Citrus Sinensis ID: 007931

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580----
MSQFWKPGAEKPRLLDDEEGGVVFLSSSLSSASSIGYGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWML
cccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHcccccccccEEEEccccccccccEEEEccHHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHcccccccccccccccccccccEEEEccccccccEEEccccHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHccccccccEEEcccccccHHHHHHccccccccccEEEEEccccccccccccEEEEEcccccccccccccccccEEEEcccHHHHHHcccccccccccccEEEcccHHHHHHHccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccHHHHHHccccccHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHc
ccccccccccccccccccccccccccccccccccccccHcHHHHHHcccccHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHccccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEcccHHHHHHHHccccHHccEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccccccccccccccccccEEEEccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEcccccEEccccccccccEEEEcEccHHHHHHHcccccccccccEEEEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHc
msqfwkpgaekprllddeegGVVFLSSSLSSASSIGYGYASIEKqrqrlpvykYRTAILYLVETHATTIIvgetgsgkttqipqylkeagwadggrviacTQPRRLAVQAVASRVAEEMGVKVGEEVGYtirfedftnkdltaiKFLTDGVLLRemmddplltkYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHArkgrrglegvelvprlepailsvegrgfnvqihyveepvsDYVQAAVSTVLLihdkeppgdilvfltgqddIDATIQLLTEEARtskknssgliilplysglsraeqeqvfsptprgkrkvvistniaetsltLEGIVYVVDsgfskqrfynpisdienlvvaPISKASARQRagragrvrpgkcyrlyteeyfvkeipaegipemqRSNLVSCVIQLKALgidnilgfdwpaspppEAMIRALEVLYSlgvldddakltsptgfqvaeiplepmiSKMIlssnelgcseeIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLqscksshwchknfINYHAMVRNLIWML
msqfwkpgaekprllddeEGGVVFLSSSLSSASSIGYGYasiekqrqrlpVYKYRTAILYLVETHATTiivgetgsgkttqiPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIrfedftnkdltaiKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKgrrglegvelvprlEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEeartskknssglIILPLYSGLSRAEQEqvfsptprgkrkvvistniaetsltlegIVYVVDSGFSKQRFYNPISDIENLVVAPISKasarqragragrvrpgkcyrLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWML
MSQFWKPGAEKPRLLDDEEGGVVFlssslssassigygyasiEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRvaeemgvkvgeevgYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASarqragragrvrpgKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWML
*********************VVFL*******SSIGYGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTE**********GLIILPLYSGL****************RKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISK*********AGRVRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWM*
********************************************QRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLT************LIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIW*****************AAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWM*
********AEKPRLLDDEEGGVVFLSSSLSSASSIGYGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSR**************RKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISK************VRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWML
************************************YGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGR**L**VELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKAS***********RPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIW*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQFWKPGAEKPRLLDDEEGGVVFLSSSLSSASSIGYGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLIWML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query584 2.2.26 [Sep-21-2011]
Q9H5Z1 703 Probable ATP-dependent RN yes no 0.965 0.802 0.523 1e-173
Q5RBD4 720 Probable ATP-dependent RN yes no 0.969 0.786 0.519 1e-172
Q54F05 1160 ATP-dependent RNA helicas yes no 0.907 0.456 0.491 1e-155
Q9BKQ8 732 Probable ATP-dependent RN yes no 0.909 0.725 0.499 1e-153
Q38953 1168 Probable pre-mRNA-splicin no no 0.886 0.443 0.503 1e-153
A2A4P0 1244 ATP-dependent RNA helicas no no 0.886 0.416 0.498 1e-152
Q14562 1220 ATP-dependent RNA helicas no no 0.886 0.424 0.498 1e-152
O42643 1168 Pre-mRNA-splicing factor yes no 0.902 0.451 0.482 1e-151
Q09530 1200 Probable pre-mRNA-splicin no no 0.886 0.431 0.496 1e-149
O22899 729 Probable pre-mRNA-splicin no no 0.888 0.711 0.483 1e-148
>sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 Back     alignment and function desciption
 Score =  608 bits (1567), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 304/581 (52%), Positives = 404/581 (69%), Gaps = 17/581 (2%)

Query: 3   QFWKPGAEKPRLLDDEEGGVVFLSSSLSSASSIGYG-YA--SIEKQRQRLPVYKYRTAIL 59
           +FW+PG E P +   EE      S + +S +++ Y  YA  SIE+QRQ+LPV+K R  IL
Sbjct: 9   KFWRPGTEGPGVSISEERQ----SLAENSGTTVVYNPYAALSIEQQRQKLPVFKLRNHIL 64

Query: 60  YLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEM 119
           YL+E + T +IVGETG GK+TQIPQYL EAGW   GRV+  TQPRR+A   VA RVAEE 
Sbjct: 65  YLIENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEER 124

Query: 120 GVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSIS 179
           G  +G EVGY IRF+D T++  T IKFLTDG+L+REMM DPLLTKYSVIM+DEAHER++ 
Sbjct: 125 GAVLGHEVGYCIRFDDCTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLY 184

Query: 180 TDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILS 239
           TDI +GLLKKIQ+ R DLRLI++SAT++A     FF+  +            R    IL+
Sbjct: 185 TDIAIGLLKKIQKKRGDLRLIVASATLDADKFRDFFNQNETSDP-------ARDTCVILT 237

Query: 240 VEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEE 299
           VEGR F V I Y++ PV DY+++ V TV+ IH  E  GD+L FLTGQ++++  + +L E+
Sbjct: 238 VEGRTFPVDIFYLQSPVPDYIKSTVETVVKIHQTEGDGDVLAFLTGQEEVETVVSMLIEQ 297

Query: 300 ARTSKKN--SSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYV 357
           AR   +      L +LP+Y+GL   EQ +VF    R  RKV+++TN+AETS+T+ GIVYV
Sbjct: 298 ARALARTGMKRHLRVLPMYAGLPSFEQMKVFERVSRSVRKVIVATNVAETSITISGIVYV 357

Query: 358 VDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPA 417
           +D GF K R YNP + IE LVV P+S+ASA QRAGR GR R GKCYRLYTEE F K +P 
Sbjct: 358 IDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDK-LPQ 416

Query: 418 EGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLT 477
             +PEMQRSNL   ++QLKALGIDN+L F + + PP ++M++ALE+LY+LG LD D +LT
Sbjct: 417 STVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLT 476

Query: 478 SPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKL 537
            P G ++AE PL PM +KM+L S   GCS+EI++I+A++ IQ+I+V     +        
Sbjct: 477 EPLGMRIAEFPLNPMFAKMLLESGNFGCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHR 536

Query: 538 RFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVR 578
           +FA  EGDH+T LNIY+ F++  K S WC ++F+NY  +VR
Sbjct: 537 KFAVEEGDHLTMLNIYEAFIKHNKDSKWCQEHFLNYKGLVR 577
May be involved in pre-mRNA splicing.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function description
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description
>sp|O22899|DHX15_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query584
255563046 696 ATP-dependent RNA helicase, putative [Ri 0.982 0.824 0.880 0.0
359483563 695 PREDICTED: probable ATP-dependent RNA he 0.982 0.825 0.857 0.0
297740468 694 unnamed protein product [Vitis vinifera] 0.981 0.825 0.861 0.0
449462101 696 PREDICTED: probable ATP-dependent RNA he 0.982 0.824 0.855 0.0
224079135 702 predicted protein [Populus trichocarpa] 0.982 0.817 0.857 0.0
334186668 695 ATP-dependent RNA helicase DDX35 [Arabid 0.981 0.824 0.795 0.0
357446867 701 ATP-dependent RNA helicase dhx8 [Medicag 0.993 0.827 0.811 0.0
297804318 704 hypothetical protein ARALYDRAFT_914834 [ 0.981 0.813 0.783 0.0
262411017 704 P10Sh95F04 [Saccharum hybrid cultivar R5 0.986 0.818 0.788 0.0
242056001 700 hypothetical protein SORBIDRAFT_03g00203 0.986 0.822 0.788 0.0
>gi|255563046|ref|XP_002522527.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223538218|gb|EEF39827.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/576 (88%), Positives = 536/576 (93%), Gaps = 2/576 (0%)

Query: 1   MSQFWKPGAEKPRLLDDEEGGVVFLSSSLSSASSIGYGYASIEKQRQRLPVYKYRTAILY 60
           M+ FWKPG EKP LLDDEEGGVVFLSSS+SS+SS    Y SIEKQRQRLPVYKYRTAILY
Sbjct: 1   MALFWKPGTEKPPLLDDEEGGVVFLSSSVSSSSSGYG-YVSIEKQRQRLPVYKYRTAILY 59

Query: 61  LVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMG 120
           LVETHAT++IVGETGSGKTTQIPQYLKEAGWADGGR+IACTQPRRLAVQAVASRVAEEMG
Sbjct: 60  LVETHATSVIVGETGSGKTTQIPQYLKEAGWADGGRLIACTQPRRLAVQAVASRVAEEMG 119

Query: 121 VKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSIST 180
           VK+GEEVGYTIRFED TN D+T IKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSIST
Sbjct: 120 VKLGEEVGYTIRFEDLTNSDVTKIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSIST 179

Query: 181 DILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSV 240
           DILLGLLKKIQR R +LRLIISSATIEAKSMSAFF A K RRGLE  EL PR EPAILSV
Sbjct: 180 DILLGLLKKIQRRRPELRLIISSATIEAKSMSAFFQASKRRRGLEADELGPRKEPAILSV 239

Query: 241 EGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEA 300
           EGRGFNVQI YVEE V+DYV+A VSTVL IHD+EP GDILVFLTGQDDIDA +QLLTEEA
Sbjct: 240 EGRGFNVQILYVEEAVADYVRATVSTVLSIHDQEPAGDILVFLTGQDDIDAAVQLLTEEA 299

Query: 301 RTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDS 360
           +   KNSSGLI+LPLYSGLSRAEQ+ VFSPTPRGKRK+VISTNIAETSLT+EGIVYVVDS
Sbjct: 300 QVKGKNSSGLIVLPLYSGLSRAEQDLVFSPTPRGKRKIVISTNIAETSLTMEGIVYVVDS 359

Query: 361 GFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPAEGI 420
           GFSKQRFYNPISD+ENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYF+ E+P +GI
Sbjct: 360 GFSKQRFYNPISDVENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFINEMPTQGI 419

Query: 421 PEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPT 480
           PEMQRSNLVS VIQLKALGIDNILGFDWPASP PEAMIRALEVLYSLG+LDDDAKLTSP 
Sbjct: 420 PEMQRSNLVSSVIQLKALGIDNILGFDWPASPSPEAMIRALEVLYSLGILDDDAKLTSPV 479

Query: 481 GFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFA 540
           GFQVAE PLEPMISKMILSSN+LGCSEEIITI+AVLSIQSIW+S R AQKELDEAKLRFA
Sbjct: 480 GFQVAESPLEPMISKMILSSNQLGCSEEIITIAAVLSIQSIWISTR-AQKELDEAKLRFA 538

Query: 541 AAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAM 576
           AAEGDHVTFLN+Y+GFLQS KSS WCHKNF+NYHAM
Sbjct: 539 AAEGDHVTFLNVYQGFLQSGKSSQWCHKNFVNYHAM 574

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359483563|ref|XP_002276679.2| PREDICTED: probable ATP-dependent RNA helicase DHX35 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740468|emb|CBI30650.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449462101|ref|XP_004148780.1| PREDICTED: probable ATP-dependent RNA helicase DHX35-like [Cucumis sativus] gi|449515633|ref|XP_004164853.1| PREDICTED: probable ATP-dependent RNA helicase DHX35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224079135|ref|XP_002305762.1| predicted protein [Populus trichocarpa] gi|222848726|gb|EEE86273.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334186668|ref|NP_567558.2| ATP-dependent RNA helicase DDX35 [Arabidopsis thaliana] gi|332658650|gb|AEE84050.1| ATP-dependent RNA helicase DDX35 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357446867|ref|XP_003593709.1| ATP-dependent RNA helicase dhx8 [Medicago truncatula] gi|355482757|gb|AES63960.1| ATP-dependent RNA helicase dhx8 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297804318|ref|XP_002870043.1| hypothetical protein ARALYDRAFT_914834 [Arabidopsis lyrata subsp. lyrata] gi|297315879|gb|EFH46302.1| hypothetical protein ARALYDRAFT_914834 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|262411017|gb|ACY66873.1| P10Sh95F04 [Saccharum hybrid cultivar R570] Back     alignment and taxonomy information
>gi|242056001|ref|XP_002457146.1| hypothetical protein SORBIDRAFT_03g002030 [Sorghum bicolor] gi|241929121|gb|EES02266.1| hypothetical protein SORBIDRAFT_03g002030 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query584
ZFIN|ZDB-GENE-070410-11 691 zgc:158828 "zgc:158828" [Danio 0.967 0.817 0.487 4.8e-142
RGD|1311165679 Dhx35 "DEAH (Asp-Glu-Ala-His) 0.970 0.835 0.480 1.6e-141
UNIPROTKB|D3ZZG1 703 Dhx35 "Protein Dhx35" [Rattus 0.970 0.806 0.480 1.6e-141
UNIPROTKB|E1BDN4 703 DHX35 "Uncharacterized protein 0.970 0.806 0.479 5.5e-141
UNIPROTKB|E2RQN7 702 DHX35 "Uncharacterized protein 0.970 0.807 0.482 5.5e-141
UNIPROTKB|F1SDW0 719 DHX35 "Uncharacterized protein 0.970 0.788 0.477 5.5e-141
UNIPROTKB|Q5THR1679 DHX35 "Probable ATP-dependent 0.970 0.835 0.480 1.9e-140
UNIPROTKB|Q9H5Z1 703 DHX35 "Probable ATP-dependent 0.970 0.806 0.480 1.9e-140
UNIPROTKB|E1C4U5 705 DHX35 "Uncharacterized protein 0.970 0.804 0.475 2.7e-139
UNIPROTKB|E2RQN1 698 DHX35 "Uncharacterized protein 0.904 0.756 0.503 1.2e-138
ZFIN|ZDB-GENE-070410-11 zgc:158828 "zgc:158828" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1389 (494.0 bits), Expect = 4.8e-142, P = 4.8e-142
 Identities = 282/578 (48%), Positives = 381/578 (65%)

Query:     3 QFWKPGAEKPRLLDDEEGGVVFXXXXXXXXXXXXXXXXXXEKQRQRLPVYKYRTAILYLV 62
             +FWKPG+E P + ++ +   +                   EKQRQRLPV+K+R  ILYLV
Sbjct:     1 KFWKPGSEAPGVCEERD---LSTETTGSPIVFNPHTALTIEKQRQRLPVFKHRNNILYLV 57

Query:    63 ETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRXXXXXXXX 122
             E+  T +IVGETGSGK+TQIPQYL EAGWA  G+VI  TQPRR+A  +VA+R        
Sbjct:    58 ESFQTVVIVGETGSGKSTQIPQYLLEAGWAAEGKVIGVTQPRRVAATSVATRVAEERGAF 117

Query:   123 XXXXXXYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDI 182
                   YTIRF+D ++   T IKFLTDG+L+REMM DPLL KYSV+++DEAHER++ TDI
Sbjct:   118 LGHEVGYTIRFDDCSDPHATRIKFLTDGMLVREMMSDPLLKKYSVLILDEAHERTLYTDI 177

Query:   183 LLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEG 242
              +GLLKKI + R DLRLI++SAT++AK    FF+  +   G    +        IL+VEG
Sbjct:   178 AIGLLKKILKKRRDLRLIVASATLDAKKFQDFFNLNES--GDASKDTC-----GILTVEG 230

Query:   243 RGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEART 302
             R F V I Y   PV DYV+A V TVL IH+ E  GD+L FLTGQ++++  + LL E+ART
Sbjct:   231 RTFPVDIFYTVSPVPDYVKATVETVLKIHETEDDGDVLAFLTGQEEVEKVVSLLQEQART 290

Query:   303 SKKNS--SGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDS 360
               +      L +LP+Y+GL   EQ +VF       RKVV++TNIAETS+T+ G+V+V+D 
Sbjct:   291 LSRYGMKKHLCVLPMYAGLPYNEQMRVFERMAPTVRKVVVATNIAETSITINGVVFVIDC 350

Query:   361 GFSKQRFYNPISDIENLVVAPISKASXXXXXXXXXXXXXXKCYRLYTEEYFVKEIPAEGI 420
              F K R YNP + IE+L+V PISKAS              KC+RLYTEE F K +P   +
Sbjct:   351 AFVKIRAYNPRTAIESLIVTPISKASACQRAGRAGRNRAGKCFRLYTEEDFEK-LPESTV 409

Query:   421 PEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPT 480
             PEMQRSNL   ++QLKALGIDN+L F + + PP ++M++ALE+L++LG LD   +LT P 
Sbjct:   410 PEMQRSNLAPVILQLKALGIDNVLRFSFLSPPPAQSMVQALELLFALGGLDQYGRLTDPM 469

Query:   481 GFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFA 540
             G ++AE PL PM +KM+L S   GCS+EI+TI+A++ IQ+I+V+    +K       +FA
Sbjct:   470 GVRMAEFPLSPMFAKMLLESGNFGCSKEIVTIAAMMQIQNIFVAPHNQRKSAAREHRKFA 529

Query:   541 AAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVR 578
              AEGDH+T LN+Y+ F++  KSS WC  +F+NY  ++R
Sbjct:   530 VAEGDHLTMLNVYEAFIKHQKSSQWCQDHFLNYKGLLR 567
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0016787 "hydrolase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
RGD|1311165 Dhx35 "DEAH (Asp-Glu-Ala-His) box polypeptide 35" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D3ZZG1 Dhx35 "Protein Dhx35" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDN4 DHX35 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQN7 DHX35 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDW0 DHX35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5THR1 DHX35 "Probable ATP-dependent RNA helicase DHX35" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H5Z1 DHX35 "Probable ATP-dependent RNA helicase DHX35" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4U5 DHX35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQN1 DHX35 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9H5Z1DHX35_HUMAN3, ., 6, ., 4, ., 1, 30.52320.96570.8022yesno
Q5RBD4DHX35_PONAB3, ., 6, ., 4, ., 1, 30.51970.96910.7861yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.13LOW CONFIDENCE prediction!
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_IV0154
hypothetical protein (703 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query584
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 0.0
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-120
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-113
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-94
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-84
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 3e-30
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-27
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 1e-22
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 6e-20
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-13
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-12
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-11
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 2e-07
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-04
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 4e-04
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 0.003
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  608 bits (1571), Expect = 0.0
 Identities = 251/560 (44%), Positives = 337/560 (60%), Gaps = 45/560 (8%)

Query: 39  YASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVI 98
              I + R  LPV   R  IL  +E +   IIVGETGSGKTTQ+PQ+L E G    G+ I
Sbjct: 39  VPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAGK-I 97

Query: 99  ACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMD 158
            CTQPRRLA ++VA RVAEE+G K+GE VGY+IRFE   +   T IK +TDG+LLRE+ +
Sbjct: 98  GCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPR-TRIKVMTDGILLREIQN 156

Query: 159 DPLLTKYSVIMVDEAHERSISTDILLGLLKKIQ-RCRSDLRLIISSATIEAKSMSAFFHA 217
           DPLL+ YSV+++DEAHERS++TDILLGLLK +  R R DL+LII SAT++A+  SA+F  
Sbjct: 157 DPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSATLDAERFSAYF-- 214

Query: 218 RKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDY-VQAAVSTVLLIHDKEPP 276
                              ++ +EGR + V+I Y+ E  +DY +  A+   + IH +E  
Sbjct: 215 ---------------GNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIHLREGS 259

Query: 277 GDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKR 336
           G ILVFL GQ +I+ T + L +      +    L ILPLY  LS  EQ +VF P P GKR
Sbjct: 260 GSILVFLPGQREIERTAEWLEK-----AELGDDLEILPLYGALSAEEQVRVFEPAPGGKR 314

Query: 337 KVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGR 396
           KVV++TNIAETSLT+ GI YV+DSG +K++ Y+P + +  L   PISKASA QRAGRAGR
Sbjct: 315 KVVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGR 374

Query: 397 VRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGID-NILGFDWPASPPPE 455
             PG CYRLY+EE F    P   +PE+ R++L   V+QLK+LGI  +I  F +   PP  
Sbjct: 375 TGPGICYRLYSEEDF-LAFPEFTLPEILRTDLSGLVLQLKSLGIGQDIAPFPFLDPPPEA 433

Query: 456 AMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISAV 515
           A+  AL +L  LG LDD  KLT P G Q++ +PL+P +++M+L++ E GC  E  TI+++
Sbjct: 434 AIQAALTLLQELGALDDSGKLT-PLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIASM 492

Query: 516 LSIQSIWV---------SGRGAQKELDEAKLRFAAA-EGDHVTFLNIYKGFLQSCK---- 561
           LS Q               R AQ  L   K R AA   GDH+  L  +   +   +    
Sbjct: 493 LSEQDRESDFSRDVKLRKQRTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAKGE 552

Query: 562 --SSHWCHKNFINYHAMVRN 579
              ++ C        A+ R 
Sbjct: 553 YLRANGCRAMLFPTKALSRA 572

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 584
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
KOG0354746 consensus DEAD-box like helicase [General function 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 99.98
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.97
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.97
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.97
COG1205 851 Distinct helicase family with a unique C-terminal 99.97
KOG4284 980 consensus DEAD box protein [Transcription] 99.97
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.97
PRK13766 773 Hef nuclease; Provisional 99.96
PHA02558501 uvsW UvsW helicase; Provisional 99.96
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.95
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.95
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.95
PRK09401 1176 reverse gyrase; Reviewed 99.94
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.94
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.94
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.94
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.94
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.94
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.93
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.93
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.93
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.93
PRK05580679 primosome assembly protein PriA; Validated 99.93
PRK14701 1638 reverse gyrase; Provisional 99.93
PRK09694878 helicase Cas3; Provisional 99.93
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.92
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.92
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.91
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.91
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.91
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.91
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.89
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.86
PRK04914 956 ATP-dependent helicase HepA; Validated 99.85
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.85
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.82
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.82
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.81
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.8
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.77
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.77
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.77
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.75
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.74
COG4096 875 HsdR Type I site-specific restriction-modification 99.74
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.73
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.71
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.69
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.69
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.69
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.68
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.65
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.65
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.63
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.62
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.62
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.61
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.59
PRK05298652 excinuclease ABC subunit B; Provisional 99.57
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.53
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.5
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.5
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.46
KOG1123776 consensus RNA polymerase II transcription initiati 99.46
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.46
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.45
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.43
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.42
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.42
smart00487201 DEXDc DEAD-like helicases superfamily. 99.41
smart0049082 HELICc helicase superfamily c-terminal domain. 99.36
PRK14873665 primosome assembly protein PriA; Provisional 99.35
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.35
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.32
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.32
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.25
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.19
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.16
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.12
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.08
KOG0387923 consensus Transcription-coupled repair protein CSB 98.97
COG4889 1518 Predicted helicase [General function prediction on 98.93
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.71
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.68
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.66
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.55
COG0610 962 Type I site-specific restriction-modification syst 98.52
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.48
KOG1002791 consensus Nucleotide excision repair protein RAD16 98.41
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.39
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.34
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 98.26
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.25
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.19
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.18
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.18
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.14
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.12
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 98.11
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.09
PRK10536262 hypothetical protein; Provisional 98.08
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.98
PRK14974336 cell division protein FtsY; Provisional 97.91
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.91
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.89
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.89
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.87
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.82
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.82
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.81
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.81
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.8
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.8
PF1324576 AAA_19: Part of AAA domain 97.72
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.71
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.7
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.66
PRK06526254 transposase; Provisional 97.65
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.64
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.63
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 97.62
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.62
KOG4439901 consensus RNA polymerase II transcription terminat 97.59
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.58
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.57
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.56
smart00382148 AAA ATPases associated with a variety of cellular 97.55
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.55
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 97.53
PRK08181269 transposase; Validated 97.53
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.46
PF13173128 AAA_14: AAA domain 97.43
PRK10416318 signal recognition particle-docking protein FtsY; 97.4
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.37
PRK04296190 thymidine kinase; Provisional 97.37
PRK06835329 DNA replication protein DnaC; Validated 97.33
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.3
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.29
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.29
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.27
PF05729166 NACHT: NACHT domain 97.27
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.27
KOG1803649 consensus DNA helicase [Replication, recombination 97.22
TIGR00064272 ftsY signal recognition particle-docking protein F 97.21
PRK07952244 DNA replication protein DnaC; Validated 97.18
PRK08116268 hypothetical protein; Validated 97.18
PRK12377248 putative replication protein; Provisional 97.17
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.15
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.15
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.11
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.1
PRK00771437 signal recognition particle protein Srp54; Provisi 97.09
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.08
PRK10867433 signal recognition particle protein; Provisional 97.07
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.05
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.04
PRK09183259 transposase/IS protein; Provisional 97.03
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.01
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.01
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.01
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 97.0
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.93
PRK08727233 hypothetical protein; Validated 96.92
PRK08939306 primosomal protein DnaI; Reviewed 96.92
PRK09112351 DNA polymerase III subunit delta'; Validated 96.89
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.88
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.88
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.87
cd03115173 SRP The signal recognition particle (SRP) mediates 96.84
PRK05642234 DNA replication initiation factor; Validated 96.84
PRK06893229 DNA replication initiation factor; Validated 96.84
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.83
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.83
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.83
PRK12402337 replication factor C small subunit 2; Reviewed 96.76
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.75
TIGR00959428 ffh signal recognition particle protein. This mode 96.75
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.75
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.73
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.71
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.67
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.66
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 96.66
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.65
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.65
KOG2340698 consensus Uncharacterized conserved protein [Funct 96.65
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 96.64
PRK15483 986 type III restriction-modification system StyLTI en 96.63
PRK08084235 DNA replication initiation factor; Provisional 96.6
PRK00149450 dnaA chromosomal replication initiation protein; R 96.6
PRK06921266 hypothetical protein; Provisional 96.58
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.55
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 96.54
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.51
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.51
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 96.49
PRK07471365 DNA polymerase III subunit delta'; Validated 96.48
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.46
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.45
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.45
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.44
PRK14086617 dnaA chromosomal replication initiation protein; P 96.4
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 96.4
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.4
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 96.39
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 96.38
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 96.37
PRK06067234 flagellar accessory protein FlaH; Validated 96.33
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.33
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.33
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 96.31
PF00004132 AAA: ATPase family associated with various cellula 96.31
cd03246173 ABCC_Protease_Secretion This family represents the 96.3
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 96.3
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.29
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 96.29
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.28
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 96.28
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.27
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.27
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.26
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.26
PRK14087450 dnaA chromosomal replication initiation protein; P 96.24
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 96.23
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 96.23
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.23
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 96.19
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 96.18
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.17
KOG2228408 consensus Origin recognition complex, subunit 4 [R 96.15
PHA02544316 44 clamp loader, small subunit; Provisional 96.11
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.08
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 96.08
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.08
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.07
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.07
PHA03333752 putative ATPase subunit of terminase; Provisional 96.02
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 95.98
PRK14088440 dnaA chromosomal replication initiation protein; P 95.97
CHL00181287 cbbX CbbX; Provisional 95.97
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.97
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.96
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.95
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 95.95
KOG18051100 consensus DNA replication helicase [Replication, r 95.91
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 95.91
PTZ001121164 origin recognition complex 1 protein; Provisional 95.89
TIGR00376637 DNA helicase, putative. The gene product may repre 95.88
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.88
PRK07940394 DNA polymerase III subunit delta'; Validated 95.86
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.86
PTZ00293211 thymidine kinase; Provisional 95.83
PRK13833323 conjugal transfer protein TrbB; Provisional 95.82
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 95.81
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.79
PRK06620214 hypothetical protein; Validated 95.78
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.77
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 95.76
PLN03025319 replication factor C subunit; Provisional 95.72
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 95.69
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.67
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 95.66
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 95.64
PF1355562 AAA_29: P-loop containing region of AAA domain 95.64
PRK12422445 chromosomal replication initiation protein; Provis 95.64
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 95.62
PRK00440319 rfc replication factor C small subunit; Reviewed 95.58
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.58
PRK13851344 type IV secretion system protein VirB11; Provision 95.54
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 95.54
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.54
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.52
PRK04195482 replication factor C large subunit; Provisional 95.49
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.49
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 95.48
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 95.48
KOG0780483 consensus Signal recognition particle, subunit Srp 95.45
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 95.45
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 95.44
PHA02533534 17 large terminase protein; Provisional 95.42
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.36
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.36
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 95.35
PRK05707328 DNA polymerase III subunit delta'; Validated 95.35
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 95.33
cd03239178 ABC_SMC_head The structural maintenance of chromos 95.31
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.3
TIGR02974329 phageshock_pspF psp operon transcriptional activat 95.3
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.29
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 95.27
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.26
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 95.22
cd03215182 ABC_Carb_Monos_II This family represents domain II 95.19
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 95.18
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.16
PRK09087226 hypothetical protein; Validated 95.15
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 95.15
PRK11823446 DNA repair protein RadA; Provisional 95.15
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.14
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.12
PRK08769319 DNA polymerase III subunit delta'; Validated 95.11
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.11
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 95.1
COG4987573 CydC ABC-type transport system involved in cytochr 95.08
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 95.06
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 95.05
PRK09354349 recA recombinase A; Provisional 95.04
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.04
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.01
COG1119257 ModF ABC-type molybdenum transport system, ATPase 94.99
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.98
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.96
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.95
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 94.94
PRK07399314 DNA polymerase III subunit delta'; Validated 94.94
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.93
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 94.9
PRK05973237 replicative DNA helicase; Provisional 94.89
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 94.89
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.89
TIGR02688449 conserved hypothetical protein TIGR02688. Members 94.87
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 94.85
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 94.83
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.81
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 94.77
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.77
PRK13342413 recombination factor protein RarA; Reviewed 94.75
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.71
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 94.69
COG3587 985 Restriction endonuclease [Defense mechanisms] 94.68
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 94.68
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.66
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 94.65
PRK04841 903 transcriptional regulator MalT; Provisional 94.59
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.57
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 94.54
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 94.53
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 94.52
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.5
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 94.5
PHA00729226 NTP-binding motif containing protein 94.45
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.44
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.44
PRK06871325 DNA polymerase III subunit delta'; Validated 94.43
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 94.41
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 94.4
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 94.38
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.38
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.38
PRK10865857 protein disaggregation chaperone; Provisional 94.34
PRK08058329 DNA polymerase III subunit delta'; Validated 94.34
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.32
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.31
PRK11054684 helD DNA helicase IV; Provisional 94.31
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 94.29
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.28
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 94.28
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 94.28
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.28
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.28
PRK05580 679 primosome assembly protein PriA; Validated 94.23
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 94.21
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.17
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 94.16
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.16
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.15
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.14
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 94.13
PRK05564313 DNA polymerase III subunit delta'; Validated 94.13
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 94.12
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 94.12
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 94.11
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 94.08
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.08
PRK10789569 putative multidrug transporter membrane\ATP-bindin 94.08
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.04
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.03
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.02
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.01
PRK06904472 replicative DNA helicase; Validated 94.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 93.99
PRK15429686 formate hydrogenlyase transcriptional activator Fh 93.98
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 93.96
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 93.96
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 93.94
PRK10790592 putative multidrug transporter membrane\ATP-bindin 93.92
TIGR01817534 nifA Nif-specific regulatory protein. This model r 93.9
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 93.89
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.88
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 93.85
COG2204464 AtoC Response regulator containing CheY-like recei 93.84
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 93.84
PLN032321495 ABC transporter C family member; Provisional 93.84
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.84
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.81
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 93.79
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 93.78
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 93.77
COG0593408 DnaA ATPase involved in DNA replication initiation 93.76
PRK14873 665 primosome assembly protein PriA; Provisional 93.75
TIGR00763775 lon ATP-dependent protease La. This protein is ind 93.74
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 93.72
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 93.72
PRK10522547 multidrug transporter membrane component/ATP-bindi 93.67
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 93.66
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 93.66
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.64
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.64
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 93.63
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.62
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 93.62
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 93.62
COG1221403 PspF Transcriptional regulators containing an AAA- 93.61
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.59
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 93.59
PRK13695174 putative NTPase; Provisional 93.58
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 93.57
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 93.57
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 93.55
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 93.53
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 93.52
PLN031301622 ABC transporter C family member; Provisional 93.51
PRK08760476 replicative DNA helicase; Provisional 93.5
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.48
cd01128249 rho_factor Transcription termination factor rho is 93.47
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.47
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 93.47
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 93.46
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 93.44
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 93.43
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 93.42
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.41
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-124  Score=962.84  Aligned_cols=528  Identities=59%  Similarity=0.948  Sum_probs=512.7

Q ss_pred             CCCccchhhHHHHhcCCCchHHHHHHHHHHhcCCEEEEEcCCCChHHHHHHHHHHhcCccCCCeEEEEeCchHHHHHHHH
Q 007931           33 SSIGYGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVA  112 (584)
Q Consensus        33 ~~~~~~~~~l~~~~~~lP~~~~~~~il~~l~~~~~viv~a~TGsGKT~~ip~~l~~~~~~~~~~~I~v~~~r~la~~~~~  112 (584)
                      .........+.++|..|||++++++|++++++++++||.|+||||||||+||++++.++...++ |.||||||+|+.++|
T Consensus        34 ~~~~~~~~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~-I~~TQPRRVAavslA  112 (674)
T KOG0922|consen   34 SYGKSTNLSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGK-IACTQPRRVAAVSLA  112 (674)
T ss_pred             ccccccccCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCc-EEeecCchHHHHHHH
Confidence            3445556678999999999999999999999999999999999999999999999999998887 999999999999999


Q ss_pred             HHHHHHhCCcceeEEeeEeeccCcCCCCCceEEEechHHHHHHHccCCCCCCCcEEEEeCCCcCccchhHHHHHHHHHHH
Q 007931          113 SRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQR  192 (584)
Q Consensus       113 ~~~~~~~~~~vg~~vg~~~~~~~~~~~~~~~I~~~T~~~ll~~l~~~~~l~~~~~iIiDE~Her~~~~d~l~~~l~~~~~  192 (584)
                      +||+.|+++.+|..|||++||++.++. .|+|.|+|+|+|++++..|+.|++|++|||||||||++.+|.++++||++.+
T Consensus       113 ~RVAeE~~~~lG~~VGY~IRFed~ts~-~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~  191 (674)
T KOG0922|consen  113 KRVAEEMGCQLGEEVGYTIRFEDSTSK-DTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILK  191 (674)
T ss_pred             HHHHHHhCCCcCceeeeEEEecccCCC-ceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHh
Confidence            999999999999999999999999999 9999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCceEEEEecccChHHHHHHhhcCCCCCCCcccccCCCCCCeEEEECCccccceEEecCCCcchHHHHHHHHHHHHHh
Q 007931          193 CRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHD  272 (584)
Q Consensus       193 ~~~~~~vi~~SAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~i~~~~~  272 (584)
                      .++++|+|+||||+|++.|.+||++++                 ++.++||.|||+++|...+..||++..+..+.++|.
T Consensus       192 ~R~~LklIimSATlda~kfS~yF~~a~-----------------i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~  254 (674)
T KOG0922|consen  192 KRPDLKLIIMSATLDAEKFSEYFNNAP-----------------ILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHL  254 (674)
T ss_pred             cCCCceEEEEeeeecHHHHHHHhcCCc-----------------eEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHc
Confidence            999999999999999999999999988                 999999999999999999999999999999999999


Q ss_pred             cCCCCCEEEEeCcHHHHHHHHHHHHHHhhhccCCCCCeEEEEecCCCCHHHHhcccCCCCCCCcEEEEeCCCCccccccC
Q 007931          273 KEPPGDILVFLTGQDDIDATIQLLTEEARTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLE  352 (584)
Q Consensus       273 ~~~~~~iLVF~~~~~~i~~l~~~L~~~~~~~~~~~~~~~v~~lh~~l~~~~r~~i~~~~~~g~~~vlvaT~i~e~Gidip  352 (584)
                      .+++|+||||++|+++|+.+++.|.+.......+.+. .+.++||.|+.++|.+||+..+.|.+|||+|||+||++||||
T Consensus       255 ~E~~GDILvFLtGqeEIe~~~~~l~e~~~~~~~~~~~-~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~  333 (674)
T KOG0922|consen  255 TEPPGDILVFLTGQEEIEAACELLRERAKSLPEDCPE-LILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTID  333 (674)
T ss_pred             cCCCCCEEEEeCCHHHHHHHHHHHHHHhhhccccCcc-eeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEec
Confidence            9999999999999999999999999998777766666 899999999999999999999999999999999999999999


Q ss_pred             CeEEEEecCCccceeecCCCCcccceeeeccHHhHHHhccccCCCCCcEEEEccChHHHhhhCCCCCCCcccccchhHHH
Q 007931          353 GIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCV  432 (584)
Q Consensus       353 ~v~~VId~g~~k~~~~d~~~~~~~l~~~~~s~~~~~QR~GRaGR~~~G~~~~l~~~~~~~~~~~~~~~pei~r~~l~~~~  432 (584)
                      +|.||||+|++|++.|||..|++.|...|+|++++.||+|||||++||+|||||++++|+. |++.++|||+|++|...+
T Consensus       334 GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGRAGRt~pGkcyRLYte~~~~~-~~~~~~PEI~R~~Ls~~v  412 (674)
T KOG0922|consen  334 GIRYVVDSGFVKQKKYNPRTGLDSLIVVPISKASANQRAGRAGRTGPGKCYRLYTESAYDK-MPLQTVPEIQRVNLSSAV  412 (674)
T ss_pred             ceEEEEcCCceEEEeeccccCccceeEEechHHHHhhhcccCCCCCCceEEEeeeHHHHhh-cccCCCCceeeechHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999977 999999999999999999


Q ss_pred             HHHHhcCCCCccCCCCCCCCCHHHHHHHHHHHHHcCCccCCCCCCHHHHHHhccCCCChhhhHHHHhhcccCChHHHHHH
Q 007931          433 IQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITI  512 (584)
Q Consensus       433 L~l~~~~~~~~~~~~~~~~p~~~~~~~al~~L~~~g~i~~~~~lT~~lG~~~~~~pl~p~~~~~l~~~~~~~c~~~~l~i  512 (584)
                      |++|++|++|+..|+|+|||+.+++..|++.|+.+||||++|.+|.|+|+.|+.+|++|.++|+++.+..+||.+|+++|
T Consensus       413 L~Lkalgi~d~l~F~f~d~P~~~~l~~AL~~L~~lgald~~g~lt~p~G~~ma~~Pl~p~lsk~ll~s~~~gc~~e~l~i  492 (674)
T KOG0922|consen  413 LQLKALGINDPLRFPFIDPPPPEALEEALEELYSLGALDDRGKLTSPLGRQMAELPLEPHLSKMLLKSSELGCSEEILTI  492 (674)
T ss_pred             HHHHhcCCCCcccCCCCCCCChHHHHHHHHHHHhcCcccCcCCcCchHHhhhhhcCCCcchhhhhhhccccCCcchhhhh
Confidence            99999999999999999999999999999999999999999999977999999999999999999999999999999999


Q ss_pred             HHhhccCcccccCcccHHH-HHHHHhhccCCCCCHHHHHHHHHHHHHcCCcHHHHHHhCCCHHHHHHHHH
Q 007931          513 SAVLSIQSIWVSGRGAQKE-LDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVRNLI  581 (584)
Q Consensus       513 ~a~l~~~~~f~~~~~~~~~-~~~~~~~~~~~~~D~~~~l~~~~~~~~~~~~~~~c~~~~l~~~~~~~a~~  581 (584)
                      +|+||++++|..|.+.+.+ ++..|.+|...+|||+|+|++|+.|.+++.+++||++||||+++|++|.+
T Consensus       493 ~a~Lsv~~~f~~p~~~~~~~a~~~~~kf~~~eGDh~tlL~vy~~~~~~~~~~~wC~en~i~~r~l~~a~~  562 (674)
T KOG0922|consen  493 AAMLSVQSVFSRPKDKKAEDADRKRAKFANPEGDHLTLLNVYESWKENGTSKKWCKENFINARSLKRAKD  562 (674)
T ss_pred             eeeeeccceecCccchhhhhhhHHHHhhcCcccCHHHHHHHHHHHHhcCChhhHHHHhcccHHHHHHHHH
Confidence            9999999999999988777 88999999999999999999999999999999999999999999999875

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query584
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-121
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-121
3i4u_A 270 Crystal Structure Analysis Of A Helicase Associated 3e-25
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 3e-23
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  431 bits (1107), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 237/546 (43%), Positives = 342/546 (62%), Gaps = 33/546 (6%)
Query: 44  KQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQY--LKEAGWADGGRVIACT 101
           K R+ LPV+  R   L L + +   + VGETGSGKTTQIPQ+    E    +  +V ACT
Sbjct: 88  KIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQV-ACT 146
Query: 102 QPRRLAVQAVASRXXXXXXXXXXXXXXYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPL 161
           QPRR+A  +VA R              Y+IRFE+ T+ + T +K++TDG+LLRE M+D  
Sbjct: 147 QPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTS-NKTILKYMTDGMLLREAMEDHD 205
Query: 162 LTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGR 221
           L++YS I++DEAHER+++TDIL+GLLK++ + R DL++II SAT++A+    +F+     
Sbjct: 206 LSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFN----- 260
Query: 222 RGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILV 281
                       +  +L+V GR + V+++Y  E   DY+ +A+ TVL IH  E  GDIL+
Sbjct: 261 ------------DAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILL 308
Query: 282 FLTGQDDI-DATIQLLTEEARTSKKNSSG-LIILPLYSGLSRAEQEQVFSPTP-----RG 334
           FLTG+D+I DA  ++  E  +  ++   G L + PLY  L   +Q+++F P P     R 
Sbjct: 309 FLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRP 368
Query: 335 KRKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASXXXXXXXX 394
            RKVVISTNIAETSLT++GIVYVVD GFSKQ+ YNP   +E+L+V+PISKAS        
Sbjct: 369 GRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRA 428
Query: 395 XXXXXXKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPP 454
                 KC+RLYTEE F KE+  +  PE+ RSNL S V++LK LGID+++ FD+   P P
Sbjct: 429 GRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAP 488
Query: 455 EAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEIITISA 514
           E M+RALE L  L  LDD+  LT P G   ++ PL+PM++ M++ S E  CS+EI+TI A
Sbjct: 489 ETMMRALEELNYLACLDDEGNLT-PLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVA 547
Query: 515 VLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSH----WCHKNF 570
           +LS+ ++++     +K  D+AK  FA  +GDH+T LN+Y  F       +    WC  ++
Sbjct: 548 MLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHY 607
Query: 571 INYHAM 576
           +NY ++
Sbjct: 608 LNYRSL 613
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query584
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 0.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 2e-97
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-96
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-96
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-92
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-90
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 4e-90
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 5e-88
1yks_A440 Genome polyprotein [contains: flavivirin protease 2e-86
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 1e-60
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  829 bits (2143), Expect = 0.0
 Identities = 257/552 (46%), Positives = 366/552 (66%), Gaps = 31/552 (5%)

Query: 39  YASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYL-KEAGWADGGRV 97
           Y  I K R+ LPV+  R   L L + +   + VGETGSGKTTQIPQ++  +         
Sbjct: 83  YVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQ 142

Query: 98  IACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMM 157
           +ACTQPRR+A  +VA RVAEEM VK+GEEVGY+IRFE+ T+   T +K++TDG+LLRE M
Sbjct: 143 VACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNK-TILKYMTDGMLLREAM 201

Query: 158 DDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHA 217
           +D  L++YS I++DEAHER+++TDIL+GLLK++ + R DL++II SAT++A+    +F+ 
Sbjct: 202 EDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFN- 260

Query: 218 RKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPG 277
                           +  +L+V GR + V+++Y  E   DY+ +A+ TVL IH  E  G
Sbjct: 261 ----------------DAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAG 304

Query: 278 DILVFLTGQDDIDATIQLLTEEAR--TSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGK 335
           DIL+FLTG+D+I+  ++ ++ E      ++    L + PLY  L   +Q+++F P P   
Sbjct: 305 DILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESH 364

Query: 336 -----RKVVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQR 390
                RKVVISTNIAETSLT++GIVYVVD GFSKQ+ YNP   +E+L+V+PISKASA+QR
Sbjct: 365 NGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQR 424

Query: 391 AGRAGRVRPGKCYRLYTEEYFVKEIPAEGIPEMQRSNLVSCVIQLKALGIDNILGFDWPA 450
           AGRAGR RPGKC+RLYTEE F KE+  +  PE+ RSNL S V++LK LGID+++ FD+  
Sbjct: 425 AGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMD 484

Query: 451 SPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMILSSNELGCSEEII 510
            P PE M+RALE L  L  LDD+  LT P G   ++ PL+PM++ M++ S E  CS+EI+
Sbjct: 485 PPAPETMMRALEELNYLACLDDEGNLT-PLGRLASQFPLDPMLAVMLIGSFEFQCSQEIL 543

Query: 511 TISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSCKSSH----WC 566
           TI A+LS+ ++++     +K  D+AK  FA  +GDH+T LN+Y  F       +    WC
Sbjct: 544 TIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWC 603

Query: 567 HKNFINYHAMVR 578
             +++NY ++  
Sbjct: 604 RDHYLNYRSLSA 615
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query584
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.97
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.97
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.97
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.97
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.97
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.96
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.96
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 99.96
3h1t_A590 Type I site-specific restriction-modification syst 99.96
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.96
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.95
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.95
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.93
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.92
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.92
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.91
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.9
3jux_A822 Protein translocase subunit SECA; protein transloc 99.89
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.85
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.85
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.85
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.84
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.84
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.84
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.83
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.83
3bor_A237 Human initiation factor 4A-II; translation initiat 99.83
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.83
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.82
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.82
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.82
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.82
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.81
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.81
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.81
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.81
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.81
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.81
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.8
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.8
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.79
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.79
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.66
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.78
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.69
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.69
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.64
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.55
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.47
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.47
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.4
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.1
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.14
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.81
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.75
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.63
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.62
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.45
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.34
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.28
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.25
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.16
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.15
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.15
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.12
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.09
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.07
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.02
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.0
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.98
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.84
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 96.84
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.83
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.78
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.75
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.75
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.72
3co5_A143 Putative two-component system transcriptional RES 96.67
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.64
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.63
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 96.63
3bos_A242 Putative DNA replication factor; P-loop containing 96.62
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.59
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.43
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.43
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.42
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.42
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.41
2qgz_A308 Helicase loader, putative primosome component; str 96.41
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.4
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.35
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.31
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.3
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.29
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.26
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.25
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.22
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 96.22
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.16
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.13
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.04
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.99
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.92
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.92
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.9
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.9
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.86
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.84
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.83
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 95.78
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.77
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.7
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.68
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.6
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.59
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.57
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.49
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 95.48
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 95.34
2fna_A357 Conserved hypothetical protein; structural genomic 95.3
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.25
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.11
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.06
3pvs_A447 Replication-associated recombination protein A; ma 94.95
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.92
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.87
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.86
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.71
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.68
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.59
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.56
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 94.51
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.5
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.45
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.43
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.24
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.21
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 94.21
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.18
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.14
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.0
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.91
2xxa_A433 Signal recognition particle protein; protein trans 93.82
3io5_A333 Recombination and repair protein; storage dimer, i 93.63
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.62
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.59
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.54
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.52
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 93.51
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.44
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.36
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 93.25
2oap_1511 GSPE-2, type II secretion system protein; hexameri 93.19
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.13
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.13
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.12
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.1
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.09
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.03
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.93
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 92.91
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 92.91
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.91
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.88
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.88
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 92.77
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.76
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.67
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.62
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.59
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.54
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 92.53
1p9r_A418 General secretion pathway protein E; bacterial typ 92.51
2og2_A359 Putative signal recognition particle receptor; nuc 92.47
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.46
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.1
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 92.02
4a74_A231 DNA repair and recombination protein RADA; hydrola 91.91
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 91.87
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.86
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 91.83
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 91.81
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 91.8
3vaa_A199 Shikimate kinase, SK; structural genomics, center 91.79
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 91.68
2z43_A324 DNA repair and recombination protein RADA; archaea 91.58
4aby_A415 DNA repair protein RECN; hydrolase, double strand 91.56
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.51
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 91.5
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.48
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 91.18
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.18
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 91.11
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 91.08
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.03
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.88
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 90.76
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.75
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 90.75
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 90.75
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 90.71
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 90.7
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 90.67
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 90.54
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 90.52
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 90.39
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.36
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 90.34
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.33
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 90.3
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.27
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 90.26
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 90.14
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 90.13
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 90.06
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 89.89
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.88
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.86
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 89.85
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 89.84
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 89.79
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 89.73
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 89.73
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.72
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.71
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 89.7
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 89.67
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 89.66
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 89.58
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 89.57
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 89.52
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.52
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 89.48
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 89.47
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.44
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 89.44
1ji0_A240 ABC transporter; ATP binding protein, structural g 89.4
1g6h_A257 High-affinity branched-chain amino acid transport 89.39
2ghi_A260 Transport protein; multidrug resistance protein, M 89.37
1b0u_A262 Histidine permease; ABC transporter, transport pro 89.37
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.33
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 89.3
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 89.29
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.24
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 89.24
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 89.22
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 89.17
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 89.08
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 89.03
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 89.02
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 89.02
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 89.0
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 89.0
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 88.98
3kta_A182 Chromosome segregation protein SMC; structural mai 88.96
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 88.84
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.82
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 88.81
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 88.72
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 88.72
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 88.69
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 88.6
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 88.56
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 88.53
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 88.53
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 88.51
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 88.46
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 88.46
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 88.35
2r44_A331 Uncharacterized protein; putative ATPase, structur 88.35
3tlx_A243 Adenylate kinase 2; structural genomics, structura 88.32
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 88.3
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.28
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 88.15
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 88.07
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.04
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 87.88
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 87.87
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 87.85
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 87.85
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 87.83
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 87.82
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 87.77
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 87.76
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 87.71
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 87.7
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 87.66
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 87.63
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 87.61
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 87.61
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 87.53
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 87.48
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.46
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 87.37
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.37
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 87.28
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.2
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.14
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 87.13
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 87.11
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 87.05
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 87.04
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.04
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 86.92
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 86.89
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 86.88
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 86.87
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 86.76
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 86.73
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 86.63
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 86.63
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 86.57
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 86.53
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 86.52
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 86.44
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 86.4
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 86.38
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 86.31
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 86.19
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 86.15
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 86.14
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 86.13
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 86.13
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 86.07
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 86.05
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 85.96
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 85.91
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 85.82
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 85.8
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 85.72
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 85.7
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 85.68
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 85.64
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 85.59
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 85.59
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 85.57
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 85.43
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 85.41
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 85.15
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 85.14
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 85.1
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 85.1
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 85.08
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 84.97
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 84.95
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 84.75
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.72
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 84.7
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 84.69
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 84.65
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 84.63
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 84.61
2vli_A183 Antibiotic resistance protein; transferase, tunica 84.56
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 84.56
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 84.53
1via_A175 Shikimate kinase; structural genomics, transferase 84.52
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 84.45
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 84.35
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 84.29
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 84.26
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 84.2
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 84.16
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 84.15
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 84.07
1tue_A212 Replication protein E1; helicase, replication, E1E 83.98
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 83.67
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 83.67
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 83.62
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 83.59
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 83.55
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 83.46
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 83.4
2r62_A268 Cell division protease FTSH homolog; ATPase domain 83.26
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 82.98
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 82.98
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 82.81
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 82.74
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 82.74
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 82.62
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 82.53
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 82.15
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 82.08
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 81.98
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 81.96
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 81.89
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 81.76
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 81.67
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 81.52
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 81.48
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 81.3
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 81.18
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 81.16
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 81.15
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 81.09
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 80.93
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 80.87
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 80.34
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 80.33
3r20_A233 Cytidylate kinase; structural genomics, seattle st 80.03
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=1.7e-90  Score=777.80  Aligned_cols=537  Identities=48%  Similarity=0.789  Sum_probs=491.1

Q ss_pred             ccccCCCCCCccchhhHHHHhcCCCchHHHHHHHHHHhcCCEEEEEcCCCChHHHHHHHHHHhcCccCC-CeEEEEeCch
Q 007931           26 SSSLSSASSIGYGYASIEKQRQRLPVYKYRTAILYLVETHATTIIVGETGSGKTTQIPQYLKEAGWADG-GRVIACTQPR  104 (584)
Q Consensus        26 ~~~~~~l~~~~~~~~~l~~~~~~lP~~~~~~~il~~l~~~~~viv~a~TGsGKT~~ip~~l~~~~~~~~-~~~I~v~~~r  104 (584)
                      ..+|.++++++.+. ++.+.|..+|++.++++|+.++.++++++++||||||||+++|+++.......+ +..+++++|+
T Consensus        71 ~~~f~~~~l~~~~~-~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~  149 (773)
T 2xau_A           71 INPFTGREFTPKYV-DILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPR  149 (773)
T ss_dssp             BCTTTCSBCCHHHH-HHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESC
T ss_pred             CCCccccCCCHHHH-HHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCch
Confidence            45699999998765 455667799999999999999999999999999999999999999877654331 3445555566


Q ss_pred             HHHHHHHHHHHHHHhCCcceeEEeeEeeccCcCCCCCceEEEechHHHHHHHccCCCCCCCcEEEEeCCCcCccchhHHH
Q 007931          105 RLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKDLTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILL  184 (584)
Q Consensus       105 ~la~~~~~~~~~~~~~~~vg~~vg~~~~~~~~~~~~~~~I~~~T~~~ll~~l~~~~~l~~~~~iIiDE~Her~~~~d~l~  184 (584)
                      +.++.+++++++++++..++..+||.++++..... .++|+++|+|++++.+..+..+.++++|||||+|+|+++.+.+.
T Consensus       150 r~La~q~~~~l~~~~~~~v~~~vG~~i~~~~~~~~-~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~  228 (773)
T 2xau_A          150 RVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSN-KTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILM  228 (773)
T ss_dssp             HHHHHHHHHHHHHHTTCCBTTTEEEEETTEEECCT-TCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhCCchhheecceeccccccCC-CCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHH
Confidence            66677888899999999999999999888777666 89999999999999998888899999999999999999999999


Q ss_pred             HHHHHHHHhcCCceEEEEecccChHHHHHHhhcCCCCCCCcccccCCCCCCeEEEECCccccceEEecCCCcchHHHHHH
Q 007931          185 GLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKGRRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAV  264 (584)
Q Consensus       185 ~~l~~~~~~~~~~~vi~~SAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~  264 (584)
                      .+++.+...+++.++|+||||++.+.+.+||+..+                 ++.++++.+|++++|...+..++.+..+
T Consensus       229 ~~l~~l~~~~~~~~iIl~SAT~~~~~l~~~~~~~~-----------------vi~v~gr~~pv~~~~~~~~~~~~~~~~l  291 (773)
T 2xau_A          229 GLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAP-----------------LLAVPGRTYPVELYYTPEFQRDYLDSAI  291 (773)
T ss_dssp             HHHHHHHHHCTTCEEEEEESCSCCHHHHHHTTSCC-----------------EEECCCCCCCEEEECCSSCCSCHHHHHH
T ss_pred             HHHHHHHHhCCCceEEEEeccccHHHHHHHhcCCC-----------------cccccCcccceEEEEecCCchhHHHHHH
Confidence            99999988888999999999999999999998766                 8899999999999999988888988888


Q ss_pred             HHHHHHHhcCCCCCEEEEeCcHHHHHHHHHHHHHHhhhc--cCCCCCeEEEEecCCCCHHHHhcccCCCC-----CCCcE
Q 007931          265 STVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTS--KKNSSGLIILPLYSGLSRAEQEQVFSPTP-----RGKRK  337 (584)
Q Consensus       265 ~~i~~~~~~~~~~~iLVF~~~~~~i~~l~~~L~~~~~~~--~~~~~~~~v~~lh~~l~~~~r~~i~~~~~-----~g~~~  337 (584)
                      ..+..++....++++||||+++++++.+++.|.+....+  .....++.+.++||+|++++|.++++.|+     +|.++
T Consensus       292 ~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~k  371 (773)
T 2xau_A          292 RTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRK  371 (773)
T ss_dssp             HHHHHHHHHSCSCEEEEECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEE
T ss_pred             HHHHHHHHhcCCCCEEEECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceE
Confidence            888888887788999999999999999999998744322  11234789999999999999999999999     99999


Q ss_pred             EEEeCCCCccccccCCeEEEEecCCccceeecCCCCcccceeeeccHHhHHHhccccCCCCCcEEEEccChHHHhhhCCC
Q 007931          338 VVISTNIAETSLTLEGIVYVVDSGFSKQRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLYTEEYFVKEIPA  417 (584)
Q Consensus       338 vlvaT~i~e~Gidip~v~~VId~g~~k~~~~d~~~~~~~l~~~~~s~~~~~QR~GRaGR~~~G~~~~l~~~~~~~~~~~~  417 (584)
                      ||||||++|+|||||+|++|||+|+.|.+.||+..+++.|.+.|+|.++|.||+|||||.++|.||+||++.++...+.+
T Consensus       372 VlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~  451 (773)
T 2xau_A          372 VVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIE  451 (773)
T ss_dssp             EEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCS
T ss_pred             EEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999655999


Q ss_pred             CCCCcccccchhHHHHHHHhcCCCCccCCCCCCCCCHHHHHHHHHHHHHcCCccCCCCCCHHHHHHhccCCCChhhhHHH
Q 007931          418 EGIPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSPTGFQVAEIPLEPMISKMI  497 (584)
Q Consensus       418 ~~~pei~r~~l~~~~L~l~~~~~~~~~~~~~~~~p~~~~~~~al~~L~~~g~i~~~~~lT~~lG~~~~~~pl~p~~~~~l  497 (584)
                      +..|||++.+|.+++|+++.+|++++..|+|++||+.+.+..|++.|..+|+||++|++| ++|+.|+++|++|++||||
T Consensus       452 ~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~lT-~lG~~~a~~pl~p~~~~~l  530 (773)
T 2xau_A          452 QSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLT-PLGRLASQFPLDPMLAVML  530 (773)
T ss_dssp             SCCCGGGGSCCHHHHHHHHHTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCBC-HHHHHHTTSSSCHHHHHHH
T ss_pred             cCCCccccCcHHHHHHHHHHcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCcC-hhhhhhccccCCHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999 7999999999999999999


Q ss_pred             HhhcccCChHHHHHHHHhhccCcccccCcccHHHHHHHHhhccCCCCCHHHHHHHHHHHHHcC---Cc-HHHHHHhCCCH
Q 007931          498 LSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRFAAAEGDHVTFLNIYKGFLQSC---KS-SHWCHKNFINY  573 (584)
Q Consensus       498 ~~~~~~~c~~~~l~i~a~l~~~~~f~~~~~~~~~~~~~~~~~~~~~~D~~~~l~~~~~~~~~~---~~-~~~c~~~~l~~  573 (584)
                      +.|..++|.+++++|+|+|+++++|..|.+.+++++.++.+|....|||++++|+|++|.+..   .. .+||++||||+
T Consensus       531 ~~~~~~~c~~~~l~i~a~ls~~~~f~~~~~~~~~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~~~l~~  610 (773)
T 2xau_A          531 IGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNY  610 (773)
T ss_dssp             HHGGGGTCHHHHHHHHHHHTSCCCBCCCTTCHHHHHHHHHTTCCTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHHTTBCH
T ss_pred             HhhcccCchhHHHHHHHhcccCCcccCChHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHhccccchHHHHHHHhCCCH
Confidence            999999999999999999999999999999999999999999998999999999999997654   44 78999999999


Q ss_pred             HHHHHHHHh
Q 007931          574 HAMVRNLIW  582 (584)
Q Consensus       574 ~~~~~a~~~  582 (584)
                      ++|++|.+.
T Consensus       611 ~~l~~~~~~  619 (773)
T 2xau_A          611 RSLSAADNI  619 (773)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            999998653
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 584
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-47
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-47
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 5e-28
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 4e-15
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-06
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 8e-04
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  166 bits (421), Expect = 1e-47
 Identities = 53/339 (15%), Positives = 92/339 (27%), Gaps = 55/339 (16%)

Query: 246 NVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEARTSKK 305
           N +I  V+  +           +L            FL      +     L +       
Sbjct: 10  NGEIEDVQTDIPSEPWNTGHDWIL----ADKRPTAWFLPSIRAANVMAASLRK------- 58

Query: 306 NSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFS-K 364
             +G  ++ L       E   +       K   +++T+IAE    L  +  V+D   + K
Sbjct: 59  --AGKSVVVLNRKTFEREYPTIKQK----KPDFILATDIAEMGANL-CVERVLDCRTAFK 111

Query: 365 QRFYNPISDIENLVVAPISKASARQRAGRAGRVRPGKCYRLY-----TEEYFVKEIPAEG 419
               +    +       IS +SA QR GR GR  P +    Y     T E     +    
Sbjct: 112 PVLVDEGRKVAIKGPLRISASSAAQRRGRIGR-NPNRDGDSYYYSEPTSENNAHHVCWL- 169

Query: 420 IPEMQRSNLVSCVIQLKALGIDNILGFDWPASPPPEAMIRALEVLYSLGVLDDDAKLTSP 479
              M   N+    ++   +     +        P E  +R  +      ++  +  L   
Sbjct: 170 EASMLLDNM---EVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELV-RNCDLPVW 225

Query: 480 TGFQVAEIPLEPMISKMILSSNELGCSEEIITISAVLSIQSIWVSGRGAQKELDEAKLRF 539
             +QVA+  L+    K      E    E  I                          ++ 
Sbjct: 226 LSWQVAKAGLKTNDRKWCFEGPE----EHEIL-------------------NDSGETVKC 262

Query: 540 AAAEGDHVTFLNIYKGFLQSCKSSHWCHKNFINYHAMVR 578
            A  G        +        S       FI +    R
Sbjct: 263 RAPGGAKKPLRPRWCDE--RVSSDQSALSEFIKFAEGRR 299
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query584
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.96
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.87
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.87
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.86
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.86
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.86
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.86
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.86
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.85
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.85
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.85
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.85
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.84
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.84
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.83
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.83
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.83
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.8
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.8
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.79
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.78
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.76
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.74
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.72
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.72
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.71
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.66
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.65
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.64
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.61
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.57
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.47
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.45
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.41
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.39
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.35
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.31
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.85
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.75
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.74
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.28
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.16
d1vmaa2213 GTPase domain of the signal recognition particle r 98.12
d1okkd2207 GTPase domain of the signal recognition particle r 98.12
d2qy9a2211 GTPase domain of the signal recognition particle r 98.11
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.01
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.85
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.8
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.78
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.71
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.63
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.16
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.92
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.8
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.78
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.72
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.54
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 96.38
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.36
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.34
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.27
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.23
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.89
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.79
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.77
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.49
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.37
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.33
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.32
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.14
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.09
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.97
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.93
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.74
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.5
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 94.41
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.2
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 94.13
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 94.12
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.08
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.97
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.59
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.59
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.56
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.55
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.46
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.45
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.38
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.07
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.97
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.96
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.91
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.67
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.66
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.56
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.18
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.07
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.04
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.91
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.9
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.83
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.81
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.68
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.41
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.4
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.38
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.24
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 91.23
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 91.21
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.16
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.11
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.11
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.97
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 90.91
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.9
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.81
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.76
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.68
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.68
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.65
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.6
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.59
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 90.58
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.56
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 90.53
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 90.46
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.46
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.37
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.37
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.32
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.32
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.27
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.18
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.14
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.97
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.97
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.9
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 89.9
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.86
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.82
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.64
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 89.6
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.51
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.49
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 89.32
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.25
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 88.64
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 88.59
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 88.28
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.08
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 88.03
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.73
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 87.6
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 87.42
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 87.42
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 87.28
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.12
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 87.09
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.97
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 86.82
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.59
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.09
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 86.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 85.88
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.84
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 85.78
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 85.75
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.69
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 85.29
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.69
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 84.63
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 84.2
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 83.61
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 83.3
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 82.9
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.83
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 82.66
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.57
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 82.57
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.39
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 82.17
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 82.13
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 82.13
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 81.91
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 81.57
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.38
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 81.32
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 81.21
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 80.98
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 80.96
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 80.94
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.33
d1svma_362 Papillomavirus large T antigen helicase domain {Si 80.28
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=100.00  E-value=2e-35  Score=296.16  Aligned_cols=294  Identities=16%  Similarity=0.166  Sum_probs=201.0

Q ss_pred             HHhcCCEEEEEcCCCChHHHHHHHHHHhcCccCCCeEEEEeCchHHHHHHHHHHHHHHhCCcceeEEeeEeeccCcCCCC
Q 007931           61 LVETHATTIIVGETGSGKTTQIPQYLKEAGWADGGRVIACTQPRRLAVQAVASRVAEEMGVKVGEEVGYTIRFEDFTNKD  140 (584)
Q Consensus        61 ~l~~~~~viv~a~TGsGKT~~ip~~l~~~~~~~~~~~I~v~~~r~la~~~~~~~~~~~~~~~vg~~vg~~~~~~~~~~~~  140 (584)
                      +++++++++|.||||||||+.+...+.......+.++++++|+|+|+.| +++++.+. +...   .+..  .+..... 
T Consensus         5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q-~~~~l~~~-~~~~---~~~~--~~~~~~~-   76 (305)
T d2bmfa2           5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAE-MEEALRGL-PIRY---QTPA--IRAEHTG-   76 (305)
T ss_dssp             SSSTTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHH-HHHHTTTS-CCBC---CC----------C-
T ss_pred             HhhcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHH-HHHHHhcC-Ccce---eeeE--EeecccC-
Confidence            4568999999999999999543323333333456678999999998765 55544322 1111   1111  1122223 


Q ss_pred             CceEEEechHHHHHHHccCCCCCCCcEEEEeCCCcCccchhHHHHHHHHHHHhcCCceEEEEecccChHHHHHHhhcCCC
Q 007931          141 LTAIKFLTDGVLLREMMDDPLLTKYSVIMVDEAHERSISTDILLGLLKKIQRCRSDLRLIISSATIEAKSMSAFFHARKG  220 (584)
Q Consensus       141 ~~~I~~~T~~~ll~~l~~~~~l~~~~~iIiDE~Her~~~~d~l~~~l~~~~~~~~~~~vi~~SAT~~~~~~~~~~~~~~~  220 (584)
                      .+.++++|++.+...+..+..+.++++||+||+|....+......+++.+. .+++.+++++|||++....       ..
T Consensus        77 ~~~i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~~-------~~  148 (305)
T d2bmfa2          77 REIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSRD-------PF  148 (305)
T ss_dssp             CCSEEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCCC-------SS
T ss_pred             ccccccCCcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCccee-------ee
Confidence            688999999999988888777999999999999976655555566665543 3467899999999843210       00


Q ss_pred             CCCCcccccCCCCCCeEEEECCccccceEEecCCCcchHHHHHHHHHHHHHhcCCCCCEEEEeCcHHHHHHHHHHHHHHh
Q 007931          221 RRGLEGVELVPRLEPAILSVEGRGFNVQIHYVEEPVSDYVQAAVSTVLLIHDKEPPGDILVFLTGQDDIDATIQLLTEEA  300 (584)
Q Consensus       221 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~iLVF~~~~~~i~~l~~~L~~~~  300 (584)
                                .....++...... .+      .........         .....++++||||+++++++.+++.|.+. 
T Consensus       149 ----------~~~~~~~~~~~~~-~~------~~~~~~~~~---------~~~~~~~~~lvf~~~~~~~~~l~~~L~~~-  201 (305)
T d2bmfa2         149 ----------PQSNAPIMDEERE-IP------ERSWNSGHE---------WVTDFKGKTVWFVPSIKAGNDIAACLRKN-  201 (305)
T ss_dssp             ----------CCCSSCEEEEECC-CC------CSCCSSCCH---------HHHSSCSCEEEECSCHHHHHHHHHHHHHH-
T ss_pred             ----------cccCCcceEEEEe-cc------HHHHHHHHH---------HHHhhCCCEEEEeccHHHHHHHHHHHHhC-
Confidence                      0000111111110 00      000000000         01235688999999999999999999887 


Q ss_pred             hhccCCCCCeEEEEecCCCCHHHHhcccCCCCCCCcEEEEeCCCCccccccCCeEEEEecCCccc--eeecCCCCcccce
Q 007931          301 RTSKKNSSGLIILPLYSGLSRAEQEQVFSPTPRGKRKVVISTNIAETSLTLEGIVYVVDSGFSKQ--RFYNPISDIENLV  378 (584)
Q Consensus       301 ~~~~~~~~~~~v~~lh~~l~~~~r~~i~~~~~~g~~~vlvaT~i~e~Gidip~v~~VId~g~~k~--~~~d~~~~~~~l~  378 (584)
                              ++.+..+||+++.+++.    .+++|.++++|||+++++|+|+ ++++|||+|....  ..||+..+...+.
T Consensus       202 --------~~~~~~l~~~~~~~~~~----~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~~~~~~~~  268 (305)
T d2bmfa2         202 --------GKKVIQLSRKTFDSEYI----KTRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGEERVILAG  268 (305)
T ss_dssp             --------TCCCEECCTTCHHHHGG----GGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSSCEEEEEE
T ss_pred             --------CCCEEEeCCcChHHHHh----hhhccchhhhhhhHHHHhcCCC-CccEEEEcCCceeeeEecCCCCceEEec
Confidence                    67789999999776654    3567899999999999999999 5889999997654  3588888888888


Q ss_pred             eeeccHHhHHHhccccCCCCC-cEEEEccChHH
Q 007931          379 VAPISKASARQRAGRAGRVRP-GKCYRLYTEEY  410 (584)
Q Consensus       379 ~~~~s~~~~~QR~GRaGR~~~-G~~~~l~~~~~  410 (584)
                      ..|+|.++|.||+|||||... |....+|..+.
T Consensus       269 ~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~~  301 (305)
T d2bmfa2         269 PMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEP  301 (305)
T ss_dssp             EEECCHHHHHHHHTTSSCSSSCCCEEEEECSCC
T ss_pred             cccCCHHHHhhhhcCcCcCCCCceEEEEECCCC
Confidence            899999999999999999954 44556666543
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure