Citrus Sinensis ID: 008025


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580
MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVFM
ccccccHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccccccccccHHHHcccccccccHHHHHHHHHcccEEHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccHHHHcHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHc
cccccccHEEEEEEcHHHHHHHHHHHHHHHcHHHHHHHEHHHHccHHccccccccccccccEEEEEcccccccccccccHHHHHHccccccccHHHHHHHHHcccEEEEEccccHHccccccEEcccEEccccccccEccccccHHHHHHHHcccccEEEEEEcccccHHHHHHHccEEEEccccccccccEccccccccEEEEEEccHHHHHHHHHHHHcccccccccccHcccccccccEEcccHHHHHccccHHHHHHHHHHHHHHHHcccHEEEEccEEEEEccHHHHHHHHHHcccEccccccHHHHHHHHHHcHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccHHHHHHHccEEEHccccccEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcHHccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc
MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEklqllpppqplppkaphpltglsfavsdlfdiegyvtgfghpewarthsaasrTSTVVSTLVEGGATCIGKTVVDEFAYsingtnkhydtptnpaapsqmpggsssgAAVAVAADLVDfslgidtvggvrvpsafcgilgfrpsygavshmgiipistsldtvgwfardpkilRHVGHVLLqlpfaaqrsprqiiIADDCFellkipadRVVQVVIKSTEKlfgrqvlkhenlgeyfdskvpslkgfhktnGELKNVMRLIQRYEFknnhnewiesvkpaldpdisAEIGEMLEISETVIENCKSIRNEMRSAISSLlkddgilvtpttaypppklggkemlsEDYQNRAFSLLSIASVSgccqvtvplgyydkcptsvSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLngnnatyySNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLeptnkraslSADRLRKVFM
MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLpfaaqrspRQIIIADDCFELLKIPADRVVQVVIKSTeklfgrqvlkhenlgeyfdskvpslkgfhktngELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSllkddgilvtPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEkgnqaykdKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTkainldkknvkayLRRGTAREMLGYYKEAIEDFSYALvleptnkraslsadrlrkvfm
MASQSANlwvllglglagillMTKKLKKNIKQDFGAFIEklqllpppqplppkaphplTGLSFAVSDLFDIEGYVTGFGHPEWarthsaasrtstvvstLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPggsssgaavavaaDLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVFM
******NLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLL*************LTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTN***********************AVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAY************EDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASL*********************************YKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLE******************
*****AN**VLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQL**************LTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQE*******************************YKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPT*K******DRLRKVFM
MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWA*************STLVEGGATCIGKTVVDEFAYSINGTNKHYDTPT****************AVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVFM
****SANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSS**A****ADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIAT***************EIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLR**F*
iiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVFM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query580 2.2.26 [Sep-21-2011]
Q9MUK5593 Translocon at the outer m N/A no 0.998 0.976 0.706 0.0
Q9LVH5589 Outer envelope protein 64 yes no 0.994 0.979 0.727 0.0
F4KCL7603 Outer envelope protein 64 no no 0.982 0.945 0.538 1e-180
Q9FR37425 Amidase 1 OS=Arabidopsis no no 0.7 0.955 0.517 1e-119
Q8PXJ1476 Glutamyl-tRNA(Gln) amidot yes no 0.643 0.783 0.255 1e-23
Q8THJ1476 Glutamyl-tRNA(Gln) amidot yes no 0.643 0.783 0.262 1e-23
Q5X4H5483 Glutamyl-tRNA(Gln) amidot yes no 0.618 0.743 0.266 2e-23
P47345477 Glutamyl-tRNA(Gln) amidot yes no 0.301 0.366 0.349 3e-23
Q5WVW0483 Glutamyl-tRNA(Gln) amidot yes no 0.618 0.743 0.268 3e-23
A5ICP2483 Glutamyl-tRNA(Gln) amidot yes no 0.618 0.743 0.268 4e-23
>sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 Back     alignment and function desciption
 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/589 (70%), Positives = 491/589 (83%), Gaps = 10/589 (1%)

Query: 1   MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG 60
           MAS S+ +WV+LGLGLAGI ++T+KL + +K+DFGAF+ KL+LLPPP P PPKAPHPL+ 
Sbjct: 4   MASPSSQIWVILGLGLAGIYVLTRKLTQAVKEDFGAFLLKLKLLPPPPPAPPKAPHPLSS 63

Query: 61  LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI 120
           L+FA+SD+FDIEG+V+ FGHPEWARTH  AS T++ VS LVE GATCIG TVVDE AY I
Sbjct: 64  LNFAISDIFDIEGHVSTFGHPEWARTHEPASSTASAVSALVESGATCIGTTVVDELAYGI 123

Query: 121 NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF 180
           +G NKH+ TPTNPA P+++PGGSSSGAAVAVAA+ VDFSLG+DT GGVRVP+ FCGILGF
Sbjct: 124 SGENKHFGTPTNPAVPNRVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGILGF 183

Query: 181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
           RPS+GAVSH+GIIP+STSLDTVGWFA+DP +LR VGH+LLQ PF  QR+PRQIIIADDCF
Sbjct: 184 RPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGHILLQAPFVMQRNPRQIIIADDCF 243

Query: 241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKG--FHKTNGELK---- 294
           + L +P DR  QVVIK+TEKLFG+QVLKH N  +Y  SKV SLK     K+NG LK    
Sbjct: 244 QHLNVPLDRTSQVVIKATEKLFGKQVLKHINFEDYISSKVSSLKACSIQKSNGVLKSSSL 303

Query: 295 ----NVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
               NVM+ +QR+EF++ H+EW+  VKP L P +SA++ E  E+SE  IEN KS+R+E+R
Sbjct: 304 KLLANVMQSLQRHEFEHTHSEWMSIVKPDLHPAVSAQLHEKFEVSELEIENSKSVRSELR 363

Query: 351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
            A++SLLKD+G+LV PT A PPPKLGGKE LS DYQ+RA SLLSIAS+SGCCQVTVPLG+
Sbjct: 364 VAVNSLLKDEGVLVIPTVADPPPKLGGKEFLSHDYQSRALSLLSIASISGCCQVTVPLGF 423

Query: 411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
           +DK P SVS IARHGGDRFLLDT++ MY  LQEQADIA  SK S +  +++QSAEI+KEK
Sbjct: 424 FDKNPVSVSLIARHGGDRFLLDTLKTMYTVLQEQADIAAPSKSSKSVVSKEQSAEISKEK 483

Query: 471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
           GNQAYKDKQW KAI FYTEAIKL GNNATYYSNRA AYLE GS+LQAE DCT AI+ DKK
Sbjct: 484 GNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKK 543

Query: 531 NVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVF 579
           NVKAY RRGTAREMLGYYKEAI+DF YALVLEPTNKRA+ SA+RLRK+F
Sbjct: 544 NVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF 592




Chaperone receptor mediating Hsp90-dependent protein targeting to chloroplasts. Bi-functional preprotein receptor acting on both sides of the membrane.
Pisum sativum (taxid: 3888)
>sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 Back     alignment and function description
>sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 Back     alignment and function description
>sp|Q9FR37|AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana GN=AMI1 PE=1 SV=1 Back     alignment and function description
>sp|Q8PXJ1|GATA_METMA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatA PE=3 SV=1 Back     alignment and function description
>sp|Q8THJ1|GATA_METAC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatA PE=3 SV=1 Back     alignment and function description
>sp|Q5X4H5|GATA_LEGPA Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Paris) GN=gatA PE=3 SV=1 Back     alignment and function description
>sp|P47345|GATA_MYCGE Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gatA PE=3 SV=1 Back     alignment and function description
>sp|Q5WVW0|GATA_LEGPL Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Lens) GN=gatA PE=3 SV=1 Back     alignment and function description
>sp|A5ICP2|GATA_LEGPC Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Legionella pneumophila (strain Corby) GN=gatA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query580
225456155590 PREDICTED: translocon at the outer membr 0.998 0.981 0.789 0.0
255579275589 amidase, putative [Ricinus communis] gi| 0.996 0.981 0.767 0.0
224135565592 amidase family protein [Populus trichoca 0.996 0.976 0.758 0.0
224118646593 amidase family protein [Populus trichoca 0.996 0.974 0.759 0.0
449497473591 PREDICTED: translocon at the outer membr 0.998 0.979 0.747 0.0
357521651594 Glutamyl-tRNA(Gln) amidotransferase subu 0.996 0.973 0.724 0.0
449439139585 PREDICTED: LOW QUALITY PROTEIN: transloc 0.987 0.979 0.736 0.0
356512970587 PREDICTED: glutamyl-tRNA(Gln) amidotrans 0.962 0.950 0.707 0.0
356524688591 PREDICTED: glutamyl-tRNA(Gln) amidotrans 0.962 0.944 0.727 0.0
75336680593 RecName: Full=Translocon at the outer me 0.998 0.976 0.706 0.0
>gi|225456155|ref|XP_002282402.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 [Vitis vinifera] gi|297734325|emb|CBI15572.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/589 (78%), Positives = 521/589 (88%), Gaps = 10/589 (1%)

Query: 1   MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG 60
           MAS SANLWVLLGLGLAG+LLMT+KLKK I++DFGAF+++LQLLPPPQP PPKAPHPLT 
Sbjct: 1   MASSSANLWVLLGLGLAGVLLMTRKLKKTIREDFGAFVQRLQLLPPPQPAPPKAPHPLTN 60

Query: 61  LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI 120
           LSFAVSD+FDIEGYVTGFG+P+WARTH  ASRTS VVS LVEGGATC GKTVVDE AYSI
Sbjct: 61  LSFAVSDVFDIEGYVTGFGNPDWARTHDTASRTSPVVSALVEGGATCTGKTVVDEMAYSI 120

Query: 121 NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF 180
           NG NKHY TPTNPAAPS++PGGSSSGAAVAVAA+ VDFSLG+DTVGGVRVP+AFCG++GF
Sbjct: 121 NGENKHYGTPTNPAAPSRIPGGSSSGAAVAVAANFVDFSLGLDTVGGVRVPAAFCGVIGF 180

Query: 181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
           RPS+GAVSHMGII +S+SLDTVGWFA+DP ILR VGHVLLQL +A QRSPRQII ADDCF
Sbjct: 181 RPSHGAVSHMGIIHVSSSLDTVGWFAKDPSILRRVGHVLLQLTYAVQRSPRQIIFADDCF 240

Query: 241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFH--KTNGELKN--- 295
           + L+IP DRV QVV+KSTEKLFGRQVLK ENL  Y DSKVPSLK FH  KTNGE +N   
Sbjct: 241 QSLRIPVDRVYQVVLKSTEKLFGRQVLKRENLENYLDSKVPSLKAFHSQKTNGETRNSLI 300

Query: 296 -----VMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
                +M  +QR+EFK+NH EWI SVKP LD  IS+++ ++LE+++T IENC+S R E+R
Sbjct: 301 RSLVKIMHCLQRHEFKHNHEEWINSVKPILDASISSQLHDVLEVADTEIENCQSSRMEIR 360

Query: 351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
           SA++SLLKDDGILV PT A PPPKLGGKE LSE+YQNR   LLSIAS+SGCCQVTVPLG 
Sbjct: 361 SALNSLLKDDGILVIPTVADPPPKLGGKESLSEEYQNRTLGLLSIASMSGCCQVTVPLGL 420

Query: 411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
           YDK P SVSF+ARHGGDRFLLDTVQ MYASLQEQADIA KSKLS+N  +++ SAEIAKEK
Sbjct: 421 YDKYPVSVSFMARHGGDRFLLDTVQTMYASLQEQADIAAKSKLSSNAVDRETSAEIAKEK 480

Query: 471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
           GNQA+KDKQW KA+ FYTEAIKL+GNNATYYSNRAAAYLE GSFLQAEADCT+AINLDKK
Sbjct: 481 GNQAFKDKQWQKAVGFYTEAIKLSGNNATYYSNRAAAYLEMGSFLQAEADCTEAINLDKK 540

Query: 531 NVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKVF 579
           NVKAYLRRGTAREMLGYYK+AIEDF YALVLEPTNKRASLSADRL+K+F
Sbjct: 541 NVKAYLRRGTAREMLGYYKDAIEDFRYALVLEPTNKRASLSADRLKKLF 589




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255579275|ref|XP_002530483.1| amidase, putative [Ricinus communis] gi|223529980|gb|EEF31906.1| amidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224135565|ref|XP_002322105.1| amidase family protein [Populus trichocarpa] gi|222869101|gb|EEF06232.1| amidase family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118646|ref|XP_002317872.1| amidase family protein [Populus trichocarpa] gi|222858545|gb|EEE96092.1| amidase family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449497473|ref|XP_004160411.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357521651|ref|XP_003631114.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] gi|355525136|gb|AET05590.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] Back     alignment and taxonomy information
>gi|449439139|ref|XP_004137345.1| PREDICTED: LOW QUALITY PROTEIN: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356512970|ref|XP_003525187.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] Back     alignment and taxonomy information
>gi|356524688|ref|XP_003530960.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] Back     alignment and taxonomy information
>gi|75336680|sp|Q9MUK5.1|TOC64_PEA RecName: Full=Translocon at the outer membrane of chloroplasts 64 gi|7453538|gb|AAF62870.1|AF179282_1 Toc64 [Pisum sativum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query580
TAIR|locus:2088600589 TOC64-III "translocon at the o 0.994 0.979 0.640 1e-196
UNIPROTKB|Q9MUK5593 TOC64 "Translocon at the outer 0.998 0.976 0.624 1.3e-194
TAIR|locus:2184757603 TOC64-V "AT5G09420" [Arabidops 0.955 0.918 0.497 3.7e-142
TAIR|locus:2036029425 AMI1 "AT1G08980" [Arabidopsis 0.696 0.950 0.465 6.8e-95
UNIPROTKB|Q60AB7341 MCA0950 "Amidase family protei 0.565 0.961 0.311 2.4e-37
ZFIN|ZDB-GENE-050327-75 481 zgc:110801 "zgc:110801" [Danio 0.2 0.241 0.413 2.4e-17
TIGR_CMR|DET_1335486 DET_1335 "glutamyl-tRNA(Gln) a 0.187 0.224 0.376 9.8e-17
MGI|MGI:1277218 660 Rpap3 "RNA polymerase II assoc 0.237 0.209 0.410 1.5e-16
TIGR_CMR|CHY_1102485 CHY_1102 "glutamyl-tRNA(Gln) a 0.318 0.381 0.310 2.6e-16
UNIPROTKB|Q936X3457 atzE "Biuret hydrolase" [Pseud 0.246 0.312 0.326 4e-16
TAIR|locus:2088600 TOC64-III "translocon at the outer membrane of chloroplasts 64-III" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1905 (675.7 bits), Expect = 1.0e-196, P = 1.0e-196
 Identities = 376/587 (64%), Positives = 439/587 (74%)

Query:     1 MASQSANXXXXXXXXXXXXXXMTKKLKKNIKQDFGAFIEXXXXXXXXXXXXXXXXXXXTG 60
             MASQ+AN              +TKKLKK +++DFGAFI+                   TG
Sbjct:     1 MASQAANLWVLLGLGLAGILMLTKKLKKTVREDFGAFIDKLMLLPPPQPAPPKAPHPLTG 60

Query:    61 LSFAVSDLFDIEGYVTGFGHPEWXXXXXXXXXXXXXXXXLVEGGATCIGKTVVDEFAYSI 120
             L+FAVSD+FDI GYVTGFGHP+W                LVEGGATC+GKTVVDEFA+SI
Sbjct:    61 LTFAVSDVFDITGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDEFAFSI 120

Query:   121 NGTNKHYDTPTNPAAPSQMPXXXXXXXXXXXXXDLVDFSLGIDTVGGVRVPSAFCGILGF 180
             +G NKHYD+PTNPAAP+++P             + VDF+LGIDTVGGVRVP+ +CG+LGF
Sbjct:   121 SGENKHYDSPTNPAAPTRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF 180

Query:   181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
             + SYGA+S+ GIIP+S+SLD+VGWFARDP  LR VGHVLLQLPFA QR+PRQII+ADDCF
Sbjct:   181 KSSYGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIILADDCF 240

Query:   241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKT----NGE---- 292
             +LLKIP DR+ QVV KS EKLFGRQ+LKH+NL  YF++KVPSLK F +T    N +    
Sbjct:   241 QLLKIPVDRITQVVTKSAEKLFGRQLLKHQNLETYFETKVPSLKEFARTKAIANTKVSTS 300

Query:   293 --LKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
               L NVM+L+QR+EF  NH +WI +VKPA+DP I +++ E  E++    EN  +IRNE R
Sbjct:   301 RLLANVMQLLQRHEFLQNHGDWINTVKPAIDPVILSQVCENPELTNEETENLNAIRNETR 360

Query:   351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
              AI SLLKDDGILV PT    PPKLG KE+ SEDYQNRA SLLSIAS+SGCCQVTVPLG+
Sbjct:   361 VAIGSLLKDDGILVIPTLPAVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGH 420

Query:   411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
             ++KCP SVSFI RHGGDRFLLDTVQ MY SLQE + I T  K S     +++SAEIAKEK
Sbjct:   421 HEKCPISVSFIGRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEK 480

Query:   471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
             GNQA+K+K W KAI  Y+EAIKL+ NNATYYSNRAAAYLE G FLQAE DCTKAI LDKK
Sbjct:   481 GNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKK 540

Query:   531 NVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRK 577
             NVKAYLRRGTAREMLG  K AIEDF YALVLEP NKRASLSA+RLRK
Sbjct:   541 NVKAYLRRGTAREMLGDCKGAIEDFRYALVLEPNNKRASLSAERLRK 587




GO:0016884 "carbon-nitrogen ligase activity, with glutamine as amido-N-donor" evidence=IEA
GO:0031359 "integral to chloroplast outer membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0009536 "plastid" evidence=IDA
UNIPROTKB|Q9MUK5 TOC64 "Translocon at the outer membrane of chloroplasts 64" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
TAIR|locus:2184757 TOC64-V "AT5G09420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036029 AMI1 "AT1G08980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q60AB7 MCA0950 "Amidase family protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050327-75 zgc:110801 "zgc:110801" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1335 DET_1335 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
MGI|MGI:1277218 Rpap3 "RNA polymerase II associated protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1102 CHY_1102 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q936X3 atzE "Biuret hydrolase" [Pseudomonas sp. ADP (taxid:47660)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LVH5OE64C_ARATHNo assigned EC number0.72740.99480.9796yesno
Q9MUK5TOC64_PEANo assigned EC number0.70620.99820.9763N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
PLN02722422 PLN02722, PLN02722, indole-3-acetamide amidohydrol 0.0
PRK08310395 PRK08310, PRK08310, amidase; Provisional 1e-121
COG0154475 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransf 3e-63
pfam01425431 pfam01425, Amidase, Amidase 3e-54
PRK09201465 PRK09201, PRK09201, amidase; Provisional 1e-42
TIGR00132460 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) a 3e-42
PRK07056454 PRK07056, PRK07056, amidase; Provisional 4e-41
PRK06102452 PRK06102, PRK06102, hypothetical protein; Provisio 1e-40
TIGR02715452 TIGR02715, amido_AtzE, amidohydrolase, AtzE family 9e-40
PRK00012459 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransf 3e-38
PRK08186600 PRK08186, PRK08186, allophanate hydrolase; Provisi 2e-37
TIGR02713561 TIGR02713, allophanate_hyd, allophanate hydrolase 7e-37
PRK05962424 PRK05962, PRK05962, amidase; Validated 1e-32
PRK07488472 PRK07488, PRK07488, indole acetimide hydrolase; Va 7e-32
PRK07139439 PRK07139, PRK07139, amidase; Provisional 3e-27
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-24
PRK07235502 PRK07235, PRK07235, amidase; Provisional 6e-24
PRK12470462 PRK12470, PRK12470, amidase; Provisional 6e-23
PRK06170490 PRK06170, PRK06170, amidase; Provisional 8e-22
PRK07486484 PRK07486, PRK07486, amidase; Provisional 5e-21
PRK06169466 PRK06169, PRK06169, putative amidase; Provisional 6e-21
PRK08137497 PRK08137, PRK08137, amidase; Provisional 3e-19
PRK06707536 PRK06707, PRK06707, amidase; Provisional 1e-18
PRK06828491 PRK06828, PRK06828, amidase; Provisional 1e-17
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-17
PRK06061483 PRK06061, PRK06061, amidase; Provisional 8e-17
PRK07487469 PRK07487, PRK07487, amidase; Provisional 2e-15
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-15
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 4e-14
PRK11910615 PRK11910, PRK11910, amidase; Provisional 6e-14
PRK07042464 PRK07042, PRK07042, amidase; Provisional 1e-13
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-12
PRK07869468 PRK07869, PRK07869, amidase; Provisional 1e-12
PRK06529482 PRK06529, PRK06529, amidase; Provisional 4e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-10
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-09
PRK06565566 PRK06565, PRK06565, amidase; Validated 8e-09
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-08
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-07
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 8e-05
PRK05962424 PRK05962, PRK05962, amidase; Validated 2e-04
COG0457 291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 6e-04
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
COG2956 389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 0.001
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.001
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.002
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.003
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.004
>gnl|CDD|166363 PLN02722, PLN02722, indole-3-acetamide amidohydrolase Back     alignment and domain information
 Score =  537 bits (1386), Expect = 0.0
 Identities = 239/421 (56%), Positives = 303/421 (71%), Gaps = 16/421 (3%)

Query: 33  DFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASR 92
           D+GAF+EK  L     P       PL GL+FAV D+FD+EGYVTGFG+P+WARTHSAA+ 
Sbjct: 6   DYGAFMEKFVL----SPTSSSHDLPLHGLTFAVKDIFDVEGYVTGFGNPDWARTHSAATS 61

Query: 93  TSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVA 152
           T+  V  ++ GGATC+GKT++DE AYSING N HY TPTNP AP ++PGGSSSG+AVAV 
Sbjct: 62  TAPAVLAVLRGGATCVGKTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVG 121

Query: 153 ADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKIL 212
           A LVDFSLG DT G VRVP+++CGI GFRPS+GAVS +G+IP++ S DTVGWFARDP IL
Sbjct: 122 AKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTVGVIPMAQSFDTVGWFARDPVIL 181

Query: 213 RHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGR-QVLKHEN 271
           + VGHVLLQ P      P QIIIA+DCF+L  IP DR+VQV++KS EKLFG   ++KH N
Sbjct: 182 KRVGHVLLQQPDVNPIKPSQIIIAEDCFQLSSIPHDRLVQVLVKSVEKLFGGGDIVKHVN 241

Query: 272 LGEYFDSKVPSLKGF-HKTNGE----------LKNVMRLIQRYEFKNNHNEWIESVKPAL 320
           LG+Y + KVPSLK F  K   E          L + MRL+QRYEFK NH EWI +VKP  
Sbjct: 242 LGDYVEDKVPSLKHFMSKEIKEQEYNIPSLAALSSAMRLLQRYEFKINHGEWITAVKPEF 301

Query: 321 DPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEM 380
            P IS  I E +  +E  I+ C+S++ E+R+A+++LL + G+LV PT   PPPKL     
Sbjct: 302 GPGISERIWEAVRTTEEKIDACQSVKTELRAALTTLLGEFGVLVIPTVPGPPPKLQADPT 361

Query: 381 LSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS 440
             E ++ RAFSLLSIA VSG CQV++PLG +D  P SVS +A+HG D FLL+ V+++Y +
Sbjct: 362 TLESFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVSVSLLAKHGSDGFLLNLVESLYGT 421

Query: 441 L 441
           +
Sbjct: 422 I 422


Length = 422

>gnl|CDD|181375 PRK08310, PRK08310, amidase; Provisional Back     alignment and domain information
>gnl|CDD|223232 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216494 pfam01425, Amidase, Amidase Back     alignment and domain information
>gnl|CDD|236409 PRK09201, PRK09201, amidase; Provisional Back     alignment and domain information
>gnl|CDD|232842 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit Back     alignment and domain information
>gnl|CDD|235921 PRK07056, PRK07056, amidase; Provisional Back     alignment and domain information
>gnl|CDD|235698 PRK06102, PRK06102, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233982 TIGR02715, amido_AtzE, amidohydrolase, AtzE family Back     alignment and domain information
>gnl|CDD|234572 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|236177 PRK08186, PRK08186, allophanate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|233981 TIGR02713, allophanate_hyd, allophanate hydrolase Back     alignment and domain information
>gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated Back     alignment and domain information
>gnl|CDD|236030 PRK07488, PRK07488, indole acetimide hydrolase; Validated Back     alignment and domain information
>gnl|CDD|235945 PRK07139, PRK07139, amidase; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|235979 PRK07235, PRK07235, amidase; Provisional Back     alignment and domain information
>gnl|CDD|171524 PRK12470, PRK12470, amidase; Provisional Back     alignment and domain information
>gnl|CDD|235723 PRK06170, PRK06170, amidase; Provisional Back     alignment and domain information
>gnl|CDD|236028 PRK07486, PRK07486, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180437 PRK06169, PRK06169, putative amidase; Provisional Back     alignment and domain information
>gnl|CDD|236161 PRK08137, PRK08137, amidase; Provisional Back     alignment and domain information
>gnl|CDD|235855 PRK06707, PRK06707, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180715 PRK06828, PRK06828, amidase; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|235686 PRK06061, PRK06061, amidase; Provisional Back     alignment and domain information
>gnl|CDD|236029 PRK07487, PRK07487, amidase; Provisional Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|183377 PRK11910, PRK11910, amidase; Provisional Back     alignment and domain information
>gnl|CDD|235915 PRK07042, PRK07042, amidase; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|181154 PRK07869, PRK07869, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180608 PRK06529, PRK06529, amidase; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|180626 PRK06565, PRK06565, amidase; Validated Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 580
PLN02722422 indole-3-acetamide amidohydrolase 100.0
COG0154475 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A su 100.0
PRK09201465 amidase; Provisional 100.0
TIGR02715452 amido_AtzE amidohydrolase, AtzE family. Members of 100.0
PRK05962424 amidase; Validated 100.0
PRK07487469 amidase; Provisional 100.0
PRK06102452 hypothetical protein; Provisional 100.0
PRK08310395 amidase; Provisional 100.0
PRK06169466 putative amidase; Provisional 100.0
PRK07056454 amidase; Provisional 100.0
PRK07235502 amidase; Provisional 100.0
PRK07042464 amidase; Provisional 100.0
PRK07486484 amidase; Provisional 100.0
PRK12470462 amidase; Provisional 100.0
PRK06170490 amidase; Provisional 100.0
PRK07488472 indole acetimide hydrolase; Validated 100.0
TIGR00132460 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) 100.0
PRK06061483 amidase; Provisional 100.0
PRK06529482 amidase; Provisional 100.0
PRK00012459 gatA aspartyl/glutamyl-tRNA amidotransferase subun 100.0
PRK07869468 amidase; Provisional 100.0
PRK08137497 amidase; Provisional 100.0
PRK08186600 allophanate hydrolase; Provisional 100.0
PRK07139439 amidase; Provisional 100.0
TIGR02713561 allophanate_hyd allophanate hydrolase. Allophanate 100.0
PRK06828491 amidase; Provisional 100.0
PF01425441 Amidase: Amidase; InterPro: IPR000120 Amidase sign 100.0
PRK11910615 amidase; Provisional 100.0
PRK06707536 amidase; Provisional 100.0
PRK06565566 amidase; Validated 100.0
KOG1211506 consensus Amidases [Translation, ribosomal structu 100.0
KOG1212560 consensus Amidases [Translation, ribosomal structu 100.0
KOG0553 304 consensus TPR repeat-containing protein [General f 99.77
PRK15359144 type III secretion system chaperone protein SscB; 99.66
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.59
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.55
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.55
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.54
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.54
PRK10370198 formate-dependent nitrite reductase complex subuni 99.53
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.53
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.51
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.45
PRK11189 296 lipoprotein NlpI; Provisional 99.45
KOG4234271 consensus TPR repeat-containing protein [General f 99.43
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.4
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.35
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.34
KOG1126638 consensus DNA-binding cell division cycle control 99.33
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.32
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.32
PRK12370553 invasion protein regulator; Provisional 99.3
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.3
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.3
PRK12370553 invasion protein regulator; Provisional 99.3
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.28
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.28
KOG1126638 consensus DNA-binding cell division cycle control 99.28
PRK11189296 lipoprotein NlpI; Provisional 99.27
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.27
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.26
PLN02789 320 farnesyltranstransferase 99.26
PRK15331165 chaperone protein SicA; Provisional 99.23
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.23
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.22
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.21
PRK10370198 formate-dependent nitrite reductase complex subuni 99.2
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.2
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 99.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.2
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.19
KOG1125579 consensus TPR repeat-containing protein [General f 99.19
PRK15359144 type III secretion system chaperone protein SscB; 99.17
PRK10803263 tol-pal system protein YbgF; Provisional 99.17
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.15
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.14
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.14
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.13
KOG0553304 consensus TPR repeat-containing protein [General f 99.13
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.12
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.12
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.1
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.1
PLN02789320 farnesyltranstransferase 99.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.07
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.07
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.07
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.06
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.05
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.05
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.04
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.04
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.04
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.01
PF13512142 TPR_18: Tetratricopeptide repeat 99.0
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.99
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.94
KOG1125579 consensus TPR repeat-containing protein [General f 98.94
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.9
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.89
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.89
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.88
PRK11788389 tetratricopeptide repeat protein; Provisional 98.88
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.88
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.88
PF1337173 TPR_9: Tetratricopeptide repeat 98.87
KOG4555175 consensus TPR repeat-containing protein [Function 98.86
KOG2076 895 consensus RNA polymerase III transcription factor 98.86
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.85
PRK11788389 tetratricopeptide repeat protein; Provisional 98.84
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.83
KOG2076 895 consensus RNA polymerase III transcription factor 98.82
PF12688120 TPR_5: Tetratrico peptide repeat 98.82
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.81
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.81
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.8
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.8
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.79
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.78
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.78
KOG2003 840 consensus TPR repeat-containing protein [General f 98.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.77
PF1337173 TPR_9: Tetratricopeptide repeat 98.76
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.75
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.75
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.72
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.69
PRK14574 822 hmsH outer membrane protein; Provisional 98.69
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.68
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.67
PRK11906458 transcriptional regulator; Provisional 98.67
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.65
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.64
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.64
KOG1129478 consensus TPR repeat-containing protein [General f 98.62
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.59
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.59
PRK14574 822 hmsH outer membrane protein; Provisional 98.58
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.55
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.53
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.52
KOG1129478 consensus TPR repeat-containing protein [General f 98.52
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.5
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.49
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.47
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.47
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.46
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 98.45
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.44
PRK11906458 transcriptional regulator; Provisional 98.44
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.43
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.42
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.4
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.39
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.38
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.36
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.36
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.36
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.34
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.33
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.32
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.3
KOG2003 840 consensus TPR repeat-containing protein [General f 98.3
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.3
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.29
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.27
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.26
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.24
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.22
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.22
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.21
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.15
PRK10803263 tol-pal system protein YbgF; Provisional 98.14
PF1343134 TPR_17: Tetratricopeptide repeat 98.14
COG4700251 Uncharacterized protein conserved in bacteria cont 98.13
PF1342844 TPR_14: Tetratricopeptide repeat 98.1
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.1
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.09
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.08
PF1342844 TPR_14: Tetratricopeptide repeat 98.07
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.04
PF12688120 TPR_5: Tetratrico peptide repeat 98.04
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.03
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.02
KOG4234271 consensus TPR repeat-containing protein [General f 97.99
PF1343134 TPR_17: Tetratricopeptide repeat 97.98
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.96
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.94
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.93
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.9
PRK15331165 chaperone protein SicA; Provisional 97.89
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.84
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.84
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.83
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.82
KOG1310 758 consensus WD40 repeat protein [General function pr 97.82
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.78
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.76
PF13512142 TPR_18: Tetratricopeptide repeat 97.72
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.72
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.7
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.69
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.68
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.68
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.61
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.59
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.59
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.58
KOG2471 696 consensus TPR repeat-containing protein [General f 97.58
KOG3364149 consensus Membrane protein involved in organellar 97.56
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.56
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.46
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.46
PRK10941269 hypothetical protein; Provisional 97.45
KOG4555175 consensus TPR repeat-containing protein [Function 97.4
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.38
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.32
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.32
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.31
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.3
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.29
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.24
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.24
COG4700251 Uncharacterized protein conserved in bacteria cont 97.22
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.19
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.17
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.13
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.12
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.12
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 97.03
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.0
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.98
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.98
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.98
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.98
PRK10941269 hypothetical protein; Provisional 96.94
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.94
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.89
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.87
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.86
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.85
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.79
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.79
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.78
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.76
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 96.71
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.69
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.67
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.66
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.61
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.61
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.59
KOG1586288 consensus Protein required for fusion of vesicles 96.58
PLN03218 1060 maturation of RBCL 1; Provisional 96.57
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.57
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.56
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.5
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.48
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.48
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.45
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.44
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.42
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.41
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.4
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.37
PLN03218 1060 maturation of RBCL 1; Provisional 96.36
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.35
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.35
KOG1585 308 consensus Protein required for fusion of vesicles 96.34
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.29
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.24
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.2
PLN03077 857 Protein ECB2; Provisional 96.19
KOG1586288 consensus Protein required for fusion of vesicles 96.19
PRK04841 903 transcriptional regulator MalT; Provisional 96.18
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.14
KOG2471 696 consensus TPR repeat-containing protein [General f 96.13
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.13
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.1
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.07
PRK04841 903 transcriptional regulator MalT; Provisional 96.05
PLN03077 857 Protein ECB2; Provisional 95.96
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.87
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.82
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 95.6
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.59
KOG1585 308 consensus Protein required for fusion of vesicles 95.58
KOG3364149 consensus Membrane protein involved in organellar 95.5
COG2912269 Uncharacterized conserved protein [Function unknow 95.49
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.46
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 95.38
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 95.17
COG5191 435 Uncharacterized conserved protein, contains HAT (H 95.02
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.92
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.89
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 94.85
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.85
KOG0530318 consensus Protein farnesyltransferase, alpha subun 94.72
COG2912269 Uncharacterized conserved protein [Function unknow 94.55
KOG0529 421 consensus Protein geranylgeranyltransferase type I 94.42
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.42
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.29
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.15
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.14
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.95
COG3898 531 Uncharacterized membrane-bound protein [Function u 93.92
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.9
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 93.79
KOG4507 886 consensus Uncharacterized conserved protein, conta 93.78
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.7
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 93.39
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.29
KOG1550 552 consensus Extracellular protein SEL-1 and related 93.2
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.14
KOG2047 835 consensus mRNA splicing factor [RNA processing and 93.12
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.12
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.1
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 93.06
KOG1550 552 consensus Extracellular protein SEL-1 and related 92.95
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.83
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.82
KOG2300 629 consensus Uncharacterized conserved protein [Funct 92.79
KOG2300 629 consensus Uncharacterized conserved protein [Funct 92.27
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.09
KOG2581 493 consensus 26S proteasome regulatory complex, subun 91.86
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 91.59
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 91.56
COG3629280 DnrI DNA-binding transcriptional activator of the 91.49
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 91.47
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.33
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.3
KOG2047 835 consensus mRNA splicing factor [RNA processing and 91.23
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 91.21
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.16
KOG2041 1189 consensus WD40 repeat protein [General function pr 91.04
COG3898 531 Uncharacterized membrane-bound protein [Function u 90.63
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.56
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 90.47
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.28
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.23
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.8
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 89.78
COG5191 435 Uncharacterized conserved protein, contains HAT (H 89.74
KOG0529 421 consensus Protein geranylgeranyltransferase type I 89.63
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.56
COG3629280 DnrI DNA-binding transcriptional activator of the 89.25
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 89.18
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 89.13
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.92
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.55
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 88.39
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.37
KOG1310 758 consensus WD40 repeat protein [General function pr 87.91
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 87.53
KOG4814 872 consensus Uncharacterized conserved protein [Funct 87.52
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.18
KOG4014248 consensus Uncharacterized conserved protein (conta 87.18
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 86.89
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 86.52
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 86.45
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 86.21
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.13
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.85
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 85.79
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.72
COG4941415 Predicted RNA polymerase sigma factor containing a 84.35
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 83.97
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 83.91
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 83.79
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 83.47
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 83.34
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.68
COG4455 273 ImpE Protein of avirulence locus involved in tempe 82.39
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 82.27
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 82.19
COG4455 273 ImpE Protein of avirulence locus involved in tempe 82.14
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 81.72
KOG1258 577 consensus mRNA processing protein [RNA processing 80.91
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 80.75
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 80.71
COG3947361 Response regulator containing CheY-like receiver a 80.55
COG3947361 Response regulator containing CheY-like receiver a 80.33
>PLN02722 indole-3-acetamide amidohydrolase Back     alignment and domain information
Probab=100.00  E-value=6.2e-87  Score=684.76  Aligned_cols=406  Identities=59%  Similarity=1.009  Sum_probs=335.3

Q ss_pred             hccCCccceeeccccCCCCCCCCCCCCCCCCCceeeeecccccCCcccCCCChhhhhcCCCCCCChHHHHHHHhCCCeEE
Q 008025           29 NIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCI  108 (580)
Q Consensus        29 ~~~~~~~a~~~~~~~~~~~~~~~~~~~gpl~Gvp~~vKD~~~~~g~~tt~Gs~~~~~~~~~~~~da~~v~~l~~aGai~~  108 (580)
                      ..|+.+|||++.....    ...+...|||+||||+|||+|+++|++||+||+.+.+.+.++.+|+++|+||++||||++
T Consensus         2 ~~~~~~~a~~~~~~~~----~~~~~~~gpL~GvPiaVKD~~~v~G~~Tt~GS~~~~~~~~~~~~dA~vV~rL~~AGAiil   77 (422)
T PLN02722          2 ATNPDYGAFMEKFVLS----PTSSSHDLPLHGLTFAVKDIFDVEGYVTGFGNPDWARTHSAATSTAPAVLAVLRGGATCV   77 (422)
T ss_pred             CcCCCCCcceeecccc----CCCCCCCCCCCCCeEEEEcccccCCCccCCCCHHHHhcCCCCCCChHHHHHHHHCCCEEE
Confidence            3688999999875331    122246799999999999999999999999999887522356799999999999999999


Q ss_pred             EeccccccccccCCCCCCCCCCCCCCCCCCCCCCCCchhHHHHhcCCCccccccCCCCcccccccccCccccccCCCccc
Q 008025          109 GKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVS  188 (580)
Q Consensus       109 gkt~~~e~~~~~~~~~~~~G~~~NP~~~~~~~GGSSgGsaaaVaag~~~~a~gtD~gGSiR~PA~~~Gv~GlkPt~G~v~  188 (580)
                      ||||||||+++.+|+|.+||+|+||||++|+|||||||||||||+|++|+|+|||||||||||||||||||||||+||||
T Consensus        78 GKTn~~Efa~~~~g~n~~~G~t~NP~~~~r~pGGSSsGSAaAVAaG~~p~AlGtDtgGSIRiPAa~cGvvG~KPT~G~vp  157 (422)
T PLN02722         78 GKTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVS  157 (422)
T ss_pred             EEechhhHhhCCCCCCCCCCCCCCCCCCCCCCCcCcHHHHHHHHcCCCceEeecCCCcccccChhHcceEEEecCCCccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCcccCCCCCcccccccCHHHHHHHHHHhcCCCcccCCCCceEEEccchhhhcCCChhHHHHHHHHHHHHHh--CCcc
Q 008025          189 HMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQV  266 (580)
Q Consensus       189 ~~G~~p~~~sld~~G~~ar~~~d~~~v~~~l~~~~~~~~~~~~~l~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~v  266 (580)
                      +.|++|+++++|++|||+|+++|++.+++++.+.+..+...+.++.+..+.+......++++.+.++++++.+.  |+.+
T Consensus       158 ~~G~~pla~sld~~G~~ar~v~D~a~~~~~l~g~~~~d~~~~~ri~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~v  237 (422)
T PLN02722        158 TVGVIPMAQSFDTVGWFARDPVILKRVGHVLLQQPDVNPIKPSQIIIAEDCFQLSSIPHDRLVQVLVKSVEKLFGGGDIV  237 (422)
T ss_pred             CCCCCcccCCCCcccceeCCHHHHHHHHHHHcCCCCCCCcCCceEEechhhhhhcccccHHHHHHHHHHHHHHhcCCCee
Confidence            99999999999999999999999999999998776555566778887755432112234678888888888776  5554


Q ss_pred             cccccccccccccCCchhhhhh-----------hhhhHHHHHHHHHHHHHhhhhHHHHHhhCCCCCHHHHHHHHHhhcCC
Q 008025          267 LKHENLGEYFDSKVPSLKGFHK-----------TNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEIS  335 (580)
Q Consensus       267 v~~~~l~~~~~~~~p~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~s  335 (580)
                       +.+++...++...+.+..+..           ....+...+..+..++....+..|+......+++.++.+++.|..++
T Consensus       238 -~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~v~~~~~~g~~~s  316 (422)
T PLN02722        238 -KHVNLGDYVEDKVPSLKHFMSKEIKEQEYNIPSLAALSSAMRLLQRYEFKINHGEWITAVKPEFGPGISERIWEAVRTT  316 (422)
T ss_pred             -eecchhHHHHHhHHHHHHHhhcccccceecchhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhCCHHHHHHHHHhccCC
Confidence             223333222222222211100           01112234444666677777888888777889999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcCCCCEEEEcCCCCCCCCCCCCCCchHHHHHHHhhhhhcccccCCceeeeeCcCCCCCC
Q 008025          336 ETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCP  415 (580)
Q Consensus       336 ~~~~~~a~~~r~~~~~~~~~~~~~~Dvll~Pt~~~~ap~~~~~~~~~~~~~~~~~~~t~~~n~~g~P~~~~P~~~~~~lp  415 (580)
                      ..+|.++++.|.++++.+.++|+++|+||+||+|.+||+++........++..++.||.++|++|+|+++||++..+|+|
T Consensus       317 ~~~y~~a~~~r~~~~~~~~~~~~~~D~Ll~Pt~p~~ap~~~~~~~~~~~~~~~~~~~t~~~nl~G~PaisvP~g~~~glP  396 (422)
T PLN02722        317 EEKIDACQSVKTELRAALTTLLGEFGVLVIPTVPGPPPKLQADPTTLESFRARAFSLLSIAGVSGFCQVSIPLGLHDNLP  396 (422)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCEEEeCCCCCCCCCcccCcchHHHHHHHHHHhhhcccccCCCEEEEeCCCCCCCC
Confidence            99999999999999999999999999999999999999987543333344445667899999999999999999888999


Q ss_pred             cccceecccCCChHHHHHHHHHHH
Q 008025          416 TSVSFIARHGGDRFLLDTVQNMYA  439 (580)
Q Consensus       416 ~g~q~~~~~~~d~~ll~la~~le~  439 (580)
                      +|+|+++++++|..++.++..+..
T Consensus       397 vGlqivg~~~~D~~lL~~a~~l~~  420 (422)
T PLN02722        397 VSVSLLAKHGSDGFLLNLVESLYG  420 (422)
T ss_pred             EEEEEECCCCChHHHHHHHHHHHh
Confidence            999999999999999999988764



>COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09201 amidase; Provisional Back     alignment and domain information
>TIGR02715 amido_AtzE amidohydrolase, AtzE family Back     alignment and domain information
>PRK05962 amidase; Validated Back     alignment and domain information
>PRK07487 amidase; Provisional Back     alignment and domain information
>PRK06102 hypothetical protein; Provisional Back     alignment and domain information
>PRK08310 amidase; Provisional Back     alignment and domain information
>PRK06169 putative amidase; Provisional Back     alignment and domain information
>PRK07056 amidase; Provisional Back     alignment and domain information
>PRK07235 amidase; Provisional Back     alignment and domain information
>PRK07042 amidase; Provisional Back     alignment and domain information
>PRK07486 amidase; Provisional Back     alignment and domain information
>PRK12470 amidase; Provisional Back     alignment and domain information
>PRK06170 amidase; Provisional Back     alignment and domain information
>PRK07488 indole acetimide hydrolase; Validated Back     alignment and domain information
>TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit Back     alignment and domain information
>PRK06061 amidase; Provisional Back     alignment and domain information
>PRK06529 amidase; Provisional Back     alignment and domain information
>PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed Back     alignment and domain information
>PRK07869 amidase; Provisional Back     alignment and domain information
>PRK08137 amidase; Provisional Back     alignment and domain information
>PRK08186 allophanate hydrolase; Provisional Back     alignment and domain information
>PRK07139 amidase; Provisional Back     alignment and domain information
>TIGR02713 allophanate_hyd allophanate hydrolase Back     alignment and domain information
>PRK06828 amidase; Provisional Back     alignment and domain information
>PF01425 Amidase: Amidase; InterPro: IPR000120 Amidase signature (AS) enzymes are a large group of hydrolytic enzymes that contain a conserved stretch of approximately 130 amino acids known as the AS sequence Back     alignment and domain information
>PRK11910 amidase; Provisional Back     alignment and domain information
>PRK06707 amidase; Provisional Back     alignment and domain information
>PRK06565 amidase; Validated Back     alignment and domain information
>KOG1211 consensus Amidases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1212 consensus Amidases [Translation, ribosomal structure and biogenesis; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
1wao_1 477 Pp5 Structure Length = 477 2e-17
2dc0_A434 Crystal Structure Of Amidase Length = 434 5e-17
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 3e-16
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 6e-16
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-14
2df4_A485 Structure Of Trna-Dependent Amidotransferase Gatcab 9e-14
3h0l_A478 Structure Of Trna-Dependent Amidotransferase Gatcab 4e-13
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 6e-13
3al0_A475 Crystal Structure Of The Glutamine Transamidosome F 4e-12
3kfu_E471 Crystal Structure Of The Transamidosome Length = 47 8e-12
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 1e-11
3a1i_A521 Crystal Structure Of Rhodococcus Sp. N-771 Amidase 2e-11
3a1k_A521 Crystal Structure Of Rhodococcus Sp. N771 Amidase L 2e-11
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 3e-11
2gi3_A476 Crystal Structure Of Glutamyl-Trna(Gln) Amidotransf 4e-11
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 6e-11
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 3e-10
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 4e-10
4gyr_A621 Granulibacter Bethesdensis Allophanate Hydrolase Ap 5e-10
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 5e-10
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 7e-10
1m21_A503 Crystal Structure Analysis Of The Peptide Amidase P 9e-10
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 1e-09
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 1e-09
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-09
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 4e-09
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 5e-09
1obl_A414 Crystal Structure Of The S133a Mutant Of Malonamida 9e-08
1o9o_A414 Crystal Structure Of The S131a Mutant Of Malonamida 9e-08
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 1e-07
1elr_A131 Crystal Structure Of The Tpr2a Domain Of Hop In Com 2e-07
3esk_A129 Structure Of Hop Tpr2a Domain In Complex With The N 2e-07
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 3e-07
1obk_A414 Crystal Structure Of The R158q Mutant Of Malonamida 7e-07
1ock_A412 The Crystal Structure Of Malonamidase E2 From Brady 7e-07
1o9n_A414 Crystal Structure Of The K62a Mutant Of Malonamidas 8e-07
1obj_A414 Crystal Structure Of The T150a Mutant Of Malonamida 9e-07
1o9q_A414 Crystal Structure Of The S155c Mutant Of Malonamida 1e-06
1obi_A414 Crystal Structure Of The G130a Mutant Of Malonamida 1e-06
3fwv_A128 Crystal Structure Of A Redesigned Tpr Protein, T-Mo 2e-06
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-06
4gcn_A127 N-Terminal Domain Of Stress-Induced Protein-1 (Sti- 5e-06
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 6e-06
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 7e-06
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-04
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 4e-04
3rkv_A162 C-Terminal Domain Of Protein C56c10.10, A Putative 5e-04
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure

Iteration: 1

Score = 87.8 bits (216), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 44/117 (37%), Positives = 68/117 (58%) Query: 462 QSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADC 521 + AE K + N +K K + AI FY++AI+LN +NA YY NR+ AYL + + A D Sbjct: 4 KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 63 Query: 522 TKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKV 578 T+AI LDKK +K Y RR + LG ++ A+ D+ + ++P +K A + K+ Sbjct: 64 TRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI 120
>pdb|2DC0|A Chain A, Crystal Structure Of Amidase Length = 434 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2DF4|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 485 Back     alignment and structure
>pdb|3H0L|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 478 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3AL0|A Chain A, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 475 Back     alignment and structure
>pdb|3KFU|E Chain E, Crystal Structure Of The Transamidosome Length = 471 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|3A1I|A Chain A, Crystal Structure Of Rhodococcus Sp. N-771 Amidase Complexed With Benzamide Length = 521 Back     alignment and structure
>pdb|3A1K|A Chain A, Crystal Structure Of Rhodococcus Sp. N771 Amidase Length = 521 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2GI3|A Chain A, Crystal Structure Of Glutamyl-Trna(Gln) Amidotransferase Subunit A (Tm1272) From Thermotoga Maritima At 1.80 A Resolution Length = 476 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|4GYR|A Chain A, Granulibacter Bethesdensis Allophanate Hydrolase Apo Length = 621 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|1M21|A Chain A, Crystal Structure Analysis Of The Peptide Amidase Pam In Complex With The Competitive Inhibitor Chymostatin Length = 503 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|1OBL|A Chain A, Crystal Structure Of The S133a Mutant Of Malonamidase E2 Complexed With Malonate From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|1O9O|A Chain A, Crystal Structure Of The S131a Mutant Of Malonamidase E2 Complexed With Malonamate From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 Back     alignment and structure
>pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1OBK|A Chain A, Crystal Structure Of The R158q Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|1OCK|A Chain A, The Crystal Structure Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 412 Back     alignment and structure
>pdb|1O9N|A Chain A, Crystal Structure Of The K62a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|1OBJ|A Chain A, Crystal Structure Of The T150a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|1O9Q|A Chain A, Crystal Structure Of The S155c Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|1OBI|A Chain A, Crystal Structure Of The G130a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>pdb|3FWV|A Chain A, Crystal Structure Of A Redesigned Tpr Protein, T-Mod(Vmy), In Complex With Meevf Peptide Length = 128 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-50
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 9e-50
1o9p_A414 Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja 1e-49
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 9e-49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-48
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-47
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-47
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-46
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 7e-44
2dc0_A434 Probable amidase; structural genomics, NPPSFA, nat 2e-42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-42
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-41
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-38
3a1k_A521 Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo 1e-37
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-37
1m22_A503 Peptide amidase, PAM; eleven-stranded beta sheet, 3e-36
1m22_A503 Peptide amidase, PAM; eleven-stranded beta sheet, 6e-04
3a2q_A493 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet 1e-35
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-33
3ip4_A485 Glutamyl-tRNA(Gln) amidotransferase subunit A; mul 2e-33
3kfu_E471 Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP 4e-33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-33
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 6e-25
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-19
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 1e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-13
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-11
3h0l_A478 Glutamyl-tRNA(Gln) amidotransferase subunit A; mul 7e-33
2gi3_A476 Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 7e-33
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-32
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-32
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-25
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-22
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-15
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-05
3ppm_A573 Fatty-acid amide hydrolase 1; protein-inhibitor co 1e-31
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-30
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-26
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-22
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-15
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-30
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-29
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-23
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-22
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-20
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-18
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-18
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-15
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-27
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-20
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-19
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-17
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-16
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-14
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-24
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-21
3u4t_A 272 TPR repeat-containing protein; structural genomics 1e-20
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-18
3u4t_A 272 TPR repeat-containing protein; structural genomics 1e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-16
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-21
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-20
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-20
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-16
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-17
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-06
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-19
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-18
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-18
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-18
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-17
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-16
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-16
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-19
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-19
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-14
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-14
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-05
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-19
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-18
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-18
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-18
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-18
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-18
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-17
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-17
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-17
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-16
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-16
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-16
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-14
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-16
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-10
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-18
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-11
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-10
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-10
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-08
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-17
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-15
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-12
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-11
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-08
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-16
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-15
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-14
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-13
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 5e-13
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-08
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-16
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-14
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-14
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 9e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-09
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-15
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-15
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-13
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-15
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-12
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-15
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 3e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-13
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 4e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-12
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 4e-11
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-14
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 9e-13
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 4e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 9e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-13
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-10
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-12
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-12
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-11
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 1e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-07
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-10
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-08
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-10
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-10
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-08
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 9e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 8e-04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-06
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-06
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-05
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 1e-05
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 6e-05
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 4e-05
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 2e-04
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-04
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 8e-04
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
 Score =  169 bits (429), Expect = 6e-50
 Identities = 44/119 (36%), Positives = 68/119 (57%)

Query: 460 QKQSAEIAKEKGNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEA 519
             + AE  K + N  +K K +  AI FY++AI+LN +NA YY NR+ AYL +  +  A  
Sbjct: 9   ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALG 68

Query: 520 DCTKAINLDKKNVKAYLRRGTAREMLGYYKEAIEDFSYALVLEPTNKRASLSADRLRKV 578
           D T+AI LDKK +K Y RR  +   LG ++ A+ D+   + ++P +K A +      K+
Sbjct: 69  DATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI 127


>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Length = 414 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 Back     alignment and structure
>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 Back     alignment and structure
>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Length = 485 Back     alignment and structure
>3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 471 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Length = 478 Back     alignment and structure
>2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* Length = 476 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Length = 573 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query580
2dc0_A434 Probable amidase; structural genomics, NPPSFA, nat 100.0
3ip4_A485 Glutamyl-tRNA(Gln) amidotransferase subunit A; mul 100.0
3h0l_A478 Glutamyl-tRNA(Gln) amidotransferase subunit A; mul 100.0
3kfu_E471 Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP 100.0
3a2q_A493 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet 100.0
1o9p_A414 Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja 100.0
2gi3_A476 Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 100.0
1m22_A503 Peptide amidase, PAM; eleven-stranded beta sheet, 100.0
3a1k_A521 Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo 100.0
3ppm_A573 Fatty-acid amide hydrolase 1; protein-inhibitor co 100.0
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.85
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.77
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.75
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.72
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.71
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.7
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.7
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.67
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.63
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.63
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.63
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.62
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.61
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.61
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.6
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.6
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.6
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.6
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.58
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.55
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.55
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.54
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.54
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.52
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.5
3k9i_A117 BH0479 protein; putative protein binding protein, 99.49
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.47
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.46
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.46
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.46
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.45
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.43
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.43
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.41
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.41
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.4
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.4
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.4
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.4
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.4
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.39
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.38
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.37
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.37
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.37
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.37
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.36
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.36
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 99.36
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.36
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.35
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.35
3u4t_A272 TPR repeat-containing protein; structural genomics 99.34
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.34
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.34
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.33
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.33
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.33
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.32
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.31
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.31
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.31
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.31
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.31
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.3
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.29
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.28
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.26
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.26
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.26
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.25
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.25
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.24
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.24
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.23
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.22
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.21
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.19
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.19
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.19
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.18
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.17
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.17
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.17
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.16
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.16
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.16
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.15
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.13
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.13
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.12
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.12
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.12
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.11
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.11
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 99.11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.1
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.1
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.09
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 99.09
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.09
3k9i_A117 BH0479 protein; putative protein binding protein, 99.09
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.09
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.08
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.06
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.06
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.03
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.02
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.01
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.0
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.0
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.0
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.99
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.99
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.99
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.98
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.97
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.97
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.94
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.93
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.93
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.93
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.93
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.91
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.9
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.9
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.89
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.89
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.89
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.87
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 98.86
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.86
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.84
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.84
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.78
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.77
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.76
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.76
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.74
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.72
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.69
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.68
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.67
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.66
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.64
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.6
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.57
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.54
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.53
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.52
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.5
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.49
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.48
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.44
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.38
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.32
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.22
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.18
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.18
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.1
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.08
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.04
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.93
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.89
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.88
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.86
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.83
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.82
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.74
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.73
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.55
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.45
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.42
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.36
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.28
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.14
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.9
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.44
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 96.34
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.32
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.87
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.44
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.19
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.08
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.02
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.96
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.83
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.42
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 93.36
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 93.34
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 92.18
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.81
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 91.72
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.69
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.41
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 90.2
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.0
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 88.5
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 88.19
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 86.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.5
>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=4.5e-88  Score=698.85  Aligned_cols=405  Identities=26%  Similarity=0.331  Sum_probs=339.7

Q ss_pred             HhhhhhhHHH-----HHHHH----h--hhccCCccceeeccccCCCCCCC-------CCCCCCCCCCceeeeecccccCC
Q 008025           12 LGLGLAGILL-----MTKKL----K--KNIKQDFGAFIEKLQLLPPPQPL-------PPKAPHPLTGLSFAVSDLFDIEG   73 (580)
Q Consensus        12 ~~~~l~~~~~-----~~~~~----~--~~~~~~~~a~~~~~~~~~~~~~~-------~~~~~gpl~Gvp~~vKD~~~~~g   73 (580)
                      ++.+|+++++     +.|++    +  +++|| +|||++..+++++++|+       +++..|||+||||+|||+|+++|
T Consensus         2 ~~~~l~~~~~~g~~s~~el~~a~l~ri~~~~~-lna~~~~~~~~Al~~A~~~d~~~~~g~~~gpL~GvPi~vKD~~~v~G   80 (434)
T 2dc0_A            2 DLLEAKRLLETGRTTPLALLEEALERAKAFQD-RNALAYLDEEAARKEALALTEELRRGQVRGPLHGLPLTVKDLFPVKG   80 (434)
T ss_dssp             CHHHHHHHHHTTSCCHHHHHHHHHHHHHHTGG-GCCEEEECHHHHHHHHHHHHHHHHTTCCCSTTTTCEEEEETTSCBTT
T ss_pred             CHHHHHHHHHcCCCCHHHHHHHHHHHHHHhCC-CcEEEEcCHHHHHHHHHHHHHHHhcCCCCCCcCCeeEEEEeccccCC
Confidence            4667777744     44432    3  37899 99999998776555442       35668999999999999999999


Q ss_pred             cccCCCChhhhhcCCCCCCChHHHHHHHhCCCeEEEeccccccccccCCCCCCCCCCCCCCCCCCCCCCCCchhHHHHhc
Q 008025           74 YVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAA  153 (580)
Q Consensus        74 ~~tt~Gs~~~~~~~~~~~~da~~v~~l~~aGai~~gkt~~~e~~~~~~~~~~~~G~~~NP~~~~~~~GGSSgGsaaaVaa  153 (580)
                      ++||+||+.| .  .++.+|+++|+|||+||||++||||||||+++.+|+|.+||+|+||||+.|+||||||||||+||+
T Consensus        81 ~~tt~Gs~~~-~--~~a~~dA~vV~rL~~aGAii~GKTn~~Efa~~~~~~n~~~G~t~NP~~~~~~pGGSSgGsAaaVAa  157 (434)
T 2dc0_A           81 MPTRAGTKAP-L--PPLPEEARAVRRLREAGALLFAKTNMHEIALGITGENPWTGPVRNAVDPSRQAGGSSGGSAVAVAL  157 (434)
T ss_dssp             BCCCTTCSSC-C--CCCCSSCHHHHHHHHTTCEEEEEECCSGGGCCSSCCCTTTCCCBCSSCTTBBCCSSSHHHHHHHHH
T ss_pred             cccCCCCccc-C--CCCCCCHHHHHHHHHCCCEEEEEeChhHHhcCCCCCCCCCCCCCCCCCCCCCCcccHHHHHHHHHc
Confidence            9999999998 3  333899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccccCCCCcccccccccCccccccCCCccccCCCcccCCCCCcccccccCHHHHHHHHHHhcCCCcccC--CCCc
Q 008025          154 DLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQ--RSPR  231 (580)
Q Consensus       154 g~~~~a~gtD~gGSiR~PA~~~Gv~GlkPt~G~v~~~G~~p~~~sld~~G~~ar~~~d~~~v~~~l~~~~~~~~--~~~~  231 (580)
                      |++|+|+|||||||||+||+||||||||||+||||+.|++|+++++|++|||+|+++|++.+++++.+. ..+.  .++.
T Consensus       158 g~~~~alGtDtgGSIRiPAa~cGv~GlKPT~G~vs~~g~~~~~~s~d~~Gp~arsv~D~a~~l~~l~g~-~~d~~~~~~l  236 (434)
T 2dc0_A          158 GIGLASLGTDTGGSIRIPAGFNGVVGFKPSYGRVSLEGALPLSRSTDHAGPLTRSVRDAHFLTEILAGE-SIPLEGVQNP  236 (434)
T ss_dssp             TSSSCEEEECSSSTTHHHHHHHTCEEEECSTTSSCCTTSCCSCTTTCCEEEEESSHHHHHHHHHHHHTS-CCCCCCCCSC
T ss_pred             CCCceeeecCCChhhhhhHHhCCCEEEECCCCCCCCCCCCCCCCccCeeCcccCCHHHHHHHHHHHhCC-CCCcccccCC
Confidence            999999999999999999999999999999999999999999999999999999999999999998876 3332  3456


Q ss_pred             eEEEccchhhhcCCChhHHHHHHHHHHHHHh--CCcccccccccccccccCCchhhhhhhhhhHHHHHHHHHHHHHhhhh
Q 008025          232 QIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNH  309 (580)
Q Consensus       232 ~l~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv~~~~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  309 (580)
                      ||++..+.+  ....++++.++++++++.|+  |++|++ +++        | +..       ....+..+...|.+..+
T Consensus       237 rig~~~~~~--~~~~~~~v~~a~~~a~~~L~~~G~~v~~-~~~--------p-~~~-------~~~~~~~~~~~e~~~~~  297 (434)
T 2dc0_A          237 VFGVPLDFL--EGRLGVEVRKAFTRLLEDLPALRAEVRE-VSL--------P-LEG-------VYEVYTRLVRYEAARIH  297 (434)
T ss_dssp             EEEECHHHH--TTCSCHHHHHHHHHHHHHTTTTTCEEEE-CCC--------C-CTT-------HHHHHHHHHHHHHHHHS
T ss_pred             EEEEECccc--cCCCCHHHHHHHHHHHHHHHHCCCEEEE-eCC--------C-cHH-------HHHHHHHHHHHHHHHHH
Confidence            777765543  22358899999999999986  666532 222        2 221       12223334455666667


Q ss_pred             HHHHHhhCCCCCHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHHHhhcCCCCEEEEcCCCCCCCCCCCCCCc----hHHH
Q 008025          310 NEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEML----SEDY  385 (580)
Q Consensus       310 ~~~~~~~~~~~~~~~~~~~~~g~~~s~~~~~~a~~~r~~~~~~~~~~~~~~Dvll~Pt~~~~ap~~~~~~~~----~~~~  385 (580)
                      ..++......+++.++.++..+..++..+|.++++.|..+++.+.++|+++|+||+||++.++|+++.....    ....
T Consensus       298 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~a~~~r~~~~~~~~~~~~~~D~ll~Pt~~~~a~~~~~~~~~~~~~~~~~  377 (434)
T 2dc0_A          298 EKALKEHPEGFSPQVREALLAGLALTEKDYRDAVAEREALRLELVKALRGVDALLLPVQPLPAPPLGTEEVELESGRKGH  377 (434)
T ss_dssp             HHHHHHCGGGSCHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHTTSSEEEEESCSSSCCBTTCCEEEETTEEEEH
T ss_pred             HHHHHhchhhcCHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhcCCEEEECCCCCCCccCcccccccccchhhh
Confidence            777777677899999999999999999999999999999999999999999999999999999999865311    0111


Q ss_pred             HHHHhhhhhcccccCCceeeeeCcCCCCCCcccceecccCCChHHHHHHHHHHHH
Q 008025          386 QNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS  440 (580)
Q Consensus       386 ~~~~~~~t~~~n~~g~P~~~~P~~~~~~lp~g~q~~~~~~~d~~ll~la~~le~~  440 (580)
                      ...+..||.++|++|+|+++||++..+|+|+|+|+++++++|..+++++..+|+.
T Consensus       378 ~~~~~~~t~~~nl~G~PaisvP~g~~~GlPvGvqlvg~~~~d~~lL~~A~~lE~~  432 (434)
T 2dc0_A          378 REAFITLTLPFSLLGVPTLALPFAKVEGMPVGLQVVGAYGEDGKVLALGGWLEAR  432 (434)
T ss_dssp             HHHHHTTTHHHHHTTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHTT
T ss_pred             hhhhhhhhhhhhhhCCCeEEEecCCCCCCCeEEEEECCCCchHHHHHHHHHHHHh
Confidence            2234569999999999999999998889999999999999999999999988753



>3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} SCOP: c.117.1.1 PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Back     alignment and structure
>3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Back     alignment and structure
>3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Back     alignment and structure
>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Back     alignment and structure
>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Back     alignment and structure
>2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* Back     alignment and structure
>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Back     alignment and structure
>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Back     alignment and structure
>3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 580
d2gi3a1475 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransf 1e-49
d2f2aa1485 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransf 3e-46
d1m22a_490 c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomon 6e-28
d1ocka_412 c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium jap 4e-23
d1mt5a_537 c.117.1.1 (A:) Fatty acid amide hydrolase (oleamid 2e-21
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-21
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-17
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-15
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 6e-14
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 8e-12
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 1e-11
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-11
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-05
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-11
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-11
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-11
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-08
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-09
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 3e-04
d1dcea1 334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1dcea1 334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-09
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-05
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-08
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 2e-07
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 8e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-06
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 7e-06
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.003
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-05
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 0.001
d1qqea_ 290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.004
>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Amidase signature (AS) enzymes
superfamily: Amidase signature (AS) enzymes
family: Amidase signature (AS) enzymes
domain: Glutamyl-tRNA(Gln) amidotransferase subunit A
species: Thermotoga maritima [TaxId: 2336]
 Score =  176 bits (448), Expect = 1e-49
 Identities = 86/399 (21%), Positives = 161/399 (40%), Gaps = 27/399 (6%)

Query: 57  PLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEF 116
              G+  A+ D     G  T          +  +   +TVV  + E G   +GK  +DEF
Sbjct: 57  KFWGIPVAIKDNILTLGMRTTCASRILE--NYESVFDATVVKKMKEAGFVVVGKANLDEF 114

Query: 117 AYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCG 176
           A   +     +    NP    ++PGGSS G+A AV+A +V  +LG DT G VR P++ CG
Sbjct: 115 AMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCG 174

Query: 177 ILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPK-ILRHVGHVLLQLPFAAQRSPRQIII 235
           ++G++P+YG VS  G++  ++SLD +G   +  +     +  +  +    A    R++  
Sbjct: 175 VVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDF 234

Query: 236 ADDCFELLKIPADRVVQVVI-----KSTEKLFGRQVLKHENLG-EYFDSKVPSLKGFHKT 289
             +  E +      V + +      +   + F   +   E LG +    K+P +K    T
Sbjct: 235 LSEIEEGVSGMKFAVPEEIYEHDIEEGVSERFEEALKLLERLGAKVERVKIPHIKYSVAT 294

Query: 290 -----------NGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEML-----E 333
                      N    + ++   R + K     ++++       ++   I          
Sbjct: 295 YYVIAPAEASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAA 354

Query: 334 ISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLL 393
             E        +R ++   ++ +L     ++TPT+     K+G  +     Y    F+  
Sbjct: 355 YYEAYFNKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYYLMDIFT-- 412

Query: 394 SIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLD 432
             A+++G   ++VP G+ +  P  V  I R   D  +  
Sbjct: 413 IPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFR 451


>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485 Back     information, alignment and structure
>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490 Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412 Back     information, alignment and structure
>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query580
d2gi3a1475 Glutamyl-tRNA(Gln) amidotransferase subunit A {The 100.0
d1mt5a_537 Fatty acid amide hydrolase (oleamide hydrolase) {R 100.0
d2f2aa1485 Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta 100.0
d1ocka_412 Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 100.0
d1m22a_490 Peptide amidase Pam {Stenotrophomonas maltophilia 100.0
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.75
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.72
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.71
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.68
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.58
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.56
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.51
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.51
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.5
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.49
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.49
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.44
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.38
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.36
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.35
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.3
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.3
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.28
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.28
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.28
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.14
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.12
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.12
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.12
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.12
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.09
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.75
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.73
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.72
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.47
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.31
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.28
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.27
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.23
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.16
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.05
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.03
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.78
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.73
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.58
>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Amidase signature (AS) enzymes
superfamily: Amidase signature (AS) enzymes
family: Amidase signature (AS) enzymes
domain: Glutamyl-tRNA(Gln) amidotransferase subunit A
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=3.3e-82  Score=670.98  Aligned_cols=402  Identities=22%  Similarity=0.309  Sum_probs=320.2

Q ss_pred             hhhhhhH-----HHHHHH----Hh--hhccCCccceeeccccCCCCCCCCCCCCCCCCCceeeeecccccCCcccCCCCh
Q 008025           13 GLGLAGI-----LLMTKK----LK--KNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHP   81 (580)
Q Consensus        13 ~~~l~~~-----~~~~~~----~~--~~~~~~~~a~~~~~~~~~~~~~~~~~~~gpl~Gvp~~vKD~~~~~g~~tt~Gs~   81 (580)
                      .+.++++     ++.+|+    ++  +++||.+||||+..++.+++      ..|||+||||+|||+|+++|++||+||+
T Consensus         8 ~~~~~~~~~~~~~~~~~l~~~~l~ri~~~~~~lna~~~~~~~~a~~------~~gpL~GvPi~vKD~~~~~g~~tt~Gs~   81 (475)
T d2gi3a1           8 KLTIEECLKLSEEEREKLPQLSLETIKRLDPHVKAFISVRENVSVE------KKGKFWGIPVAIKDNILTLGMRTTCASR   81 (475)
T ss_dssp             GCCHHHHTTSCHHHHTTHHHHHHHHHHHHHHHHCCEEEECCCCCCC------CCSTTTTCEEEEETTBCCSSSCCCTTCG
T ss_pred             HhHHHHHHHcCCCCHHHHHHHHHHHHHHHCCcCCEEEEcCHHHhhh------ccCCCCCCEEEEEcccCCCCCccCccCh
Confidence            4455666     444443    23  38999999999988776544      3589999999999999999999999999


Q ss_pred             hhhhcCCCCCCChHHHHHHHhCCCeEEEeccccccccccCCCCCCCCCCCCCCCCCCCCCCCCchhHHHHhcCCCccccc
Q 008025           82 EWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLG  161 (580)
Q Consensus        82 ~~~~~~~~~~~da~~v~~l~~aGai~~gkt~~~e~~~~~~~~~~~~G~~~NP~~~~~~~GGSSgGsaaaVaag~~~~a~g  161 (580)
                      .+++  +++++|+++|++||++|||++||||||||+++.+|+|.+||+|+||||+.++||||||||||+||+|++|+|+|
T Consensus        82 ~~~~--~~~~~da~~v~~L~~aGaii~Gktn~~e~~~~~~~~~~~~G~t~nP~~~~~~~GGSSgGsaaavAag~~~~a~G  159 (475)
T d2gi3a1          82 ILEN--YESVFDATVVKKMKEAGFVVVGKANLDEFAMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALG  159 (475)
T ss_dssp             GGTT--CCCCSCCHHHHHHHHHTCEEEEEECCSGGGCCSSSTTCSSCCCCBTTBTTBCCCSSSHHHHHHHHTTSSSEEEE
T ss_pred             hhcC--CCCCCCcceeeehhhcCCccccccchhhcccccccccchhcccccccccccccCcccccchhhhhhcCcceEee
Confidence            9987  78999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCcccccccccCccccccCCCccccCCCcccCCCCCcccccccCHHHHHHHHHHhcCCCccc---------------
Q 008025          162 IDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAA---------------  226 (580)
Q Consensus       162 tD~gGSiR~PA~~~Gv~GlkPt~G~v~~~G~~p~~~sld~~G~~ar~~~d~~~v~~~l~~~~~~~---------------  226 (580)
                      ||||||||+||+||||||||||+||||+.|++|+++++|++|||+|+++|++.+++++.+.+..+               
T Consensus       160 tD~gGSiR~PA~~~Gv~G~kPt~G~i~~~g~~~~~~~~d~~GpmaRsv~D~alll~v~~g~d~~d~~s~~~~~~~~~~~~  239 (475)
T d2gi3a1         160 SDTGGSVRQPASLCGVVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSEIE  239 (475)
T ss_dssp             EESSSTTHHHHHHHTSEEEECCTTSBCCTTBCCSCTTTCEEEEEESSHHHHHHHHHHHBSCBTTBTTCCSCCCCSSTTTT
T ss_pred             cCCCccchhhhHHhCceeecCCCCCCCCCCCCCCCCCCCccCCccCCHHHHHHHhhhhhccccccccccccccccchhcc
Confidence            99999999999999999999999999999999999999999999999999999999887543211               


Q ss_pred             -CCCCceEEEccchhhhcCCChhHHHHHHHHHHHHHh--CCcccccccccccccccCCchhhhhhhhhhHHHHHHHHHHH
Q 008025          227 -QRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRY  303 (580)
Q Consensus       227 -~~~~~~l~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv~~~~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  303 (580)
                       ...+.|+++..+.+.  ...++++.++++++++.|+  |++|++ +++        |.+....       ..+..+...
T Consensus       240 ~~~~~~ri~~~~~~~~--~~~~~~v~~a~~~a~~~L~~~G~~V~e-v~~--------p~~~~~~-------~~~~~i~~~  301 (475)
T d2gi3a1         240 EGVSGMKFAVPEEIYE--HDIEEGVSERFEEALKLLERLGAKVER-VKI--------PHIKYSV-------ATYYVIAPA  301 (475)
T ss_dssp             SCCTTCEEEEEGGGGG--SCCCHHHHHHHHHHHHHHHHTTCEEEE-ECC--------TTGGGHH-------HHHHHHHHH
T ss_pred             ccccccceeeeecccc--CCCCHHHHHHHHHHHHHHHHCCCEEEE-eCC--------CchHHHH-------HHHHHHHHH
Confidence             234567776655432  3357899999999999986  777643 222        3222111       111111122


Q ss_pred             HHhhhhH------------------HHHHhhCCCCCHHHHHHHHHhhcC-----CHHHHHHHHHHHHHHHHHHHhhcCCC
Q 008025          304 EFKNNHN------------------EWIESVKPALDPDISAEIGEMLEI-----SETVIENCKSIRNEMRSAISSLLKDD  360 (580)
Q Consensus       304 ~~~~~~~------------------~~~~~~~~~~~~~~~~~~~~g~~~-----s~~~~~~a~~~r~~~~~~~~~~~~~~  360 (580)
                      ++..++.                  .+.......+.+.++.++..+...     ...++.++.+.|..+++.+.++|+++
T Consensus       302 e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  381 (475)
T d2gi3a1         302 EASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAAYYEAYFNKAMKVRRKISDELNEVLSQY  381 (475)
T ss_dssp             HHHTC------------------------CCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHhhcchhhhhcccccHHHHHHhhhhcccCHHHHHHHHhcchhhchHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            2221111                  112222334567777777665433     33345567788899999999999999


Q ss_pred             CEEEEcCCCCCCCCCCCCCCchHHHHHHHhhhhhcccccCCceeeeeCcCCCCCCcccceecccCCChHHHHHHHHHHHH
Q 008025          361 GILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS  440 (580)
Q Consensus       361 Dvll~Pt~~~~ap~~~~~~~~~~~~~~~~~~~t~~~n~~g~P~~~~P~~~~~~lp~g~q~~~~~~~d~~ll~la~~le~~  440 (580)
                      |+||+||++.++|++++...+...+  ....||.++|++|+|+++||+|+.+|+|+|+|+++++++|..+++++..+|+.
T Consensus       382 D~ll~Pt~~~~a~~~~~~~~~~~~~--~~~~~t~~~Nl~G~PaisvP~G~s~GlPvGvQlig~~~~D~~LL~~A~~~E~~  459 (475)
T d2gi3a1         382 DAILTPTSPVTAFKIGEIKDPLTYY--LMDIFTIPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFRIARAIEKN  459 (475)
T ss_dssp             SEEEEESCSSCCCBTTTCCCHHHHH--TTTTTTHHHHHHTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHHH
T ss_pred             CEEEeCCCCCCCCCcccccchHHHh--hhhHHHHHHHHHCCCeEEEeCCCCCCCCEeEEEECCCCCHHHHHHHHHHHHHc
Confidence            9999999999999998764332221  23348999999999999999999999999999999999999999999999976


Q ss_pred             HH
Q 008025          441 LQ  442 (580)
Q Consensus       441 l~  442 (580)
                      ..
T Consensus       460 ~~  461 (475)
T d2gi3a1         460 SP  461 (475)
T ss_dssp             CT
T ss_pred             CC
Confidence            54



>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure