+AK E+PFKKRF+IYERALKALPGSY
Sbjct:     1 MAISKDLYPSQEDLLYEEELLRNQFSLKLWWRYLIAKAESPFKKRFIIYERALKALPGSY 60

Query:    61 KLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITK 120
             KLW+AYL ERL IV+NLP+THP+Y++LNNTFER LVTMHKMPRIW+MYL+TLT Q+ IT+
Sbjct:    61 KLWYAYLRERLDIVRNLPVTHPQYDSLNNTFERGLVTMHKMPRIWVMYLQTLTVQQLITR 120

Query:   121 ARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFL 180
              RRTFDRALCALPVTQHDRIWE YL FV Q GIPIETSLRVYRRYL YDPSHIE+FIEFL
Sbjct:   121 TRRTFDRALCALPVTQHDRIWEPYLVFVSQNGIPIETSLRVYRRYLMYDPSHIEEFIEFL 180

Query:   181 VKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGG 240
             VKS+ WQE+AERLASVLNDD+FYSIKGKTKH+LWLELC+LL  HA  ISGLNVDAIIRGG
Sbjct:   181 VKSERWQESAERLASVLNDDKFYSIKGKTKHKLWLELCELLVHHANVISGLNVDAIIRGG 240

Query:   241 IRKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMV 300
             IRKFTDEVG LWTSLADYYIR+ L EKARDI+EEGMM VVTVRDFSVIFD YS+FEE  V
Sbjct:   241 IRKFTDEVGMLWTSLADYYIRKNLLEKARDIYEEGMMKVVTVRDFSVIFDVYSRFEESTV 300

Query:   301 SAKMAKPDLSVXXXXXXXXXXXXXXXXIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLA 360
             + KM     S                 +RL+ NLS+ E  +K+LNGFWL+D  DVDLRLA
Sbjct:   301 AKKMEMMSSSDEEDENEENGVEDDEEDVRLNFNLSVKELQRKILNGFWLNDDNDVDLRLA 360

Query:   361 RLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVG 420
             RLE LMNRRP LANSVLLRQNPHNVEQWHRRVKIFEGN  KQILTYTEAVRTVDPMKAVG
Sbjct:   361 RLEELMNRRPALANSVLLRQNPHNVEQWHRRVKIFEGNAAKQILTYTEAVRTVDPMKAVG 420

Query:   421 KPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGA 480
             KPHTLWVAFAKLYE +KD+ N RVIFDKAVQVNYKTVDHLAS+WCEWAEMELRHKNFKGA
Sbjct:   421 KPHTLWVAFAKLYENHKDLVNTRVIFDKAVQVNYKTVDHLASVWCEWAEMELRHKNFKGA 480

Query:   481 LELMRRATAEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYER 540
             LELMRRATA P+VEVRRRVAADGNEPVQMKLH+SLRLW+FYVDLEESLG LESTRAVYE+
Sbjct:   481 LELMRRATAVPTVEVRRRVAADGNEPVQMKLHRSLRLWSFYVDLEESLGTLESTRAVYEK 540

Query:   541 ILDLRIATPQIIINYALLLE 560
             ILDLRIATPQII+NYA LLE
Sbjct:   541 ILDLRIATPQIIMNYAFLLE 560
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
ZFIN|ZDB-GENE-040426-685 xab2 "XPA binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914689 Xab2 "XPA binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621217 Xab2 "XPA binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F5H315 XAB2 "Pre-mRNA-splicing factor SYF1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCS7 XAB2 "Pre-mRNA-splicing factor SYF1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6RY07 XAB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCH5 XAB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPV4 XAB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAI6 XAB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 594
KOG2047 835 consensus mRNA splicing factor [RNA processing and 100.0
KOG1915 677 consensus Cell cycle control protein (crooked neck 100.0
KOG1915677 consensus Cell cycle control protein (crooked neck 100.0
KOG0495913 consensus HAT repeat protein [RNA processing and m 100.0
KOG0495 913 consensus HAT repeat protein [RNA processing and m 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.95
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.94
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.92
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.88
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.88
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.87
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.86
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
KOG0547606 consensus Translocase of outer mitochondrial membr 99.84
KOG1258577 consensus mRNA processing protein [RNA processing 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.82
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.8
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.79
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.79
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.79
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.78
KOG1258577 consensus mRNA processing protein [RNA processing 99.77
PLN03077 857 Protein ECB2; Provisional 99.76
KOG1126638 consensus DNA-binding cell division cycle control 99.76
KOG2076 895 consensus RNA polymerase III transcription factor 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
PLN03218 1060 maturation of RBCL 1; Provisional 99.74
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.74
KOG2076 895 consensus RNA polymerase III transcription factor 99.73
KOG1126638 consensus DNA-binding cell division cycle control 99.72
PLN03077 857 Protein ECB2; Provisional 99.68
KOG0547606 consensus Translocase of outer mitochondrial membr 99.68
PLN03218 1060 maturation of RBCL 1; Provisional 99.68
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.67
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.67
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.66
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.64
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.64
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.64
PRK12370553 invasion protein regulator; Provisional 99.64
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.63
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
KOG2003 840 consensus TPR repeat-containing protein [General f 99.58
PRK12370553 invasion protein regulator; Provisional 99.56
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.55
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.55
PRK11189296 lipoprotein NlpI; Provisional 99.55
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.55
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.53
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.52
KOG1125579 consensus TPR repeat-containing protein [General f 99.51
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.5
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.5
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.5
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.49
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.49
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.49
PRK11189296 lipoprotein NlpI; Provisional 99.49
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.49
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.48
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.48
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.47
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.46
PRK15359144 type III secretion system chaperone protein SscB; 99.45
KOG1125579 consensus TPR repeat-containing protein [General f 99.45
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.43
KOG2003 840 consensus TPR repeat-containing protein [General f 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.37
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.35
KOG1129478 consensus TPR repeat-containing protein [General f 99.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.31
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.31
PRK10370198 formate-dependent nitrite reductase complex subuni 99.29
PLN02789320 farnesyltranstransferase 99.29
KOG1129478 consensus TPR repeat-containing protein [General f 99.25
KOG2376652 consensus Signal recognition particle, subunit Srp 99.22
PRK10370198 formate-dependent nitrite reductase complex subuni 99.21
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.2
PLN02789320 farnesyltranstransferase 99.19
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.18
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.15
PRK15359144 type III secretion system chaperone protein SscB; 99.15
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.14
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.13
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.12
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.09
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.09
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.05
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.03
KOG0553304 consensus TPR repeat-containing protein [General f 99.02
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.02
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.01
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.99
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.98
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.96
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.95
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.94
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.93
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.93
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.92
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.89
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.89
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.86
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.84
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.82
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.82
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.79
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.77
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.77
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.73
KOG0553304 consensus TPR repeat-containing protein [General f 98.69
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.68
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.68
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.65
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.64
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.63
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.63
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.62
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.62
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.58
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.57
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.57
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.56
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.56
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.54
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.54
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.52
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.49
PRK04841 903 transcriptional regulator MalT; Provisional 98.47
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.44
PRK11906458 transcriptional regulator; Provisional 98.43
PRK10803263 tol-pal system protein YbgF; Provisional 98.43
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.37
PRK04841903 transcriptional regulator MalT; Provisional 98.36
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.34
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.33
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.32
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.31
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.31
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.3
PRK11906458 transcriptional regulator; Provisional 98.3
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.28
PRK15331165 chaperone protein SicA; Provisional 98.28
COG4700251 Uncharacterized protein conserved in bacteria cont 98.25
PF1337173 TPR_9: Tetratricopeptide repeat 98.23
PF1342844 TPR_14: Tetratricopeptide repeat 98.21
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.17
PRK10803263 tol-pal system protein YbgF; Provisional 98.16
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.14
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.14
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.12
PF1337173 TPR_9: Tetratricopeptide repeat 98.12
PF12688120 TPR_5: Tetratrico peptide repeat 98.09
PF12688120 TPR_5: Tetratrico peptide repeat 98.07
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.05
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.03
PF1343134 TPR_17: Tetratricopeptide repeat 98.02
PRK15331165 chaperone protein SicA; Provisional 98.02
PF1342844 TPR_14: Tetratricopeptide repeat 98.02
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.98
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.97
KOG4234271 consensus TPR repeat-containing protein [General f 97.97
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.85
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.78
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.75
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.71
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.64
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.64
COG3898531 Uncharacterized membrane-bound protein [Function u 97.63
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.6
PF13512142 TPR_18: Tetratricopeptide repeat 97.59
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.59
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.58
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.58
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.57
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.57
COG4700251 Uncharacterized protein conserved in bacteria cont 97.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.51
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.5
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.48
PF1343134 TPR_17: Tetratricopeptide repeat 97.46
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.45
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.45
KOG4555175 consensus TPR repeat-containing protein [Function 97.41
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.41
PF13512142 TPR_18: Tetratricopeptide repeat 97.36
KOG4234271 consensus TPR repeat-containing protein [General f 97.35
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.35
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.27
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.27
COG3898531 Uncharacterized membrane-bound protein [Function u 97.26
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.25
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.23
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.21
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.15
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.13
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.1
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.05
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.03
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.0
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.95
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 96.95
KOG4555175 consensus TPR repeat-containing protein [Function 96.92
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.92
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.88
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.83
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.82
KOG1586288 consensus Protein required for fusion of vesicles 96.79
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.78
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.78
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.74
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 96.53
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.49
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.49
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.47
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.45
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.45
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 96.43
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.4
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.39
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.32
KOG1585308 consensus Protein required for fusion of vesicles 96.3
KOG4648536 consensus Uncharacterized conserved protein, conta 96.3
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.23
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.23
KOG1585308 consensus Protein required for fusion of vesicles 96.22
KOG1586288 consensus Protein required for fusion of vesicles 96.21
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.05
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.96
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.91
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.85
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.65
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.57
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.49
KOG3616 1636 consensus Selective LIM binding factor [Transcript 95.43
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.36
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.3
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.11
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.09
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.99
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.85
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 94.82
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 94.81
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.71
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.66
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.59
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.56
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.55
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 94.38
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.36
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.16
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.07
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 93.9
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.82
KOG2471 696 consensus TPR repeat-containing protein [General f 93.76
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.74
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 93.7
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.68
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.42
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.96
PF09986214 DUF2225: Uncharacterized protein conserved in bact 92.51
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 92.27
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.6
PRK10941269 hypothetical protein; Provisional 91.54
KOG2422 665 consensus Uncharacterized conserved protein [Funct 91.33
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.93
PRK10941269 hypothetical protein; Provisional 90.69
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 90.62
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.62
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.44
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.01
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.49
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 89.43
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.42
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.89
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 88.62
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 87.8
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 87.56
KOG4507 886 consensus Uncharacterized conserved protein, conta 87.17
KOG2300 629 consensus Uncharacterized conserved protein [Funct 86.98
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.4
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 86.27
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 85.28
PF1286294 Apc5: Anaphase-promoting complex subunit 5 84.6
KOG4814 872 consensus Uncharacterized conserved protein [Funct 84.38
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.72
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 83.65
COG3629280 DnrI DNA-binding transcriptional activator of the 83.55
COG3947361 Response regulator containing CheY-like receiver a 83.16
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.12
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 82.97
PF1286294 Apc5: Anaphase-promoting complex subunit 5 82.73
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 82.66
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.36
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 81.82
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 81.67
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 80.59
KOG20411189 consensus WD40 repeat protein [General function pr 80.31
PF1304150 PPR_2: PPR repeat family 80.18
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=6.3e-66  Score=510.12  Aligned_cols=533  Identities=61%  Similarity=1.011  Sum_probs=495.5

Q ss_pred             CCCCCCCCCCcchHhHHHHhhCCCCHHHHHHHHHHHHcCChhHHHHHHHHHHHhCCCChHHHHHHHHHHHHhccCCCCCc
Q 007648            2 AISKELYPSEDDLLYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITH   81 (594)
Q Consensus         2 ~~~~~~~~~~~~~~~e~~l~~~P~~~~~w~~~~~~~~~~~~~~a~~~~e~al~~~P~s~~lW~~~~~~~~~~~~~~~~~~   81 (594)
                      .++...++++.|.+||+.|.+||.|...|++||++.......+...+|||||+..|.|..+|..|+.....++..+|.+.
T Consensus         2 ~~n~dl~~~~EDvpfEeEilRnp~svk~W~RYIe~k~~sp~k~~~~lYERal~~lp~sykiW~~YL~~R~~~vk~~~~T~   81 (835)
T KOG2047|consen    2 IENVDLNFENEDVPFEEEILRNPFSVKCWLRYIEHKAGSPDKQRNLLYERALKELPGSYKIWYDYLKARRAQVKHLCPTD   81 (835)
T ss_pred             CCCccccccccccchHHHHHcCchhHHHHHHHHHHHccCChHHHHHHHHHHHHHCCCchHHHHHHHHHHHHHhhccCCCC
Confidence            34556778889999999999999999999999999888888999999999999999999999999998888888899999


Q ss_pred             hhHHHHHHHHHHHHHhcCCChHHHHHHHHHHHhcccHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHcCCchHHHHHH
Q 007648           82 PEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRV  161 (594)
Q Consensus        82 ~~~~~A~~~~~~al~~~P~~~~lw~~y~~~~~~~~~~~~A~~~~~ral~~~p~~~~~~~w~~~~~~~~~~~~~~~~a~~~  161 (594)
                      .-++.....|++++....+.|.+|..|+++.++|+++...|..|.|||...|..+|..+|..|+.|....+-+ +.++.+
T Consensus        82 ~~~~~vn~c~er~lv~mHkmpRIwl~Ylq~l~~Q~~iT~tR~tfdrALraLpvtqH~rIW~lyl~Fv~~~~lP-ets~rv  160 (835)
T KOG2047|consen   82 PAYESVNNCFERCLVFMHKMPRIWLDYLQFLIKQGLITRTRRTFDRALRALPVTQHDRIWDLYLKFVESHGLP-ETSIRV  160 (835)
T ss_pred             hHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHhcchHHHHHHHHHHHHHhCchHhhccchHHHHHHHHhCCCh-HHHHHH
Confidence            9999999999999999999999999999999999999999999999999999988999999999999999999 999999


Q ss_pred             HHHHHhhCCCCHHHHHHHHHhcccHHHHHHHHHHhhcCcccccccccchHHHHHHHHHHHhhcccccccCcHHHHHHHHH
Q 007648          162 YRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGI  241 (594)
Q Consensus       162 ~~~~l~~~p~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (594)
                      |++.|++.|...+.|+.++...++.++|.+.|..+++++.|.+..|++.+++|.++++++..+|+.+.+.+.+++++.++
T Consensus       161 yrRYLk~~P~~~eeyie~L~~~d~~~eaa~~la~vln~d~f~sk~gkSn~qlw~elcdlis~~p~~~~slnvdaiiR~gi  240 (835)
T KOG2047|consen  161 YRRYLKVAPEAREEYIEYLAKSDRLDEAAQRLATVLNQDEFVSKKGKSNHQLWLELCDLISQNPDKVQSLNVDAIIRGGI  240 (835)
T ss_pred             HHHHHhcCHHHHHHHHHHHHhccchHHHHHHHHHhcCchhhhhhcccchhhHHHHHHHHHHhCcchhcccCHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999998999999999999


Q ss_pred             hhccchhHHHHHHHHHHHHHhccHHHHHHHHHHHHhhhccccchHHHHHHHHHHHHHHHHHHhcCCCCCCcccccccccC
Q 007648          242 RKFTDEVGRLWTSLADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHG  321 (594)
Q Consensus       242 ~~~p~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~l~~~~~~~e~~~~~~~l~~~~~~~~~~~~~~~~~  321 (594)
                      .+||+....+|..||++|++.|.+++|+++|+++++..-+..++..+|+.|+.||+......++ +......        
T Consensus       241 ~rftDq~g~Lw~SLAdYYIr~g~~ekarDvyeeai~~v~tvrDFt~ifd~Ya~FEE~~~~~~me-~a~~~~~--------  311 (835)
T KOG2047|consen  241 RRFTDQLGFLWCSLADYYIRSGLFEKARDVYEEAIQTVMTVRDFTQIFDAYAQFEESCVAAKME-LADEESG--------  311 (835)
T ss_pred             ccCcHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHhheehhhHHHHHHHHHHHHHHHHHHHHh-hhhhccc--------
Confidence            9999999999999999999999999999999999999999999999999999999998776665 2111110        


Q ss_pred             CcchhhhHhhhhhhHHHHHHhhhccccccchhhHHHHHHHHHhhhhhchhhhhhhhhccCCCChHHHHHHHHHhcCCchh
Q 007648          322 SAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFEGNPTK  401 (594)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~~~~~~  401 (594)
                                             ++   ++..+++.+++.|+.+++.++.++|..+|++||+|+..|+..+.+++|++.+
T Consensus       312 -----------------------n~---ed~~dl~~~~a~~e~lm~rr~~~lNsVlLRQn~~nV~eW~kRV~l~e~~~~~  365 (835)
T KOG2047|consen  312 -----------------------NE---EDDVDLELHMARFESLMNRRPLLLNSVLLRQNPHNVEEWHKRVKLYEGNAAE  365 (835)
T ss_pred             -----------------------Ch---hhhhhHHHHHHHHHHHHhccchHHHHHHHhcCCccHHHHHhhhhhhcCChHH
Confidence                                   00   1133577788999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhccCCCcccCCchHHHHHHHHHHHhcCCHHHHHHHHHHHHhccCCChhhHHHHHHHHHHHHHhcCChHHHH
Q 007648          402 QILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGAL  481 (594)
Q Consensus       402 a~~~y~~Ai~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~kal~~~p~~~~~~~~~~~~~~~~~~~~~~~~~A~  481 (594)
                      ...+|..|++.++|.+.+|+...+|..+|.+|+..|+++.||.+|++|++.+....+.+..+|+.||.+++++.+++.|+
T Consensus       366 ~i~tyteAv~~vdP~ka~Gs~~~Lw~~faklYe~~~~l~~aRvifeka~~V~y~~v~dLa~vw~~waemElrh~~~~~Al  445 (835)
T KOG2047|consen  366 QINTYTEAVKTVDPKKAVGSPGTLWVEFAKLYENNGDLDDARVIFEKATKVPYKTVEDLAEVWCAWAEMELRHENFEAAL  445 (835)
T ss_pred             HHHHHHHHHHccCcccCCCChhhHHHHHHHHHHhcCcHHHHHHHHHHhhcCCccchHHHHHHHHHHHHHHHhhhhHHHHH
Confidence            99999999999999998899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCchhHhhhhh-ccCChhhhHHhhccHhhHHHHHHHHHHhCChHHHHHHHHHHHhccCCchHHHHHHHHHHH
Q 007648          482 ELMRRATAEPSVEVRRRVA-ADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLE  560 (594)
Q Consensus       482 ~~~~~al~~~p~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~~~~~~~  560 (594)
                      ++.++|+..+...   .++ +++..+.|.+++.|..+|..|+|++..+|.++..+.+|++.+.+....|++.+|||.|+.
T Consensus       446 ~lm~~A~~vP~~~---~~~~yd~~~pvQ~rlhrSlkiWs~y~DleEs~gtfestk~vYdriidLriaTPqii~NyAmfLE  522 (835)
T KOG2047|consen  446 KLMRRATHVPTNP---ELEYYDNSEPVQARLHRSLKIWSMYADLEESLGTFESTKAVYDRIIDLRIATPQIIINYAMFLE  522 (835)
T ss_pred             HHHHhhhcCCCch---hhhhhcCCCcHHHHHHHhHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhcCCHHHHHHHHHHHH
Confidence            9999999885431   233 677778899999999999999999999999999999999999999999999999999999


Q ss_pred             Hhchhhhhhhccc
Q 007648          561 VWTLLHVFLLHVP  573 (594)
Q Consensus       561 ~~g~~~~a~~~~~  573 (594)
                      .+..|+++-+.|.
T Consensus       523 eh~yfeesFk~YE  535 (835)
T KOG2047|consen  523 EHKYFEESFKAYE  535 (835)
T ss_pred             hhHHHHHHHHHHH
Confidence            9999999976554

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-24
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-05
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 1e-18
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-10
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 1e-07
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 2e-17
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-13
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 3e-08
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-05
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-14
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-13
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 8e-09
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-08
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-08
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-07
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
 Score =  106 bits (266), Expect = 1e-24
 Identities = 72/553 (13%), Positives = 157/553 (28%), Gaps = 112/553 (20%)

Query: 15  LYEEELLRNPFSLKLWWRYLVAKREAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIV 74
           + E++L  NP+ L  W   +   +  P  K    YER +   P S +             
Sbjct: 1   MAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRF------------ 48

Query: 75  KNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKFITKARRTFDRALCALPV 134
                                         W +Y+E     K   K  + F R L  +  
Sbjct: 49  ------------------------------WKLYIEAEIKAKNYDKVEKLFQRCLMKVL- 77

Query: 135 TQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEAAERLA 194
             H  +W+ YL +V +    + +      +   +    I   I      ++W +      
Sbjct: 78  --HIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIM---SYQIWVDYIN--- 129

Query: 195 SVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTS 254
                              +L+  + + ++A       V  + + G       + +LW  
Sbjct: 130 -------------------FLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRD 170

Query: 255 LADYYIRRELFEKARDIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEE 314
              Y     +    + I +         RD+        ++E +M           ++  
Sbjct: 171 YNKYEEGINIHLAKKMIEDR-------SRDYMNARRVAKEYETVM---------KGLDRN 214

Query: 315 EDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDV--KDVDLRLARLEHLMNRRPEL 372
                  +   E  ++D+     ++ K          +  K V     +   ++   P++
Sbjct: 215 APSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDI 274

Query: 373 ANS-VLLRQNPHNVEQWHRRVKIFEGNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAK 431
                   +    +      +   +    +    Y  A+ T+       K   L+ A+A 
Sbjct: 275 WYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLK-----KNMLLYFAYAD 329

Query: 432 LYETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEP 491
             E+         I+++ + +          ++ ++ +   R +  K    + ++A  + 
Sbjct: 330 YEESRMKYEKVHSIYNRLLAIEDID---PTLVYIQYMKFARRAEGIKSGRMIFKKAREDA 386

Query: 492 SVEVRRRVAA-------DGN--------EPVQMKLHKSLRLWTFYVDLEESLGNLESTRA 536
                  V A         +        E    K          Y+D    L    +TR 
Sbjct: 387 RTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRV 446

Query: 537 VYERILDLRIATP 549
           ++ER+L      P
Sbjct: 447 LFERVLTSGSLPP 459
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 100.0
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 100.0
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.98
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.93
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.91
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.9
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.87
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.87
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.86
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.84
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.84
3u4t_A272 TPR repeat-containing protein; structural genomics 99.81
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.81
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.78
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.78
3u4t_A272 TPR repeat-containing protein; structural genomics 99.78
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.76
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.76
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.74
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.74
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.74
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.73
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.73
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.71
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.7
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.69
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.69
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.68
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.68
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.68
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.67
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.67
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.65
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.65
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.65
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.63
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.63
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.62
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.61
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.61
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.6
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.58
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.57
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.56
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.55
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.55
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.54
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.54
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.53
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.52
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.51
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.49
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.49
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.48
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.47
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.46
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.46
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.46
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.45
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.45
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.44
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.43
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.43
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.43
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.42
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.42
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.41
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.41
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.4
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.4
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.4
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.4
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.37
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.37
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.37
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.37
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.35
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.34
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.32
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.32
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.31
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.25
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.25
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.23
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.22
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.22
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.21
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.2
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.2
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.2
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.19
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.19
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.19
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.18
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.18
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.16
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.15
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.15
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.14
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.14
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.13
3k9i_A117 BH0479 protein; putative protein binding protein, 99.13
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.11
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.1
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.08
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.06
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.03
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.02
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.02
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.0
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.0
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.0
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.97
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.96
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.94
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.94
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.93
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.92
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.91
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.91
3k9i_A117 BH0479 protein; putative protein binding protein, 98.9
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.87
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.87
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.87
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.86
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.83
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.82
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.8
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.78
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.75
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.75
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.7
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.65
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.65
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.62
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.55
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.54
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.53
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.52
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.42
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.41
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.36
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.25
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.22
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.04
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.01
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.99
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.89
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.77
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.71
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 97.69
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.64
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.62
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 97.62
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.52
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.5
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.44
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.42
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 97.31
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 97.29
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 97.21
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.13
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.09
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 96.63
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 96.45
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.89
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.88
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.03
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.38
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.3
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.86
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.7
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.41
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.12
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.38
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.38
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.45
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.67
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 88.49
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.99
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 87.96
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 86.58
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 86.49
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.0
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 84.71
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 84.54
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 84.38
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 82.15
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 81.43
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.07
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 80.54
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
Probab=100.00  E-value=2.3e-37  Score=336.07  Aligned_cols=450  Identities=12%  Similarity=0.151  Sum_probs=341.1

Q ss_pred             CCCcchHhHHHHhhCCCCHHHHHHHHHHHH-cCChhHHHHHHHHHHHhCCCChHHHHHHHHHHHHhccCCCCCchh---H
Q 007648            9 PSEDDLLYEEELLRNPFSLKLWWRYLVAKR-EAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPE---Y   84 (594)
Q Consensus         9 ~~~~~~~~e~~l~~~P~~~~~w~~~~~~~~-~~~~~~a~~~~e~al~~~P~s~~lW~~~~~~~~~~~~~~~~~~~~---~   84 (594)
                      .++....||+.|.+||.|.+.|.+|+++.. .++++.++.+|+++|..+|.+..+|..|+.++..        .++   +
T Consensus        48 ~~d~i~~lE~~l~~np~d~~~W~~yi~~~~~~~~~~~aR~vyEraL~~fP~~~~lW~~Yi~~E~~--------~~~~~~~  119 (679)
T 4e6h_A           48 ESDVIGKLNDMIEEQPTDIFLYVKLLKHHVSLKQWKQVYETFDKLHDRFPLMANIWCMRLSLEFD--------KMEELDA  119 (679)
T ss_dssp             CSCHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHT--------C--CCCH
T ss_pred             CHHHHHHHHHHHHHCcCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHh--------hCCcchH
Confidence            344455899999999999999999999875 6899999999999999999999999999999843        355   9


Q ss_pred             HHHHHHHHHHHHhcC--CChHHHHHHHHHHHhcccH--------HHHHHHHHHHHHhCCC-C-CHHHHHHHHHHHHHHc-
Q 007648           85 ETLNNTFERALVTMH--KMPRIWIMYLETLTSQKFI--------TKARRTFDRALCALPV-T-QHDRIWEIYLRFVEQE-  151 (594)
Q Consensus        85 ~~A~~~~~~al~~~P--~~~~lw~~y~~~~~~~~~~--------~~A~~~~~ral~~~p~-~-~~~~~w~~~~~~~~~~-  151 (594)
                      +.++.+|+||+...|  .++.+|..|+.+..+.++.        +.++++|++|+...+. + .++.+|..|+.|+... 
T Consensus       120 ~~v~~lfeRal~~~~~~~sv~LW~~Yl~f~~~~~~~~~~~~~~r~~vr~~FErAl~~vG~~d~~s~~iW~~Yi~f~~~~~  199 (679)
T 4e6h_A          120 AVIEPVLARCLSKELGNNDLSLWLSYITYVRKKNDIITGGEEARNIVIQAFQVVVDKCAIFEPKSIQFWNEYLHFLEHWK  199 (679)
T ss_dssp             HHHHHHHHHHTCSSSCCCCHHHHHHHHHHHHHHSCSTTTHHHHHHHHHHHHHHHHHHTTTTCSSCHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHhcccccccchhHHHHHHHHHHHHHHhCcccccchHHHHHHHHHHHhcc
Confidence            999999999999994  7899999999998876542        5577999999987654 2 3478999999997632 


Q ss_pred             --------CCchHHHHHHHHHHHhhCCCCHH----HHHHHHHh-------------cccHHHHHHHHHHhh------cC-
Q 007648          152 --------GIPIETSLRVYRRYLKYDPSHIE----DFIEFLVK-------------SKLWQEAAERLASVL------ND-  199 (594)
Q Consensus       152 --------~~~~~~a~~~~~~~l~~~p~~~~----~~~~~~~~-------------~~~~~~a~~~~~~~~------~~-  199 (594)
                              +.. +.++++|++++.+...+.+    .|..+...             ..+|+.|...+...-      .. 
T Consensus       200 ~~~~~eeq~~~-~~~R~iy~raL~iP~~~~~~~w~~Y~~fe~~~~~~~a~~~~~e~~~~y~~Ar~~~~e~~~~~~~l~r~  278 (679)
T 4e6h_A          200 PVNKFEEQQRV-QYIRKLYKTLLCQPMDCLESMWQRYTQWEQDVNQLTARRHIGELSAQYMNARSLYQDWLNITKGLKRN  278 (679)
T ss_dssp             CCSHHHHHHHH-HHHHHHHHHHTTSCCSSHHHHHHHHHHHHHHHCTTTHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCCC
T ss_pred             ccCcHHHHhHH-HHHHHHHHHHHhCccHHHHHHHHHHHHHHHhcCcchHHHHHHHhhHHHHHHHHHHHHHHHHHHhHhhc
Confidence                    233 7899999999975333333    23333222             234555666655422      10 


Q ss_pred             -ccc--------ccc---cccchHHHHHHHHHHHhhccccccc----CcHHHHHHHHHhhccchhHHHHHHHHHHHHHhc
Q 007648          200 -DQF--------YSI---KGKTKHRLWLELCDLLTTHATEISG----LNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRE  263 (594)
Q Consensus       200 -~~~--------~~~---~~~~~~~~w~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~p~~~~~~~~~la~~~~~~g  263 (594)
                       |..        .+.   .......+|..|+.|++.+|..++.    ..+..++++++..+|.. +++|+.++.++...|
T Consensus       279 ~p~~~~~~~~~~~p~~~~~~~~ql~lW~~yi~fEk~~~~~l~~~~~~~Rv~~~Ye~aL~~~p~~-~~lW~~ya~~~~~~~  357 (679)
T 4e6h_A          279 LPITLNQATESNLPKPNEYDVQQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFA-PEIWFNMANYQGEKN  357 (679)
T ss_dssp             CCSSSTTCCTTTSCCTTCCCHHHHHHHHHHHHHHHTCTTCCCHHHHHHHHHHHHHHHHHHTTTC-HHHHHHHHHHHHHHS
T ss_pred             cccccccchhccCCCCchhHHHHHHHHHHHHHHHHhCCccccchhhHHHHHHHHHHHHHHcCCC-HHHHHHHHHHHHhcC
Confidence             110        000   0112468999999999988743221    12346789999999975 899999999999999


Q ss_pred             cHHHHH-HHHHHHHhhhccccchHHHHHHHHHHHHHHHHHHhcCCCCCCcccccccccCCcchhhhHhhhhhhHHHHHHh
Q 007648          264 LFEKAR-DIFEEGMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKK  342 (594)
Q Consensus       264 ~~~~A~-~~~~~al~~~p~~~~~~~l~~~~~~~e~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  342 (594)
                      +.+.|+ ++|++|+..+|...   .+|..++.+++...                                          
T Consensus       358 ~~~~a~r~il~rAi~~~P~s~---~Lwl~~a~~ee~~~------------------------------------------  392 (679)
T 4e6h_A          358 TDSTVITKYLKLGQQCIPNSA---VLAFSLSEQYELNT------------------------------------------  392 (679)
T ss_dssp             CCTTHHHHHHHHHHHHCTTCH---HHHHHHHHHHHHTT------------------------------------------
T ss_pred             cHHHHHHHHHHHHHHhCCCCH---HHHHHHHHHHHHhC------------------------------------------
Confidence            999996 99999999999765   68888998887521                                          


Q ss_pred             hhccccccchhhHHHHHHHHHhhhhhchhhhhhhhhccCCC-----------ChHHHHHHHHHhc--CCchhHHHHHHHH
Q 007648          343 VLNGFWLHDVKDVDLRLARLEHLMNRRPELANSVLLRQNPH-----------NVEQWHRRVKIFE--GNPTKQILTYTEA  409 (594)
Q Consensus       343 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~-----------~~~~~~~~~~~~~--~~~~~a~~~y~~A  409 (594)
                                 .+..++..|++++...+.... ......|.           ...+|..++.++.  ++.+.|+.+|++|
T Consensus       393 -----------~~e~aR~iyek~l~~l~~~~~-~~~~~~p~~~~~~~~~~~~~~~vWi~y~~~erR~~~l~~AR~vf~~A  460 (679)
T 4e6h_A          393 -----------KIPEIETTILSCIDRIHLDLA-ALMEDDPTNESAINQLKSKLTYVYCVYMNTMKRIQGLAASRKIFGKC  460 (679)
T ss_dssp             -----------CHHHHHHHHHHHHHHHHHHHH-HHHHHSTTCHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             -----------CHHHHHHHHHHHHHHHHHHhh-hhhhccCcchhhhhhhccchHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence                       122234445554321100000 00011243           4568999999875  7899999999999


Q ss_pred             HhccCCCcccCCchHHHHHHHHHHHhcC-CHHHHHHHHHHHHhccCCChhhHHHHHHHHHHHHHhcCChHHHHHHHHHHh
Q 007648          410 VRTVDPMKAVGKPHTLWVAFAKLYETYK-DIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRAT  488 (594)
Q Consensus       410 i~~~~~~~~~~~~~~~~~~~a~~~~~~~-~~~~A~~~~~kal~~~p~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al  488 (594)
                      ++..++.     ...+|+.+|.++.+.+ +.++|+++|+++++..|+++    .+|..|++++...|+.+.||.+|++|+
T Consensus       461 ~~~~~~~-----~~~lyi~~A~lE~~~~~d~e~Ar~ife~~Lk~~p~~~----~~w~~y~~fe~~~~~~~~AR~lferal  531 (679)
T 4e6h_A          461 RRLKKLV-----TPDIYLENAYIEYHISKDTKTACKVLELGLKYFATDG----EYINKYLDFLIYVNEESQVKSLFESSI  531 (679)
T ss_dssp             HHTGGGS-----CTHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTTCH----HHHHHHHHHHHHHTCHHHHHHHHHHHT
T ss_pred             HHhcCCC-----ChHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHCCCch----HHHHHHHHHHHhCCCHHHHHHHHHHHH
Confidence            9852321     4689999999998765 59999999999999999999    999999999999999999999999999


Q ss_pred             cCCchhHhhhhhccCChhhhHHhhccHhhHHHHHHHHHHhCChHHHHHHHHHHHhccCCchHH
Q 007648          489 AEPSVEVRRRVAADGNEPVQMKLHKSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQI  551 (594)
Q Consensus       489 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~~~~  551 (594)
                      ...|+..                 +...+|..|+++|.+.|+.+.++++++|+++..|+++.+
T Consensus       532 ~~~~~~~-----------------~~~~lw~~~~~fE~~~G~~~~~~~v~~R~~~~~P~~~~~  577 (679)
T 4e6h_A          532 DKISDSH-----------------LLKMIFQKVIFFESKVGSLNSVRTLEKRFFEKFPEVNKL  577 (679)
T ss_dssp             TTSSSTT-----------------HHHHHHHHHHHHHHHTCCSHHHHHHHHHHHHHSTTCCHH
T ss_pred             HhcCCHH-----------------HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCcHH
Confidence            9988200                 145899999999999999999999999999999998753
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 594
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 6e-12
d2onda1 308 a.118.8.7 (A:242-549) Cleavage stimulation factor 4e-06
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 4e-05
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 0.003
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 64.6 bits (156), Expect = 6e-12
 Identities = 30/264 (11%), Positives = 86/264 (32%), Gaps = 21/264 (7%)

Query: 26  SLKLWWRYLVAKREAP---------FKKRFVIYERALKALPGSYKLWHAYL------IER 70
            + +W +Y+  ++  P          K+    YE+ L  L     +W+          + 
Sbjct: 7   QVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKL 66

Query: 71  LSIVKNLPITHPEYETLNNTFERAL-VTMHKMPRIWIMYLETLTSQKFITKARRTFDRAL 129
           L+   ++       +   N +ERA+   + K   ++  Y +   S+    K    ++R L
Sbjct: 67  LAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLL 126

Query: 130 CALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDFIEFLVKSKLWQEA 189
            A+       ++  Y++F  +    I++   ++++  +   +    ++       +    
Sbjct: 127 -AIEDIDPTLVYIQYMKFARRAE-GIKSGRMIFKKAREDARTRHHVYVTAA---LMEYYC 181

Query: 190 AERLASVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVG 249
           ++  +      +    K        L   D L+    + +   +   +        ++ G
Sbjct: 182 SKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSG 241

Query: 250 RLWTSLADYYIRRELFEKARDIFE 273
            +W     +            + +
Sbjct: 242 EIWARFLAFESNIGDLASILKVEK 265
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.88
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.84
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.72
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.7
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.67
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.67
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.6
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.54
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.43
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.43
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.31
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.29
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.28
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.19
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.18
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.17
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.16
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.14
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.08
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.07
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.05
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.02
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.01
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.99
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.97
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.9
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.87
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.82
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.7
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.52
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.42
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.28
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.25
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.22
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.12
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.08
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.38
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.28
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.21
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.97
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.07
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.16
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 85.43
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-29  Score=257.54  Aligned_cols=373  Identities=13%  Similarity=0.078  Sum_probs=290.7

Q ss_pred             HcCChhHHHHHHHHHHHhCCCChHHHHHHHHHHHHhccCCCCCchhHHHHHHHHHHHHHhcCCChHHHHHHHHHHHhccc
Q 007648           38 REAPFKKRFVIYERALKALPGSYKLWHAYLIERLSIVKNLPITHPEYETLNNTFERALVTMHKMPRIWIMYLETLTSQKF  117 (594)
Q Consensus        38 ~~~~~~~a~~~~e~al~~~P~s~~lW~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~P~~~~lw~~y~~~~~~~~~  117 (594)
                      ..|+++.|...|+++++.+|.++.+|...+...        ...|++++|+..|+++++.+|+++.+|..++.++.++|+
T Consensus        11 ~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~--------~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~   82 (388)
T d1w3ba_          11 QAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIH--------FQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             HHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHH--------HHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTC
T ss_pred             HcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHH--------HHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcc
Confidence            478999999999999999999999888877665        344888999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHcCCchHHHHHHHHHHHhhCCCCHHHH---HHHHHhcccHHHHHHHHH
Q 007648          118 ITKARRTFDRALCALPVTQHDRIWEIYLRFVEQEGIPIETSLRVYRRYLKYDPSHIEDF---IEFLVKSKLWQEAAERLA  194 (594)
Q Consensus       118 ~~~A~~~~~ral~~~p~~~~~~~w~~~~~~~~~~~~~~~~a~~~~~~~l~~~p~~~~~~---~~~~~~~~~~~~a~~~~~  194 (594)
                      +++|...+.+++...|..  ...+..........+.. ..+...........+......   .......+....+...  
T Consensus        83 ~~~A~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  157 (388)
T d1w3ba_          83 LQEAIEHYRHALRLKPDF--IDGYINLAAALVAAGDM-EGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKAC--  157 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTC--HHHHHHHHHHHHHHSCS-SHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHH--
T ss_pred             cccccccccccccccccc--ccccccccccccccccc-cccccccccccccccccccccccccccccccchhhhhHHH--
Confidence            999999999999988875  44444444444444555 555555555555544443211   1112222222222222  


Q ss_pred             HhhcCcccccccccchHHHHHHHHHHHhhcccccccCcHHHHHHHHHhhccchhHHHHHHHHHHHHHhccHHHHHHHHHH
Q 007648          195 SVLNDDQFYSIKGKTKHRLWLELCDLLTTHATEISGLNVDAIIRGGIRKFTDEVGRLWTSLADYYIRRELFEKARDIFEE  274 (594)
Q Consensus       195 ~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~la~~~~~~g~~~~A~~~~~~  274 (594)
                                                                +.+.+...|+. ...+..+|..+...|+++.|...+++
T Consensus       158 ------------------------------------------~~~~~~~~~~~-~~~~~~l~~~~~~~~~~~~A~~~~~~  194 (388)
T d1w3ba_         158 ------------------------------------------YLKAIETQPNF-AVAWSNLGCVFNAQGEIWLAIHHFEK  194 (388)
T ss_dssp             ------------------------------------------HHHHHHHCTTC-HHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             ------------------------------------------HHHhhccCcch-hHHHHhhcccccccCcHHHHHHHHHH
Confidence                                                      22333444443 57899999999999999999999999


Q ss_pred             HHhhhccccchHHHHHHHHHHHHHHHHHHhcCCCCCCcccccccccCCcchhhhHhhhhhhHHHHHHhhhccccccchhh
Q 007648          275 GMMTVVTVRDFSVIFDSYSQFEEIMVSAKMAKPDLSVEEEEDDEEHGSAEDEDIRLDVNLSMAEFVKKVLNGFWLHDVKD  354 (594)
Q Consensus       275 al~~~p~~~~~~~l~~~~~~~e~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (594)
                      ++...|+...   .+.........                                                     .+.
T Consensus       195 al~~~p~~~~---~~~~l~~~~~~-----------------------------------------------------~~~  218 (388)
T d1w3ba_         195 AVTLDPNFLD---AYINLGNVLKE-----------------------------------------------------ARI  218 (388)
T ss_dssp             HHHHCTTCHH---HHHHHHHHHHT-----------------------------------------------------TTC
T ss_pred             HHHhCcccHH---HHHHHhhhhhc-----------------------------------------------------ccc
Confidence            9999887653   22222211110                                                     011


Q ss_pred             HHHHHHHHHhhhhhchhhhhhhhhccCCCChHHHHHHHHHhc--CCchhHHHHHHHHHhccCCCcccCCchHHHHHHHHH
Q 007648          355 VDLRLARLEHLMNRRPELANSVLLRQNPHNVEQWHRRVKIFE--GNPTKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKL  432 (594)
Q Consensus       355 ~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~--~~~~~a~~~y~~Ai~~~~~~~~~~~~~~~~~~~a~~  432 (594)
                      ...++..+++            ....+|.+...+..++.++.  |++++|+..|++|++. .|.     .+.+|..+|.+
T Consensus       219 ~~~A~~~~~~------------~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-~p~-----~~~~~~~l~~~  280 (388)
T d1w3ba_         219 FDRAVAAYLR------------ALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL-QPH-----FPDAYCNLANA  280 (388)
T ss_dssp             TTHHHHHHHH------------HHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT-CSS-----CHHHHHHHHHH
T ss_pred             HHHHHHHHHH------------hHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh-CCC-----CHHHHHHHHHH
Confidence            2234455666            46778899999998888774  8999999999999986 443     67899999999


Q ss_pred             HHhcCCHHHHHHHHHHHHhccCCChhhHHHHHHHHHHHHHhcCChHHHHHHHHHHhcCCchhHhhhhhccCChhhhHHhh
Q 007648          433 YETYKDIANARVIFDKAVQVNYKTVDHLASIWCEWAEMELRHKNFKGALELMRRATAEPSVEVRRRVAADGNEPVQMKLH  512 (594)
Q Consensus       433 ~~~~~~~~~A~~~~~kal~~~p~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~  512 (594)
                      +...|++++|+..+++++...|.++    ..+..++.++...|++++|.+.|+++++..|+                   
T Consensus       281 ~~~~~~~~~A~~~~~~~~~~~~~~~----~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-------------------  337 (388)
T d1w3ba_         281 LKEKGSVAEAEDCYNTALRLCPTHA----DSLNNLANIKREQGNIEEAVRLYRKALEVFPE-------------------  337 (388)
T ss_dssp             HHHHSCHHHHHHHHHHHHHHCTTCH----HHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTT-------------------
T ss_pred             HHHcCCHHHHHHHHHhhhccCCccc----hhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCC-------------------
Confidence            9999999999999999999999999    89999999999999999999999999999995                   


Q ss_pred             ccHhhHHHHHHHHHHhCChHHHHHHHHHHHhccCCchHHHHHHHHHHHHhch
Q 007648          513 KSLRLWTFYVDLEESLGNLESTRAVYERILDLRIATPQIIINYALLLEVWTL  564 (594)
Q Consensus       513 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~~~~~~~~~g~  564 (594)
                       ++.+|..++.++...|++++|+..|++|++++|+++.+|.++|.++.+.||
T Consensus       338 -~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         338 -FAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             -CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             -CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence             678899999999999999999999999999999999999999999999886
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure