Citrus Sinensis ID: 008069

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58

MFISCCSLSIPELNFTPSLINHNSQVLIHQNRSKFTALSNKVQSFGQRDAMQLGSSSKPRIRNCMIQSFEHVNTLPFSDYKFSRMKLFKPRYEKSSLFSGDSLKSSNFNGSTLRSEDLGCGESERNRDFALMAKTVMSVDNLVEIGGNEGMSRGADDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLKQSIAFREV

cccccccccccccccccccccccccEEEEEccccHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEccccccccccEEEEEccEEEcccccccccccccccHHHHHHHHHHccccEEEEEcccEEEEEccccEEEEEcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccEEEEcccEEEEEEEccEEEEEEEccccEEEccEEEEcccHHHHHHHccccccccHHHHHHHHHccccccEEEEEEEEcccccccccccEEEEEccccccccccccEEEEEcccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEc

cEEEEcccccccccccccHcccccEEEEEccccHHHEccccHHHHcccHHHHcccccccccccEEEEEccccccccccccccEEccccccccccccccccccEEEEcccccccccEEEcccccccccccEEEEEEEEEcccEEEcccccccccccccccEEEEEccHHHHHHHHHHHHcccEEEEEEEcccccccEEEEEcccEEEccccEEEEcccHHHHHHHHHHHHHHHcccEEEcccccEEEEEcccccEEEccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHccHHHHHHHcccHEEEccccHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccEEEEcccEEEEEEEccEEEEEEEcccEEEEccEEEEcccHHHHHHHHccccccccHHHHHHHHHcccccEEEEEEccccccccccccccEEEEcccHHHccccccEEEEEcccccccccccccccEEEEEEccccHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHccEEEEEc

mfisccslsipelnftpslinhnsqvLIHQNRSKFTALSNKVqsfgqrdamqlgssskprirncmiqsfehvntlpfsdykfsrmklfkpryeksslfsgdslkssnfngstlrsedlgcgeserNRDFALMAKTVMSVDNLVEiggnegmsrgaddydaIVIGSGIGGLVAATQLAVKGARVLVLEKYvipggssgyyerdgytfdvgssvmfgfsdkgnLNLITQALAAVgcemevipdpttvhfhlpndlsvrVHREYSDFVAELtskfphekegVLAFYGECWKIFNALNSlelksleepiyLFGQFFKRPLECLTLAyylpqnagniarkyikdpqllsfidaECFIVSTINALQTPMINASMVLcdrhfgginypvggvGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNAtrwdtfgkllkgeqlpkEEENFQKLYvkapsflsihmgvkaevlppdtdchhfvleddwnrleepygsiflsiptvldsslapeghhiLHIFTICsiedweglaqkdydAKKELVADEIINRLENklfpglkqsiafrev

MFISCCSLSIPELNFTPSLINHNSQVLIHQNRSKFTALSNKVQSFGQRDAMQLGSSSKPRIRNCMIQSFEhvntlpfsDYKFSRMKLFKPRYeksslfsgdslkssnfngstlrsedlgcgeSERNRDFALMAKTVMSVDNLVEIGGNEGMSRGADDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYvipggssgyyeRDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILeqgkavgvrlsdgrEFYAKTiisnatrwdtFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRlenklfpglkqsiafrev

MFISCCSLSIPELNFTPSLINHNSQVLIHQNRSKFTALSNKVQSFGQRDAMQLGSSSKPRIRNCMIQSFEHVNTLPFSDYKFSRMKLFKPRYEksslfsgdslkssNFNGSTLRSEDLGCGESERNRDFALMAKTVMSVDNLVEIGGNEGMSRGADDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFgginypvggvggiAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLKQSIAFREV

*FISCCSLSIPELNFTPSLINHNSQVLIHQNR**F*************************IRNCMIQSFEHVNTLPFSDYKFSRMKLFK***************************************FALMAKTVMSVDNLVEIGGNEGMSRGADDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLK********

*F*SCCSLSIPELNFTPSLINHNSQVLIHQNRSKFTALSNKVQSFG******************MIQSFEHVNTLPFSDYKF*****************************************************************************AIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKE*ENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLKQSIAFREV

MFISCCSLSIPELNFTPSLINHNSQVLIHQNRSKFTALSNKVQSFGQRDAMQLGSSSKPRIRNCMIQSFEHVNTLPFSDYKFSRMKLFKPRYEKSSLFSGDSLKSSNFNGSTLRSEDLGCGESERNRDFALMAKTVMSVDNLVEIG*********DDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLKQSIAFREV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		579	2.2.26 [Sep-21-2011]
Q8S4R4		615	Prolycopene isomerase, ch	N/A	no	0.880	0.829	0.762	0.0
Q2VEX9		615	Prolycopene isomerase, ch	N/A	no	0.853	0.803	0.748	0.0
Q9M9Y8		595	Prolycopene isomerase, ch	yes	no	0.744	0.724	0.861	0.0
Q52QW3		587	Prolycopene isomerase 1,	N/A	no	0.749	0.739	0.799	0.0
Q52QW2		587	Prolycopene isomerase 2,	N/A	no	0.749	0.739	0.797	0.0
P22871		492	Phytoene desaturase (lyco	N/A	no	0.682	0.802	0.239	1e-20
P21685		492	Phytoene desaturase (lyco	yes	no	0.675	0.794	0.255	2e-20
Q5BLE8		607	Putative all-trans-retino	yes	no	0.720	0.686	0.245	4e-19
P54978		501	Phytoene desaturase (lyco	N/A	no	0.678	0.784	0.240	2e-15
Q8VHE9		609	All-trans-retinol 13,14-r	yes	no	0.594	0.564	0.268	5e-15

>sp\|Q8S4R4\|CRTSO_SOLLC Prolycopene isomerase, chloroplastic OS=Solanum lycopersicum GN=CRTISO PE=1 SV=1	Back alignment and function desciption

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/517 (76%), Positives = 433/517 (83%), Gaps = 7/517 (1%)

Query: 68  SFEHVNTLPFSDYKFSRMKLFKPRYEKSSLFSGDSLKSSNF-NGSTLRSEDLGCGESERN 126
           SF + N+L     K   +   KPRY K      D L   N  +   L     G  +++  
Sbjct: 5   SFMYPNSLLDGTCKTVALGDSKPRYNKQRSSCFDPLIIGNCTDQQQLCGLSWGVDKAKGR 64

Query: 127 RDFALM-AKTVMSVDNLVEIGGN---EGMSRGADDYDAIVIGSGIGGLVAATQLAVKGAR 182
           R   +   K V+ VD  VE  G+   EG   G+  YDAIVIGSGIGGLVAATQLAVKGA+
Sbjct: 65  RGGTVSNLKAVVDVDKRVESYGSSDVEGNESGS--YDAIVIGSGIGGLVAATQLAVKGAK 122

Query: 183 VLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDP 242
           VLVLEKYVIPGGSSG+YERDGY FDVGSSVMFGFSDKGNLNLITQALAAVG ++EVIPDP
Sbjct: 123 VLVLEKYVIPGGSSGFYERDGYKFDVGSSVMFGFSDKGNLNLITQALAAVGRKLEVIPDP 182

Query: 243 TTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLE 302
           TTVHFHLPNDLSVR+HREY DF+ EL SKFPHEKEG++ FY ECWKIFN+LNSLELKSLE
Sbjct: 183 TTVHFHLPNDLSVRIHREYDDFIEELVSKFPHEKEGIIKFYSECWKIFNSLNSLELKSLE 242

Query: 303 EPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTP 362
           EPIYLFGQFFK+PLECLTLAYYLPQNAG+IARKYI+DP LLSFIDAECFIVST+NALQTP
Sbjct: 243 EPIYLFGQFFKKPLECLTLAYYLPQNAGSIARKYIRDPGLLSFIDAECFIVSTVNALQTP 302

Query: 363 MINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGV 422
           MINASMVLCDRHFGGINYPVGGVG IAKSLAKGL D GS+ILY+ANVT +IL+ GKAVGV
Sbjct: 303 MINASMVLCDRHFGGINYPVGGVGEIAKSLAKGLDDHGSQILYRANVTSIILDNGKAVGV 362

Query: 423 RLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEV 482
           +LSDGR+FYAKTI+SNATRWDTFGKLLK E LPKEEENFQK YVKAPSFLSIHMGVKA+V
Sbjct: 363 KLSDGRKFYAKTIVSNATRWDTFGKLLKAENLPKEEENFQKAYVKAPSFLSIHMGVKADV 422

Query: 483 LPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGL 542
           LPPDTDCHHFVLEDDW  LE+PYGSIFLSIPTVLDSSLAPEGHHILHIFT  SIEDWEGL
Sbjct: 423 LPPDTDCHHFVLEDDWTNLEKPYGSIFLSIPTVLDSSLAPEGHHILHIFTTSSIEDWEGL 482

Query: 543 AQKDYDAKKELVADEIINRLENKLFPGLKQSIAFREV 579
           + KDY+AKKE+VA+ II+RLE  LFPGLK SI F+EV
Sbjct: 483 SPKDYEAKKEVVAERIISRLEKTLFPGLKSSILFKEV 519

Carotene cis-trans-isomerase that converts 7,9,9'-tri-cis-neurosporene to 9'-cis-neurosporene and 7,9,9',7'-tetra-cis-lycopene (also known as prolycopene) into all-trans-lycopene. Isomerization requires redox-active components, suggesting that isomerization is achieved by a reversible redox reaction acting at specific double bonds. Isomerizes adjacent cis-double bonds at C7 and C9 pairwise into the trans-configuration, but is incapable of isomerizing single cis-double bonds at C9 and C9'.
Solanum lycopersicum (taxid: 4081)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 3

>sp\|Q2VEX9\|CRTSO_DAUCA Prolycopene isomerase, chloroplastic OS=Daucus carota GN=CRTISO PE=2 SV=1	Back alignment and function description

>sp\|Q9M9Y8\|CRTSO_ARATH Prolycopene isomerase, chloroplastic OS=Arabidopsis thaliana GN=CRTISO PE=2 SV=2	Back alignment and function description

>sp\|Q52QW3\|CRTS1_ONCHC Prolycopene isomerase 1, chloroplastic OS=Oncidium hybrid cultivar GN=CRTISO1 PE=2 SV=1	Back alignment and function description

>sp\|Q52QW2\|CRTS2_ONCHC Prolycopene isomerase 2, chloroplastic OS=Oncidium hybrid cultivar GN=CRTISO2 PE=2 SV=1	Back alignment and function description

>sp\|P22871\|CRTI_ESCVU Phytoene desaturase (lycopene-forming) OS=Escherichia vulneris GN=crtI PE=3 SV=1	Back alignment and function description

>sp\|P21685\|CRTI_PANAN Phytoene desaturase (lycopene-forming) OS=Pantoea ananas GN=crtI PE=1 SV=1	Back alignment and function description

>sp\|Q5BLE8\|RETST_DANRE Putative all-trans-retinol 13,14-reductase OS=Danio rerio GN=retsat PE=2 SV=1	Back alignment and function description

>sp\|P54978\|CRTI_PARSN Phytoene desaturase (lycopene-forming) OS=Paracoccus sp. (strain N81106 / MBIC 01143) GN=crtI PE=3 SV=2	Back alignment and function description

>sp\|Q8VHE9\|RETST_RAT All-trans-retinol 13,14-reductase OS=Rattus norvegicus GN=Retsat PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		579
224139966		613	predicted protein [Populus trichocarpa]	0.875	0.827	0.786	0.0
225439332		641	PREDICTED: prolycopene isomerase, chloro	0.882	0.797	0.766	0.0
255566223		617	Carotenoid isomerase, chloroplast precur	0.841	0.789	0.781	0.0
224088134		606	predicted protein [Populus trichocarpa]	0.849	0.811	0.780	0.0
359270188		648	carotenoid isomerase [Calendula officina	0.901	0.805	0.732	0.0
262036868		602	carotenoid isomerase [Ipomoea sp. Kenyan	0.861	0.828	0.765	0.0
449437510		666	PREDICTED: prolycopene isomerase, chloro	0.825	0.717	0.792	0.0
359270186		648	carotenoid isomerase [Calendula officina	0.901	0.805	0.728	0.0
449501117		666	PREDICTED: LOW QUALITY PROTEIN: prolycop	0.825	0.717	0.790	0.0
359270190		648	carotenoid isomerase [Calendula officina	0.901	0.805	0.721	0.0

>gi\|224139966\|ref\|XP_002323362.1\| predicted protein [Populus trichocarpa] gi\|222867992\|gb\|EEF05123.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/511 (78%), Positives = 454/511 (88%), Gaps = 4/511 (0%)

Query: 73  NTLPFSDYKFSRMKLFKPRYEKSSLFSGDSLKSSNFNG----STLRSEDLGCGESERNRD 128
           N+L F  +   ++   K R +K  + S + +++S  +G      ++ +    G+ + N+D
Sbjct: 7   NSLFFGQFNTVQLGSSKSRSQKHRILSIEPVRTSVLDGYIVPRNIKGKIDNLGKVKLNKD 66

Query: 129 FALMAKTVMSVDNLVEIGGNEGMSRGADDYDAIVIGSGIGGLVAATQLAVKGARVLVLEK 188
           F L +K+V++VD  V++ GN G+ R   +YDAIVIGSGIGGLVAATQLAVKGA+VLVLEK
Sbjct: 67  FVLRSKSVLTVDKEVDVDGNGGLGRERSNYDAIVIGSGIGGLVAATQLAVKGAKVLVLEK 126

Query: 189 YVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFH 248
           YVIPGGSSGYYERDG+TFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFH
Sbjct: 127 YVIPGGSSGYYERDGFTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFH 186

Query: 249 LPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLF 308
           LPNDLSV+VHREY DF++EL +KFPHEK+G+L FYGECWKIFNALNSLELKSLEEPIYLF
Sbjct: 187 LPNDLSVQVHREYIDFISELAAKFPHEKDGILKFYGECWKIFNALNSLELKSLEEPIYLF 246

Query: 309 GQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASM 368
           GQFF++PLECLTLAYYLPQNAG+IARKYIKDPQLLSFIDAECFIVST+NALQTPMINA+M
Sbjct: 247 GQFFQKPLECLTLAYYLPQNAGDIARKYIKDPQLLSFIDAECFIVSTVNALQTPMINAAM 306

Query: 369 VLCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGR 428
           VLCDRHFGGINYPVGGVGGIAKSL+KGL D+GSEILY+ANVT +ILE GKAVGVRLSDGR
Sbjct: 307 VLCDRHFGGINYPVGGVGGIAKSLSKGLVDQGSEILYRANVTNIILEHGKAVGVRLSDGR 366

Query: 429 EFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTD 488
           EF+ KTIISNATRWDTFGKLLKGE LPKEEENFQK+YVKAPSFLSIHMGVKAEVLPPDTD
Sbjct: 367 EFFGKTIISNATRWDTFGKLLKGETLPKEEENFQKVYVKAPSFLSIHMGVKAEVLPPDTD 426

Query: 489 CHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYD 548
           CHHFVLEDDW RLEEPYGSIFLSIPT+LDSSLAPEGHHILHIFT  SIEDWEGL+ KDY+
Sbjct: 427 CHHFVLEDDWARLEEPYGSIFLSIPTILDSSLAPEGHHILHIFTTSSIEDWEGLSTKDYE 486

Query: 549 AKKELVADEIINRLENKLFPGLKQSIAFREV 579
           AKK++ ADEII+RLE KLFPG++ SIAF EV
Sbjct: 487 AKKKVAADEIISRLEKKLFPGIRSSIAFMEV 517

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225439332\|ref\|XP_002269554.1\| PREDICTED: prolycopene isomerase, chloroplastic-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255566223\|ref\|XP_002524099.1\| Carotenoid isomerase, chloroplast precursor, putative [Ricinus communis] gi\|223536667\|gb\|EEF38309.1\| Carotenoid isomerase, chloroplast precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224088134\|ref\|XP_002308337.1\| predicted protein [Populus trichocarpa] gi\|222854313\|gb\|EEE91860.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359270188\|dbj\|BAL27714.1\| carotenoid isomerase [Calendula officinalis]	Back alignment and taxonomy information

>gi\|262036868\|dbj\|BAI47575.1\| carotenoid isomerase [Ipomoea sp. Kenyan]	Back alignment and taxonomy information

>gi\|449437510\|ref\|XP_004136535.1\| PREDICTED: prolycopene isomerase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|359270186\|dbj\|BAL27713.1\| carotenoid isomerase [Calendula officinalis]	Back alignment and taxonomy information

>gi\|449501117\|ref\|XP_004161282.1\| PREDICTED: LOW QUALITY PROTEIN: prolycopene isomerase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|359270190\|dbj\|BAL27715.1\| carotenoid isomerase [Calendula officinalis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		579
TAIR\|locus:2033055		595	CRTISO "carotenoid isomerase"	0.768	0.747	0.816	3e-195
UNIPROTKB\|Q0IS25		602	Os11g0572700 "Os11g0572700 pro	0.436	0.420	0.786	3.1e-166
UNIPROTKB\|A8J9E9		568	CHLREDRAFT_196597 "Carotenoid	0.727	0.741	0.548	4.2e-127
UNIPROTKB\|Q10AT7		597	Os03g0841900 "Os03g0841900 pro	0.393	0.381	0.289	6.2e-33
UNIPROTKB\|A8J3K3		558	CHLREDRAFT_130438 "Predicted p	0.720	0.747	0.282	6.5e-33
TAIR\|locus:2009395		574	AT1G57770 [Arabidopsis thalian	0.713	0.719	0.282	3.5e-30
UNIPROTKB\|A8J7T2		566	CHLREDRAFT_176572 "Predicted p	0.423	0.432	0.302	1.8e-28
UNIPROTKB\|P21685		492	crtI "Phytoene desaturase (lyc	0.678	0.798	0.254	4e-17
UNIPROTKB\|P17054		524	crtI "Phytoene desaturase (neu	0.312	0.345	0.245	3.1e-14
UNIPROTKB\|Q3Z8B0		523	DET0811 "Phytoene dehydrogenas	0.321	0.355	0.283	7.2e-14

TAIR\|locus:2033055 CRTISO "carotenoid isomerase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1891 (670.7 bits), Expect = 3.0e-195, P = 3.0e-195
 Identities = 365/447 (81%), Positives = 394/447 (88%)

Query:   135 TVMSVDNLVEIGGNEGMSR-GADD-YDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIP 192
             TV SV + V     +G  R G +  YDAIVIGSGIGGLVAATQLAVK ARVLVLEKY+IP
Sbjct:    53 TVKSVSSSVVASTVQGTKRDGGESLYDAIVIGSGIGGLVAATQLAVKEARVLVLEKYLIP 112

Query:   193 GGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPND 252
             GGSSG+YERDGYTFDVGSSVMFGFSDKGNLNLITQAL AVG +MEVIPDPTTVHFHLPN+
Sbjct:   113 GGSSGFYERDGYTFDVGSSVMFGFSDKGNLNLITQALKAVGRKMEVIPDPTTVHFHLPNN 172

Query:   253 LSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFF 312
             LSVR+HREY DF+AELTSKFPHEKEG+L FYG+CWKIFN+LNSLELKSLEEPIYLFGQFF
Sbjct:   173 LSVRIHREYDDFIAELTSKFPHEKEGILGFYGDCWKIFNSLNSLELKSLEEPIYLFGQFF 232

Query:   313 KRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCD 372
             ++PLECLTLAYYLPQNAG IARKYIKDPQLLSFIDAECFIVST+NALQTPMINASMVLCD
Sbjct:   233 QKPLECLTLAYYLPQNAGAIARKYIKDPQLLSFIDAECFIVSTVNALQTPMINASMVLCD 292

Query:   373 RHFXXXXXXXXXXXXXAKSLAKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYA 432
             RH+             AKSLA+GL D+GSEI YKANV  +IL+ GKAVGVRL+DGREF+A
Sbjct:   293 RHYGGINYPVGGVGGIAKSLAEGLVDQGSEIQYKANVKSIILDHGKAVGVRLADGREFFA 352

Query:   433 KTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHF 492
             KTIISNATRWDTFGKLLKGE+LPKEEENFQK+YVKAPSFLSIHMGVKAEVLPPDTDCHHF
Sbjct:   353 KTIISNATRWDTFGKLLKGEKLPKEEENFQKVYVKAPSFLSIHMGVKAEVLPPDTDCHHF 412

Query:   493 VLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKE 552
             VLEDDW  LEEPYGSIFLSIPT+LDSSLAP+G HILHIFT  SIEDWEGL  K+Y+AKKE
Sbjct:   413 VLEDDWKNLEEPYGSIFLSIPTILDSSLAPDGRHILHIFTTSSIEDWEGLPPKEYEAKKE 472

Query:   553 LVADEIINRLENKLFPGLKQSIAFREV 579
              VA  II RLE KLFPGL  SI F+EV
Sbjct:   473 DVAARIIQRLEKKLFPGLSSSITFKEV 499

GO:0009055 "electron carrier activity" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;IBA;TAS

GO:0016117 "carotenoid biosynthetic process" evidence=IEA;IGI;TAS

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016853 "isomerase activity" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009662 "etioplast organization" evidence=IMP

GO:0046608 "carotenoid isomerase activity" evidence=IGI;IMP

UNIPROTKB\|Q0IS25 Os11g0572700 "Os11g0572700 protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|A8J9E9 CHLREDRAFT_196597 "Carotenoid isomerase" [Chlamydomonas reinhardtii (taxid:3055)]	Back alignment and assigned GO terms

UNIPROTKB\|Q10AT7 Os03g0841900 "Os03g0841900 protein" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|A8J3K3 CHLREDRAFT_130438 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)]	Back alignment and assigned GO terms

TAIR\|locus:2009395 AT1G57770 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A8J7T2 CHLREDRAFT_176572 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)]	Back alignment and assigned GO terms

UNIPROTKB\|P21685 crtI "Phytoene desaturase (lycopene-forming)" [Pantoea ananatis (taxid:553)]	Back alignment and assigned GO terms

UNIPROTKB\|P17054 crtI "Phytoene desaturase (neurosporene-forming)" [Rhodobacter capsulatus SB 1003 (taxid:272942)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3Z8B0 DET0811 "Phytoene dehydrogenase family" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8S4R4	CRTSO_SOLLC	5, ., 2, ., 1, ., 1, 3	0.7620	0.8808	0.8292	N/A	no
Q52QW2	CRTS2_ONCHC	5, ., 2, ., 1, ., 1, 3	0.7972	0.7495	0.7393	N/A	no
Q52QW3	CRTS1_ONCHC	5, ., 2, ., 1, ., 1, 3	0.7995	0.7495	0.7393	N/A	no
Q2VEX9	CRTSO_DAUCA	5, ., 2, ., 1, ., 1, 3	0.7485	0.8531	0.8032	N/A	no
Q9M9Y8	CRTSO_ARATH	5, ., 2, ., 1, ., 1, 3	0.8614	0.7443	0.7243	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		579
TIGR02730		493	TIGR02730, carot_isom, carotene isomerase	0.0
COG1233		487	COG1233, COG1233, Phytoene dehydrogenase and relat	4e-72
TIGR02734		502	TIGR02734, crtI_fam, phytoene desaturase	5e-35
TIGR02733		492	TIGR02733, desat_CrtD, C-3',4' desaturase CrtD	2e-31
pfam13450		66	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-	1e-12
COG1232		444	COG1232, HemY, Protoporphyrinogen oxidase [Coenzym	5e-09
pfam01593		444	pfam01593, Amino_oxidase, Flavin containing amine	1e-08
PRK05249		461	PRK05249, PRK05249, soluble pyridine nucleotide tr	2e-07
pfam01266		234	pfam01266, DAO, FAD dependent oxidoreductase	4e-07
COG0665		387	COG0665, DadA, Glycine/D-amino acid oxidases (deam	9e-07
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	9e-07
COG0644		396	COG0644, FixC, Dehydrogenases (flavoproteins) [Ene	2e-06
PRK12834		549	PRK12834, PRK12834, putative FAD-binding dehydroge	2e-06
COG1249		454	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas	2e-06
COG1053		562	COG1053, SdhA, Succinate dehydrogenase/fumarate re	3e-06
PRK07121		492	PRK07121, PRK07121, hypothetical protein; Validate	6e-06
PRK07233		434	PRK07233, PRK07233, hypothetical protein; Provisio	7e-06
pfam00890		401	pfam00890, FAD_binding_2, FAD binding domain	9e-06
PRK07804		541	PRK07804, PRK07804, L-aspartate oxidase; Provision	4e-05
COG3573		552	COG3573, COG3573, Predicted oxidoreductase [Genera	4e-05
PRK12839		572	PRK12839, PRK12839, hypothetical protein; Provisio	5e-05
PRK11259		376	PRK11259, solA, N-methyltryptophan oxidase; Provis	6e-05
PRK12844		557	PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrog	6e-05
PRK07843		557	PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrog	1e-04
PRK06370		463	PRK06370, PRK06370, mercuric reductase; Validated	1e-04
PLN02328		808	PLN02328, PLN02328, lysine-specific histone demeth	2e-04
PRK06134		581	PRK06134, PRK06134, putative FAD-binding dehydroge	2e-04
TIGR02032		295	TIGR02032, GG-red-SF, geranylgeranyl reductase fam	2e-04
COG1635		262	COG1635, THI4, Ribulose 1,5-bisphosphate synthetas	2e-04
PRK04176		257	PRK04176, PRK04176, ribulose-1,5-biphosphate synth	2e-04
PRK12843		578	PRK12843, PRK12843, putative FAD-binding dehydroge	2e-04
PRK08163		396	PRK08163, PRK08163, salicylate hydroxylase; Provis	2e-04
PRK12842		574	PRK12842, PRK12842, putative succinate dehydrogena	2e-04
pfam12831		415	pfam12831, FAD_oxidored, FAD dependent oxidoreduct	2e-04
pfam01946		229	pfam01946, Thi4, Thi4 family	2e-04
COG0654		387	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox	2e-04
PRK10157		428	PRK10157, PRK10157, putative oxidoreductase FixC;	3e-04
PRK07208		479	PRK07208, PRK07208, hypothetical protein; Provisio	3e-04
PRK06292		460	PRK06292, PRK06292, dihydrolipoamide dehydrogenase	3e-04
COG0562		374	COG0562, Glf, UDP-galactopyranose mutase [Cell env	3e-04
TIGR01350		460	TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog	4e-04
PLN02576		496	PLN02576, PLN02576, protoporphyrinogen oxidase	4e-04
PRK08274		466	PRK08274, PRK08274, tricarballylate dehydrogenase;	4e-04
PRK11883		451	PRK11883, PRK11883, protoporphyrinogen oxidase; Re	4e-04
TIGR00292		254	TIGR00292, TIGR00292, thiazole biosynthesis enzyme	5e-04
PTZ00367		567	PTZ00367, PTZ00367, squalene epoxidase; Provisiona	7e-04
PRK05192		618	PRK05192, PRK05192, tRNA uridine 5-carboxymethylam	8e-04
TIGR01377		380	TIGR01377, soxA_mon, sarcosine oxidase, monomeric	9e-04
TIGR01438		484	TIGR01438, TGR, thioredoxin and glutathione reduct	9e-04
pfam07992		283	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp	0.001
pfam03486		405	pfam03486, HI0933_like, HI0933-like protein	0.001
COG2081		408	COG2081, COG2081, Predicted flavoproteins [General	0.001
PRK06416		462	PRK06416, PRK06416, dihydrolipoamide dehydrogenase	0.002
PRK11728		393	PRK11728, PRK11728, hydroxyglutarate oxidase; Prov	0.002
COG0029		518	COG0029, NadB, Aspartate oxidase [Coenzyme metabol	0.002
PRK05329		422	PRK05329, PRK05329, anaerobic glycerol-3-phosphate	0.003
PRK06116		450	PRK06116, PRK06116, glutathione reductase; Validat	0.003
PRK06481		506	PRK06481, PRK06481, fumarate reductase flavoprotei	0.003
PRK07233		434	PRK07233, PRK07233, hypothetical protein; Provisio	0.004
PTZ00052		499	PTZ00052, PTZ00052, thioredoxin reductase; Provisi	0.004
PRK06183		500	PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr	0.004

>gnl\|CDD\|131777 TIGR02730, carot_isom, carotene isomerase	Back alignment and domain information

 Score =  759 bits (1962), Expect = 0.0
 Identities = 291/422 (68%), Positives = 352/422 (83%), Gaps = 2/422 (0%)

Query: 158 YDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFS 217
           YDAIVIGSGIGGLV ATQLAVKGA+VLVLE+Y+IPGGS+GY+ER+GY FDVG+S++FGF 
Sbjct: 1   YDAIVIGSGIGGLVTATQLAVKGAKVLVLERYLIPGGSAGYFEREGYRFDVGASMIFGFG 60

Query: 218 DKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKE 277
           DKG  NL+T+ALAAVG ++E IPDP  +H+HLPN L+V+VHREY DF+ EL +KFPHEKE
Sbjct: 61  DKGTTNLLTRALAAVGRKLETIPDPVQIHYHLPNGLNVKVHREYDDFIQELVAKFPHEKE 120

Query: 278 GVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYI 337
           G+  FY ECW++FN LNS+EL SLEEP YLF  FFK PL CL LA YLPQNAG+IAR+YI
Sbjct: 121 GIRRFYDECWQVFNCLNSMELLSLEEPRYLFRVFFKHPLACLGLAKYLPQNAGDIARRYI 180

Query: 338 KDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLA 397
           +DP LL FID ECF  S + A QTPMINA MV  DRH+GGINYP GGVG IA+SL KGL 
Sbjct: 181 RDPGLLKFIDIECFCWSVVPADQTPMINAGMVFSDRHYGGINYPKGGVGQIAESLVKGLE 240

Query: 398 DKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKE 457
             G +I Y+A VTK+ILE GKAVGV+L+DG + YAK I+SNATRWDTFGKLLK E LPK+
Sbjct: 241 KHGGQIRYRARVTKIILENGKAVGVKLADGEKIYAKRIVSNATRWDTFGKLLKAENLPKK 300

Query: 458 EENFQKLYVKAPSFLSIHMGVKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLD 517
           E+N+Q+ YVK+PSFLS+H+GVKA+VLPP T+CHH +LE DW  LE+P G+IF+SIPT+LD
Sbjct: 301 EKNWQRNYVKSPSFLSLHLGVKADVLPPGTECHHILLE-DWTNLEKPQGTIFVSIPTLLD 359

Query: 518 SSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLKQSIAFR 577
            SLAPEGHHI+H FT  S+EDW+GL+ KDY+AKKE  A+ II+RLE K+FPGL  +I ++
Sbjct: 360 PSLAPEGHHIIHTFTPSSMEDWQGLSPKDYEAKKEADAERIIDRLE-KIFPGLDSAIDYK 418

Query: 578 EV 579
           EV
Sbjct: 419 EV 420

Members of this family, including sll0033 (crtH) of Synechocystis sp. PCC 6803, catalyze a cis-trans isomerization of carotenes to the all-trans lycopene, a reaction that can also occur non-enzymatically in light through photoisomerization [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]. Length = 493

>gnl\|CDD\|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|233988 TIGR02734, crtI_fam, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD	Back alignment and domain information

>gnl\|CDD\|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain	Back alignment and domain information

>gnl\|CDD\|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase	Back alignment and domain information

>gnl\|CDD\|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|216400 pfam01266, DAO, FAD dependent oxidoreductase	Back alignment and domain information

>gnl\|CDD\|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|180854 PRK07121, PRK07121, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|235977 PRK07233, PRK07233, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|216176 pfam00890, FAD_binding_2, FAD binding domain	Back alignment and domain information

>gnl\|CDD\|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|237223 PRK12839, PRK12839, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236887 PRK11259, solA, N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|236111 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|235787 PRK06370, PRK06370, mercuric reductase; Validated	Back alignment and domain information

>gnl\|CDD\|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>gnl\|CDD\|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family	Back alignment and domain information

>gnl\|CDD\|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional	Back alignment and domain information

>gnl\|CDD\|237224 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase	Back alignment and domain information

>gnl\|CDD\|145231 pfam01946, Thi4, Thi4 family	Back alignment and domain information

>gnl\|CDD\|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional	Back alignment and domain information

>gnl\|CDD\|235967 PRK07208, PRK07208, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase	Back alignment and domain information

>gnl\|CDD\|215314 PLN02576, PLN02576, protoporphyrinogen oxidase	Back alignment and domain information

>gnl\|CDD\|236214 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>gnl\|CDD\|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme	Back alignment and domain information

>gnl\|CDD\|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|235362 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>gnl\|CDD\|130444 TIGR01377, soxA_mon, sarcosine oxidase, monomeric form	Back alignment and domain information

>gnl\|CDD\|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>gnl\|CDD\|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase	Back alignment and domain information

>gnl\|CDD\|217590 pfam03486, HI0933_like, HI0933-like protein	Back alignment and domain information

>gnl\|CDD\|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>gnl\|CDD\|223108 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>gnl\|CDD\|235701 PRK06116, PRK06116, glutathione reductase; Validated	Back alignment and domain information

>gnl\|CDD\|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>gnl\|CDD\|235977 PRK07233, PRK07233, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		579
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	100.0
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	100.0
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	100.0
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	100.0
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	100.0
PRK07233		434	hypothetical protein; Provisional	99.96
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	99.95
PLN02612		567	phytoene desaturase	99.95
PRK11883		451	protoporphyrinogen oxidase; Reviewed	99.95
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	99.95
PRK12416		463	protoporphyrinogen oxidase; Provisional	99.94
PRK07208		479	hypothetical protein; Provisional	99.94
PLN02487		569	zeta-carotene desaturase	99.93
COG0493		457	GltD NADPH-dependent glutamate synthase beta chain	99.93
PLN02576		496	protoporphyrinogen oxidase	99.93
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	99.92
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	99.92
PRK12779		944	putative bifunctional glutamate synthase subunit b	99.9
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	99.9
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	99.9
PLN02268		435	probable polyamine oxidase	99.89
PRK12831		464	putative oxidoreductase; Provisional	99.89
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	99.88
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	99.88
PLN02676		487	polyamine oxidase	99.87
PLN02529		738	lysine-specific histone demethylase 1	99.87
PLN02568		539	polyamine oxidase	99.86
KOG0399		2142	consensus Glutamate synthase [Amino acid transport	99.86
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	99.86
PLN02328		808	lysine-specific histone demethylase 1 homolog	99.86
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	99.86
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	99.86
PLN03000		881	amine oxidase	99.85
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	99.84
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	99.84
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	99.84
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	99.83
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	99.82
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	99.82
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	99.81
PLN02976		1713	amine oxidase	99.81
COG2907		447	Predicted NAD/FAD-binding protein [General functio	99.76
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	99.75
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	99.73
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	99.72
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	99.7
COG3349		485	Uncharacterized conserved protein [Function unknow	99.67
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	99.66
PRK12814		652	putative NADPH-dependent glutamate synthase small	99.65
PRK13984		604	putative oxidoreductase; Provisional	99.64
PRK13977		576	myosin-cross-reactive antigen; Provisional	99.57
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	99.56
PRK06567		1028	putative bifunctional glutamate synthase subunit b	99.54
COG2081		408	Predicted flavoproteins [General function predicti	99.51
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	99.5
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	99.43
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	99.37
COG0579		429	Predicted dehydrogenase [General function predicti	99.35
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	99.35
PF14691		111	Fer4_20: Dihydroprymidine dehydrogenase domain II,	99.35
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	99.31
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	99.3
PRK11728		393	hydroxyglutarate oxidase; Provisional	99.28
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	99.27
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	99.27
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	99.26
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	99.25
PTZ00383		497	malate:quinone oxidoreductase; Provisional	99.24
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	99.23
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	99.23
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	99.23
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	99.22
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.21
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	99.21
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	99.21
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	99.21
PRK08274		466	tricarballylate dehydrogenase; Validated	99.2
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	99.2
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	99.2
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	99.16
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	99.15
PRK12842		574	putative succinate dehydrogenase; Reviewed	99.14
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	99.14
PRK07121		492	hypothetical protein; Validated	99.13
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	99.1
PRK06847		375	hypothetical protein; Provisional	99.1
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	99.09
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	99.09
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	99.08
PRK10157		428	putative oxidoreductase FixC; Provisional	99.08
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.07
PLN02464		627	glycerol-3-phosphate dehydrogenase	99.07
PRK13339		497	malate:quinone oxidoreductase; Reviewed	99.04
PRK05257		494	malate:quinone oxidoreductase; Validated	99.04
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	99.04
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	99.03
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	99.03
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.02
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	99.01
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	99.01
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	99.01
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	99.01
PRK07190		487	hypothetical protein; Provisional	98.99
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.98
PRK06175		433	L-aspartate oxidase; Provisional	98.98
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	98.98
PRK06184		502	hypothetical protein; Provisional	98.98
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	98.97
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	98.97
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	98.96
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	98.96
PLN02661		357	Putative thiazole synthesis	98.96
PRK06834		488	hypothetical protein; Provisional	98.96
PRK08163		396	salicylate hydroxylase; Provisional	98.96
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	98.96
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	98.96
PRK10015		429	oxidoreductase; Provisional	98.96
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	98.96
PRK07236		386	hypothetical protein; Provisional	98.96
PRK06185		407	hypothetical protein; Provisional	98.95
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	98.95
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	98.95
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	98.95
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	98.93
PRK07804		541	L-aspartate oxidase; Provisional	98.93
PRK07588		391	hypothetical protein; Provisional	98.92
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	98.92
PRK09126		392	hypothetical protein; Provisional	98.92
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	98.92
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	98.92
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	98.91
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	98.91
PRK07045		388	putative monooxygenase; Reviewed	98.91
PRK08013		400	oxidoreductase; Provisional	98.91
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	98.9
KOG1439		440	consensus RAB proteins geranylgeranyltransferase c	98.9
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	98.9
PRK12839		572	hypothetical protein; Provisional	98.89
TIGR00275		400	flavoprotein, HI0933 family. The model when search	98.89
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	98.88
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	98.87
PLN02697		529	lycopene epsilon cyclase	98.87
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	98.87
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	98.87
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	98.87
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	98.86
PRK07395		553	L-aspartate oxidase; Provisional	98.86
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	98.86
PRK05868		372	hypothetical protein; Validated	98.86
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	98.85
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	98.85
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	98.85
PRK08244		493	hypothetical protein; Provisional	98.85
PRK08275		554	putative oxidoreductase; Provisional	98.84
PRK08401		466	L-aspartate oxidase; Provisional	98.84
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	98.84
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	98.84
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	98.84
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	98.83
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	98.83
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	98.82
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	98.81
PLN02463		447	lycopene beta cyclase	98.8
PLN02815		594	L-aspartate oxidase	98.79
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	98.79
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	98.79
PRK08071		510	L-aspartate oxidase; Provisional	98.79
PRK06753		373	hypothetical protein; Provisional	98.79
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	98.79
PRK08132		547	FAD-dependent oxidoreductase; Provisional	98.78
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	98.78
PRK06475		400	salicylate hydroxylase; Provisional	98.77
PRK06126		545	hypothetical protein; Provisional	98.77
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.76
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	98.76
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	98.76
PRK07512		513	L-aspartate oxidase; Provisional	98.76
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.76
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	98.74
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	98.74
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	98.73
PRK09077		536	L-aspartate oxidase; Provisional	98.73
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	98.72
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	98.72
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	98.72
PRK07538		413	hypothetical protein; Provisional	98.7
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	98.7
PRK06116		450	glutathione reductase; Validated	98.7
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	98.69
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	98.68
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	98.65
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	98.65
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	98.64
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	98.63
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	98.63
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	98.62
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	98.61
PLN02985		514	squalene monooxygenase	98.61
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	98.61
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	98.6
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	98.6
PRK06996		398	hypothetical protein; Provisional	98.6
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	98.6
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	98.59
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	98.59
PRK11445		351	putative oxidoreductase; Provisional	98.58
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	98.58
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	98.55
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	98.55
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	98.54
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	98.51
PLN02507		499	glutathione reductase	98.49
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	98.49
KOG1298		509	consensus Squalene monooxygenase [Lipid transport	98.49
PRK08294		634	phenol 2-monooxygenase; Provisional	98.47
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	98.47
PRK09897		534	hypothetical protein; Provisional	98.47
PTZ00367		567	squalene epoxidase; Provisional	98.43
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	98.41
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	98.39
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	98.38
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	98.38
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	98.37
KOG2415		621	consensus Electron transfer flavoprotein ubiquinon	98.35
KOG2404		477	consensus Fumarate reductase, flavoprotein subunit	98.32
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	98.32
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	98.31
KOG2852		380	consensus Possible oxidoreductase [General functio	98.31
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	98.3
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	98.29
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	98.28
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	98.26
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	98.23
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	98.22
KOG0042		680	consensus Glycerol-3-phosphate dehydrogenase [Ener	98.2
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	98.19
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	98.16
PLN02852		491	ferredoxin-NADP+ reductase	98.16
PRK07845		466	flavoprotein disulfide reductase; Reviewed	98.16
KOG2853		509	consensus Possible oxidoreductase [General functio	98.14
KOG2614		420	consensus Kynurenine 3-monooxygenase and related f	98.12
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	98.11
COG3573		552	Predicted oxidoreductase [General function predict	98.1
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	98.09
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	98.04
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	98.02
PRK14694		468	putative mercuric reductase; Provisional	98.01
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	98.0
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	97.98
PRK06370		463	mercuric reductase; Validated	97.98
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	97.98
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.97
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	97.97
PLN02785		587	Protein HOTHEAD	97.95
KOG1399		448	consensus Flavin-containing monooxygenase [Seconda	97.94
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	97.93
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	97.92
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	97.88
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	97.87
TIGR02053		463	MerA mercuric reductase. This model represents the	97.86
PTZ00058		561	glutathione reductase; Provisional	97.86
PTZ00188		506	adrenodoxin reductase; Provisional	97.82
PRK10262		321	thioredoxin reductase; Provisional	97.82
PRK13748		561	putative mercuric reductase; Provisional	97.82
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	97.8
PRK09564		444	coenzyme A disulfide reductase; Reviewed	97.78
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	97.78
PRK14727		479	putative mercuric reductase; Provisional	97.77
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	97.76
KOG2665		453	consensus Predicted FAD-dependent oxidoreductase [	97.76
PTZ00052		499	thioredoxin reductase; Provisional	97.74
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.71
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	97.71
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	97.69
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.69
PLN02546		558	glutathione reductase	97.65
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	97.6
PRK12770		352	putative glutamate synthase subunit beta; Provisio	97.6
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	97.59
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	97.58
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	97.55
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	97.52
COG4716		587	Myosin-crossreactive antigen [Function unknown]	97.49
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	97.48
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	97.47
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	97.46
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	97.44
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	97.43
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	97.42
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	97.42
PRK14989		847	nitrite reductase subunit NirD; Provisional	97.41
KOG2311		679	consensus NAD/FAD-utilizing protein possibly invol	97.39
PRK07845		466	flavoprotein disulfide reductase; Reviewed	97.38
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	97.38
KOG0405		478	consensus Pyridine nucleotide-disulphide oxidoredu	97.34
PRK14989		847	nitrite reductase subunit NirD; Provisional	97.31
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	97.3
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	97.29
KOG1238		623	consensus Glucose dehydrogenase/choline dehydrogen	97.29
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.29
PRK02106		560	choline dehydrogenase; Validated	97.28
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	97.27
PRK06370		463	mercuric reductase; Validated	97.23
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.23
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	97.21
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	97.17
PRK07846		451	mycothione reductase; Reviewed	97.17
TIGR02053		463	MerA mercuric reductase. This model represents the	97.16
PTZ00052		499	thioredoxin reductase; Provisional	97.16
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	97.14
COG4529		474	Uncharacterized protein conserved in bacteria [Fun	97.13
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	97.13
PRK13512		438	coenzyme A disulfide reductase; Provisional	97.11
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	97.11
PRK09564		444	coenzyme A disulfide reductase; Reviewed	97.1
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.08
PRK14694		468	putative mercuric reductase; Provisional	97.08
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	97.08
PRK14727		479	putative mercuric reductase; Provisional	97.05
PRK13748		561	putative mercuric reductase; Provisional	97.04
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	97.01
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	97.01
PRK07846		451	mycothione reductase; Reviewed	96.99
KOG2960		328	consensus Protein involved in thiamine biosynthesi	96.98
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	96.95
PTZ00058		561	glutathione reductase; Provisional	96.93
KOG1800		468	consensus Ferredoxin/adrenodoxin reductase [Nucleo	96.88
KOG4716		503	consensus Thioredoxin reductase [Posttranslational	96.79
PLN02546		558	glutathione reductase	96.78
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	96.71
PRK10262		321	thioredoxin reductase; Provisional	96.69
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	96.56
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	96.46
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	96.44
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	96.43
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	96.43
PRK13512		438	coenzyme A disulfide reductase; Provisional	96.39
KOG4405		547	consensus GDP dissociation inhibitor [Signal trans	96.36
PF07156		368	Prenylcys_lyase: Prenylcysteine lyase; InterPro: I	96.03
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	95.9
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	95.73
COG3486		436	IucD Lysine/ornithine N-monooxygenase [Secondary m	95.51
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	95.44
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	95.26
COG1206		439	Gid NAD(FAD)-utilizing enzyme possibly involved in	95.1
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	95.1
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	94.98
KOG0404		322	consensus Thioredoxin reductase [Posttranslational	94.96
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	94.69
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	94.68
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	94.64
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.63
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	94.53
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	94.42
KOG3855		481	consensus Monooxygenase involved in coenzyme Q (ub	94.41
COG0569		225	TrkA K+ transport systems, NAD-binding component [	94.17
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	94.11
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	93.96
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	93.95
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	93.91
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	93.84
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	93.79
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	93.78
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.72
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.51
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.51
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	93.25
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	93.1
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.09
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	92.97
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	92.92
PLN02507		499	glutathione reductase	92.86
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	92.8
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	92.68
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	92.53
PRK06116		450	glutathione reductase; Validated	92.47
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	92.46
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	92.22
COG1902		363	NemA NADH:flavin oxidoreductases, Old Yellow Enzym	92.11
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	92.08
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	92.08
KOG3923		342	consensus D-aspartate oxidase [Amino acid transpor	91.83
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	91.82
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	91.81
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	91.68
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	91.56
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	91.52
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	91.5
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	91.49
PRK04148		134	hypothetical protein; Provisional	91.44
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	91.44
PRK08268		507	3-hydroxy-acyl-CoA dehydrogenase; Validated	91.35
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	91.32
PRK06719		157	precorrin-2 dehydrogenase; Validated	91.32
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	91.2
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	91.17
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	91.13
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	91.12
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	91.05
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	91.01
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	90.97
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	90.7
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	90.69
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	90.66
PRK12831		464	putative oxidoreductase; Provisional	90.55
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	90.48
PTZ00153		659	lipoamide dehydrogenase; Provisional	90.32
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	90.25
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	90.02
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	89.95
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	89.9
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	89.88
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	89.83
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	89.79
PTZ00082		321	L-lactate dehydrogenase; Provisional	89.78
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	89.67
PRK02106		560	choline dehydrogenase; Validated	89.6
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.59
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	89.58
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	89.56
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	89.46
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	89.38
PRK02472		447	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.38
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.3
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	89.29
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	89.15
KOG2755		334	consensus Oxidoreductase [General function predict	89.07
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	89.07
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	89.04
COG1251		793	NirB NAD(P)H-nitrite reductase [Energy production	89.04
PRK12770		352	putative glutamate synthase subunit beta; Provisio	88.99
PRK08306		296	dipicolinate synthase subunit A; Reviewed	88.89
KOG1346		659	consensus Programmed cell death 8 (apoptosis-induc	88.72
PRK07417		279	arogenate dehydrogenase; Reviewed	88.71
PRK15057		388	UDP-glucose 6-dehydrogenase; Provisional	88.63
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	88.54
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	88.5
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	88.3
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	88.28
PRK04690		468	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	88.21
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	88.19
PRK00421		461	murC UDP-N-acetylmuramate--L-alanine ligase; Provi	88.13
PLN02353		473	probable UDP-glucose 6-dehydrogenase	88.12
PRK12548		289	shikimate 5-dehydrogenase; Provisional	88.03
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	88.01
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	87.83
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	87.81
PRK06223		307	malate dehydrogenase; Reviewed	87.77
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	87.7
PRK11730		715	fadB multifunctional fatty acid oxidation complex	87.59
PRK15116		268	sulfur acceptor protein CsdL; Provisional	87.56
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	87.52
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	87.45
KOG3851		446	consensus Sulfide:quinone oxidoreductase/flavo-bin	87.31
PF13478		136	XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2	87.21
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	87.16
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	87.15
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	87.11
cd02929		370	TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH)	87.11
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	87.02
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	87.0
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	86.76
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	86.74
PRK03806		438	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	86.65
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	86.57
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	86.47
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	86.34
PTZ00117		319	malate dehydrogenase; Provisional	86.31
KOG2304		298	consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t	86.29
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	86.28
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	86.23
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	86.12
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	85.91
PRK02006		498	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.81
COG2084		286	MmsB 3-hydroxyisobutyrate dehydrogenase and relate	85.8
PRK01368		454	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.62
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	85.56
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	85.53
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	85.47
PRK09496		453	trkA potassium transporter peripheral membrane com	85.31
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	85.27
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	85.23
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	85.18
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	85.08
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	85.05
PRK01390		460	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.92
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	84.9
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	84.82
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	84.69
PRK03803		448	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	84.66
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	84.54
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	84.52
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	84.48
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	84.48
PRK08328		231	hypothetical protein; Provisional	84.43
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	84.35
PRK12779		944	putative bifunctional glutamate synthase subunit b	84.33
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	84.32
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	84.21
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	84.03

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

Probab=100.00  E-value=2.4e-50  Score=440.37  Aligned_cols=420  Identities=69%  Similarity=1.210  Sum_probs=345.7

Q ss_pred             ccEEEECCChhHHHHHHHHHHcCCcEEEEecCCCCCcceeEEeeCCeeeccccccccCCCCCCChHHHHHHHHHcCCcee
Q 008069          158 YDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCEME  237 (579)
Q Consensus       158 ~~v~viG~g~~g~~~a~~l~~~g~~v~~~e~~~~~gg~~~t~~~~g~~~~~G~~~~~g~~~~~~~~~~~~~l~~~g~~~~  237 (579)
                      +||+|||||++||++|..|+++|++|+|+||++.+||+++++..+||.||.|++.+.++.+...++.+.+.+..+|..++
T Consensus         1 ~dvvViGaG~~Gl~aA~~La~~G~~V~vlE~~~~~GG~~~~~~~~G~~fd~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (493)
T TIGR02730         1 YDAIVIGSGIGGLVTATQLAVKGAKVLVLERYLIPGGSAGYFEREGYRFDVGASMIFGFGDKGTTNLLTRALAAVGRKLE   80 (493)
T ss_pred             CcEEEECCcHHHHHHHHHHHHCCCcEEEEECCCCCCCceeEeccCCEEEEecchhheecCCcccccHHHHHHHHcCCccc
Confidence            68999999999999999999999999999999999999999999999999999999887655566677888888887777


Q ss_pred             EeeCCCeEEEEcCCCceEEecCCHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHhhhhhhhccchhhHHHhhhhcChhh
Q 008069          238 VIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLE  317 (579)
Q Consensus       238 ~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~p~~~~~i~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (579)
                      ..+......+.+++|..+.++.+++++.+++.+.+|++.+++++|++.....+..+.......+..+..+...+...+..
T Consensus        81 ~~~~~~~~~~~~~~g~~~~~~~d~~~~~~~l~~~~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (493)
T TIGR02730        81 TIPDPVQIHYHLPNGLNVKVHREYDDFIQELVAKFPHEKEGIRRFYDECWQVFNCLNSMELLSLEEPRYLFRVFFKHPLA  160 (493)
T ss_pred             ccCCCccEEEECCCCeeEeeecCHHHHHHHHHHHCchhHHHHHHHHHHHHHHHHHHHhhhhccccChHHHHHHHhhchhh
Confidence            66665566777888888999999999999999999999999999999887776644332111112222222222222222


Q ss_pred             hhHHhhhccccHHHHHHHhcCCHHHHHHHhhhhhhhhcCCCCCchHHHHHHHHhhhhcCccceeCCChHHHHHHHHHHHH
Q 008069          318 CLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSLAKGLA  397 (579)
Q Consensus       318 ~~~~~~~~~~s~~~~l~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~p~gG~~~l~~aL~~~l~  397 (579)
                      ...+..+..+++.+++++++.++.++.++...+.+++...+.++|+.+....+.....+++++|.||+..++++|.+.++
T Consensus       161 ~~~~~~~~~~s~~~~~~~~~~~~~l~~~l~~~~~~~~~~p~~~~p~~~~~~~~~~~~~~g~~~~~gG~~~l~~~L~~~~~  240 (493)
T TIGR02730       161 CLGLAKYLPQNAGDIARRYIRDPGLLKFIDIECFCWSVVPADQTPMINAGMVFSDRHYGGINYPKGGVGQIAESLVKGLE  240 (493)
T ss_pred             hhHHHHHhhccHHHHHHHhcCCHHHHHHHHHHHHhccCCCcccchhhhHHHhhcccccceEecCCChHHHHHHHHHHHHH
Confidence            22334455689999999999999999999887776664445777776665554444457889999999999999999999


Q ss_pred             HcCceEEeCceeeEEEEeCCEEEEEEeCCCcEEEcCEEEECCChhHHHhhccCCCCCChHHHHHHHhhccCCCeEEEEEe
Q 008069          398 DKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFLSIHMG  477 (579)
Q Consensus       398 ~~G~~I~l~~~V~~I~~~~~~v~gV~~~dG~~i~Ad~VV~a~~~~~~~~~Ll~~~~lp~~~~~~~~~~~~~~s~~~v~lg  477 (579)
                      ++|++|+++++|++|..+++++.+|++.+|++++||.||+|++++.++.+|++++.+++..+...+.++++++.+++|++
T Consensus       241 ~~G~~i~~~~~V~~I~~~~~~~~gv~~~~g~~~~ad~vV~a~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~s~s~~~~~l~  320 (493)
T TIGR02730       241 KHGGQIRYRARVTKIILENGKAVGVKLADGEKIYAKRIVSNATRWDTFGKLLKAENLPKKEKNWQRNYVKSPSFLSLHLG  320 (493)
T ss_pred             HCCCEEEeCCeeeEEEecCCcEEEEEeCCCCEEEcCEEEECCChHHHHHHhCCccccchhhHHHHhhccCCCceEEEEEE
Confidence            99999999999999999989999999999999999999999999999888998777776655566677888899999999


Q ss_pred             ecCCcCCCCCCccceeeccchhhhcCCcceEEEEcCCCCCCCCCCCCeeEEEEEeccchhhhcCCChhhHHHHHHHHHHH
Q 008069          478 VKAEVLPPDTDCHHFVLEDDWNRLEEPYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADE  557 (579)
Q Consensus       478 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~i~~~~~s~~dp~~aP~G~~~l~~~~~~~~~~w~~~~~~~y~~~ke~~~~~  557 (579)
                      ++.+..|.....|++++ ++|+.+..+.+++|+++||..||+++|+|+++++++++.+++.|.+++.++|++.|++++++
T Consensus       321 l~~~~~p~~~~~~~~~~-~~~~~~~~~~~~~~v~~ps~~dps~aP~G~~~i~~~~~~~~~~w~~~~~~~y~~~k~~~~~~  399 (493)
T TIGR02730       321 VKADVLPPGTECHHILL-EDWTNLEKPQGTIFVSIPTLLDPSLAPEGHHIIHTFTPSSMEDWQGLSPKDYEAKKEADAER  399 (493)
T ss_pred             ecCccCCCCCCccEEec-chhhccCCCCCeEEEEeCCCCCCCCCcCCcEEEEEecCCChhhccCCCcHHHHHHHHHHHHH
Confidence            99876554444466665 34666556667899999999999999999999999998888899988888999999999999


Q ss_pred             HHHHHHHhhCCCCCCCeEEEEC
Q 008069          558 IINRLENKLFPGLKQSIAFREV  579 (579)
Q Consensus       558 il~~le~~~~P~l~~~I~~~~v  579 (579)
                      +++.|+ +++|+|+++|+++++
T Consensus       400 il~~l~-~~~p~l~~~I~~~~~  420 (493)
T TIGR02730       400 IIDRLE-KIFPGLDSAIDYKEV  420 (493)
T ss_pred             HHHHHH-HHCCChhhcEEEEEe
Confidence            999999 789999999999875

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism]	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion]	Back alignment and domain information

>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>KOG2852 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>KOG2853 consensus Possible oxidoreductase [General function prediction only]	Back alignment and domain information

>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only]	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown]	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>COG4716 Myosin-crossreactive antigen [Function unknown]	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only]	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG4529 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only]	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

Back alignment and domain information

>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion]	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>KOG2755 consensus Oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion]	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms]	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK15057 UDP-glucose 6-dehydrogenase; Provisional	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>PLN02353 probable UDP-glucose 6-dehydrogenase	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion]	Back alignment and domain information

>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]	Back alignment and domain information

>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		579
4dgk_A		501	Crystal Structure Of Phytoene Desaturase Crti From		6e-16

>pdb|4DGK|A Chain A, Crystal Structure Of Phytoene Desaturase Crti From Pantoea Ananatis Length = 501

Back alignment and structure

Iteration: 1

Score = 82.4 bits (202), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 105/430 (24%), Positives = 170/430 (39%), Gaps = 39/430 (9%) Query: 162 VIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGN 221 VIG+G GGL A +L G VL+LE+ PGG + YE G+TFD G +V+ + Sbjct: 6 VIGAGFGGLALAIRLQAAGIPVLLLEQRDKPGGRAYVYEDQGFTFDAGPTVI------TD 59 Query: 222 LNLITQALAAVGCEM----EVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKE 277 + I + A G ++ E++P + + + A++ P + E Sbjct: 60 PSAIEELFALAGKQLKEYVELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVE 119 Query: 278 GVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYI 337 G F +F L+L ++ P F + + L + ++ + YI Sbjct: 120 GYRQFLDYSRAVFKE-GYLKLGTV--PFLSFRDMLRAAPQLAKLQAW--RSVYSKVASYI 174 Query: 338 KDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFXXXXXXXXXXXXXAKSLAKGLA 397 +D L +V N T I + +R + + + K Sbjct: 175 EDEHLRQAFSFHSLLVGG-NPFATSSIYTLIHALEREWGVWFPRGGTGAL-VQGMIKLFQ 232 Query: 398 DKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKE 457 D G E++ A V+ + K V L DGR F + + SNA T+ LL Q P Sbjct: 233 DLGGEVVLNARVSHMETTGNKIEAVHLEDGRRFLTQAVASNADVVHTYRDLLS--QHPAA 290 Query: 458 EENFQKLYVK--APSFLSIHMGVKAEVLPPDTDCHHFV---------LEDDWNR--LEEP 504 + KL K + S ++ G+ D HH V +++ +N L E Sbjct: 291 VKQSNKLQTKRMSNSLFVLYFGLNHH---HDQLAHHTVCFGPRYRELIDEIFNHDGLAED 347 Query: 505 YGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLEN 564 + S++L P V DSSLAPEG + + + G A D+ + + D I LE Sbjct: 348 F-SLYLHAPCVTDSSLAPEG---CGSYYVLAPVPHLGTANLDWTVEGPKLRDRIFAYLEQ 403 Query: 565 KLFPGLKQSI 574 PGL+ + Sbjct: 404 HYMPGLRSQL 413

PyMOL of 4dgk

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		579
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	1e-103
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	8e-83
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	3e-32
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	8e-26
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	8e-18
3utf_A		513	UDP-galactopyranose mutase; nucleotide binding, fl	3e-15
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	9e-14
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	1e-13
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	5e-13
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	5e-13
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	9e-13
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	1e-12
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	1e-12
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	4e-11
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	5e-11
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	5e-11
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	8e-11
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	1e-10
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	4e-10
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	1e-09
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	1e-09
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	1e-09
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	1e-09
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	1e-09
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	2e-09
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	4e-09
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	5e-09
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	6e-09
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	7e-09
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	8e-09
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	2e-08
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	3e-08
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	3e-08
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	7e-08
3atr_A		453	Conserved archaeal protein; saturating double bond	7e-08
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	1e-07
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	2e-07
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	2e-07
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	3e-07
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	3e-07
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	4e-07
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	5e-07
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	7e-07
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	9e-07
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	2e-06
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	3e-06
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	3e-06
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	4e-06
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	4e-06
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	5e-06
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	5e-06
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	6e-06
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	6e-06
4dna_A		463	Probable glutathione reductase; structural genomic	7e-06
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	8e-06
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	1e-05
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	1e-05
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	1e-05
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	2e-05
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	2e-05
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	2e-05
2cul_A		232	Glucose-inhibited division protein A-related PROT	2e-05
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	2e-05
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	2e-05
3dme_A		369	Conserved exported protein; structural genomics, P	2e-05
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	4e-05
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	4e-05
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	4e-05
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	4e-05
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	5e-05
1c0p_A		363	D-amino acid oxidase; alpha-beta-alpha motif, flav	5e-05
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	6e-05
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	6e-05
4fk1_A		304	Putative thioredoxin reductase; structural genomic	6e-05
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	6e-05
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	6e-05
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	7e-05
1fec_A		490	Trypanothione reductase; redox-active center, oxid	9e-05
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	1e-04
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	1e-04
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	1e-04
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	1e-04
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	1e-04
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	2e-04
2e1m_A		376	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	2e-04
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	2e-04
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	2e-04
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	3e-04
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	3e-04
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	3e-04
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	3e-04
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	4e-04
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	4e-04
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	4e-04
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	5e-04
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	6e-04
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	6e-04
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	6e-04
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	6e-04
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	7e-04
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	7e-04
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	7e-04
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	7e-04
1ojt_A		482	Surface protein; redox-active center, glycolysis,	8e-04

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425	Back alignment and structure

 Score =  318 bits (817), Expect = e-103
 Identities = 87/425 (20%), Positives = 153/425 (36%), Gaps = 63/425 (14%)

Query: 159 DAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSD 218
             +VIG+G+GGL++A +L+  G  V V E+  I GG        G+    G+  M     
Sbjct: 2   KTVVIGAGLGGLLSAARLSKAGHEVEVFERLPITGGRFTNLSYKGFQLSSGAFHMLPNGP 61

Query: 219 KGNLNLITQALAAVGCEMEVIP-DPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKE 277
            G L    + +      + ++  + TTV   L                       P   +
Sbjct: 62  GGPLACFLKEV---EASVNIVRSEMTTVRVPLKKG-------------------NPDYVK 99

Query: 278 GVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNA--GNIARK 335
           G   F    +  F +L S            +    K  L  ++     P  +      + 
Sbjct: 100 G---FKDISFNDFPSLLS------------YKDRMKIALLIVSTRKNRPSGSSLQAWIKS 144

Query: 336 YIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDR-HFGGINYPVGGVGGIAKSLAK 394
            + D  L+ F D+ C    ++ + + P+     ++ +   FGG   P GG  GI  +L  
Sbjct: 145 QVSDEWLIKFADSFCGWALSLKSDEVPVEEVFEIIENMYRFGGTGIPEGGCKGIIDALET 204

Query: 395 GLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQL 454
            ++  G +I     V+K+++E GKA G+ ++D R   A  +ISN     T          
Sbjct: 205 VISANGGKIHTGQEVSKILIENGKAAGI-IADDRIHDADLVISNLGHAATAVLC-----S 258

Query: 455 PKEEENFQKLYVKAPSFLSIHMGVKAEVLPPDTDC-HHFVLEDDWNRLEEPYGSIFLSIP 513
               +     Y K    L    G+K  +   +    H  VL   + R         ++  
Sbjct: 259 EALSKEADAAYFKMVGTLQPSAGIKICLAADEPLVGHTGVLLTPYTR-----RINGVNEV 313

Query: 514 TVLDSSLAPEGHHILHIFTICSIEDWEGLAQKDYDAKKELVADEIINRLENKLFPGLKQS 573
           T  D  LAP G H+       + E+ +           E   +  +  L+ ++FPG +  
Sbjct: 314 TQADPELAPPGKHLTMCHQYVAPENVK---------NLESEIEMGLEDLK-EIFPGKRYE 363

Query: 574 IAFRE 578
           +   +
Sbjct: 364 VLLIQ 368

PyMOL of 3ka7

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453	Back alignment and structure

>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Length = 232	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382	Back alignment and structure

>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542	Back alignment and structure

>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Length = 472	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		579
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	100.0
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	100.0
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	99.97
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	99.95
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	99.95
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	99.95
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	99.95
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	99.94
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	99.94
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	99.94
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	99.93
2vdc_G		456	Glutamate synthase [NADPH] small chain; oxidoreduc	99.93
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	99.92
4gde_A		513	UDP-galactopyranose mutase; flavin adenine dinucle	99.92
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	99.91
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	99.9
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	99.89
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	99.88
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	99.88
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	99.88
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	99.88
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	99.86
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	99.86
1vg0_A		650	RAB proteins geranylgeranyltransferase component A	99.86
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	99.84
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	99.83
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	99.83
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	99.77
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	99.74
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	99.73
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	99.68
3ayj_A		721	Pro-enzyme of L-phenylalanine oxidase; amino acid	99.68
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	99.65
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	99.65
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	99.64
2e1m_A		376	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	99.63
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	99.46
3dme_A		369	Conserved exported protein; structural genomics, P	99.41
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	99.38
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	99.37
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	99.36
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	99.36
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	99.33
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	99.31
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	99.31
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	99.31
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	99.3
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	99.29
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	99.25
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	99.24
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	99.23
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	99.22
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	99.22
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	99.21
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	99.2
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	99.19
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	99.17
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	99.17
2bry_A		497	NEDD9 interacting protein with calponin homology a	99.17
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	99.16
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	99.14
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	99.13
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	99.13
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	99.13
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	99.12
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	99.12
1o94_A		729	Tmadh, trimethylamine dehydrogenase; electron tran	99.1
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	99.09
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	99.09
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	99.07
2bs2_A		660	Quinol-fumarate reductase flavoprotein subunit A;	99.05
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	99.05
1ps9_A		671	2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel	99.04
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	99.04
3atr_A		453	Conserved archaeal protein; saturating double bond	99.04
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	99.04
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	99.03
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	99.02
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	99.0
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	99.0
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	98.99
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	98.98
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	98.97
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	98.96
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	98.94
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	98.94
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	98.93
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	98.92
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	98.92
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	98.91
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	98.9
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	98.9
1jnr_A		643	Adenylylsulfate reductase; oxidoreductase; HET: FA	98.88
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	98.88
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	98.88
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	98.87
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	98.87
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	98.86
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	98.86
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	98.86
4hb9_A		412	Similarities with probable monooxygenase; flavin,	98.85
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	98.84
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	98.83
2cul_A		232	Glucose-inhibited division protein A-related PROT	98.81
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	98.81
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	98.8
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	98.8
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	98.79
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	98.79
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	98.77
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	98.77
4fk1_A		304	Putative thioredoxin reductase; structural genomic	98.76
4dna_A		463	Probable glutathione reductase; structural genomic	98.76
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	98.74
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	98.74
3r9u_A		315	Thioredoxin reductase; structural genomics, center	98.73
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	98.72
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	98.71
3gyx_A		662	Adenylylsulfate reductase; oxidoreductase; HET: FA	98.71
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	98.7
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	98.68
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	98.67
3fpz_A		326	Thiazole biosynthetic enzyme; FAD, mitochondrion,	98.66
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	98.65
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	98.65
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	98.64
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	98.62
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	98.62
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	98.62
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	98.59
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	98.59
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	98.59
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	98.59
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	98.58
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	98.57
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	98.57
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	98.56
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	98.55
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	98.49
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	98.49
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	98.49
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	98.49
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	98.47
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	98.47
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	98.46
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	98.46
3qvp_A		583	Glucose oxidase; oxidoreductase; HET: NAG BMA MAN	98.45
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	98.44
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	98.43
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	98.43
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	98.41
4gcm_A		312	TRXR, thioredoxin reductase; FAD/NAD-linked reduct	98.4
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	98.38
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	98.34
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	98.34
1pn0_A		665	Phenol 2-monooxygenase; two dimers, TLS refinement	98.31
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	98.3
3q9t_A		577	Choline dehydrogenase and related flavoproteins; g	98.28
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	98.26
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	98.25
4a5l_A		314	Thioredoxin reductase; oxidoreductase, redox metab	98.23
3fim_B		566	ARYL-alcohol oxidase; AAO, lignin degradation, oxi	98.19
3t37_A		526	Probable dehydrogenase; BET alpha beta fold, ADP b	98.18
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	98.17
1c0p_A		363	D-amino acid oxidase; alpha-beta-alpha motif, flav	98.14
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	98.08
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	98.06
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	98.04
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	98.04
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	98.03
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	98.03
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	97.99
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.97
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	97.96
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	97.95
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	97.93
3g3e_A		351	D-amino-acid oxidase; FAD, flavoprotein, oxidoredu	97.91
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	97.89
1ojt_A		482	Surface protein; redox-active center, glycolysis,	97.88
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	97.88
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	97.88
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	97.88
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	97.87
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	97.87
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	97.86
3ihm_A		430	Styrene monooxygenase A; rossman fold, anti-parall	97.86
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	97.83
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	97.81
1fec_A		490	Trypanothione reductase; redox-active center, oxid	97.81
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	97.79
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	97.78
3c4a_A		381	Probable tryptophan hydroxylase VIOD; alpha-beta p	97.78
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	97.77
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.75
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	97.73
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	97.73
1fec_A		490	Trypanothione reductase; redox-active center, oxid	97.73
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	97.72
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	97.71
4b63_A		501	L-ornithine N5 monooxygenase; oxidoreductase, side	97.7
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	97.68
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	97.67
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	97.67
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	97.64
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	97.64
1ojt_A		482	Surface protein; redox-active center, glycolysis,	97.6
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	97.59
3g5s_A		443	Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy	97.55
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	97.53
1lqt_A		456	FPRA; NADP+ derivative, oxidoreductase, structural	97.52
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	97.52
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	97.52
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	97.51
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	97.46
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	97.46
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.46
1cjc_A		460	Protein (adrenodoxin reductase); flavoenzyme, MAD	97.46
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	97.42
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	97.41
3h28_A		430	Sulfide-quinone reductase; monotopic membrane prot	97.38
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	97.37
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	97.36
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	97.36
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	97.35
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	97.34
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	97.3
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	97.29
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	97.28
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	97.27
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	97.26
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	97.25
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	97.24
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	97.21
3sx6_A		437	Sulfide-quinone reductase, putative; sulfide:quino	97.19
1ju2_A		536	HydroxynitrIle lyase; flavin, GMC oxidoreductase,	97.17
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	97.17
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	97.15
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	97.15
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	97.12
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	97.11
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	97.08
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	97.07
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	97.02
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	96.99
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	96.97
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	96.96
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	96.9
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	96.86
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	96.8
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	96.8
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	96.7
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	96.69
1gpe_A		587	Protein (glucose oxidase); oxidoreductase(flavopro	96.61
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	96.51
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	96.48
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	96.24
2g1u_A		155	Hypothetical protein TM1088A; structural genomics,	95.71
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	95.67
3fwz_A		140	Inner membrane protein YBAL; TRKA-N domain, E.coli	95.65
3dfz_A		223	SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase	95.51
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	95.49
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	95.43
1lss_A		140	TRK system potassium uptake protein TRKA homolog;	95.41
3llv_A		141	Exopolyphosphatase-related protein; NAD(P)-binding	95.33
3ic5_A		118	Putative saccharopine dehydrogenase; structural ge	94.96
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	94.93
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	94.81
4gcm_A		312	TRXR, thioredoxin reductase; FAD/NAD-linked reduct	94.77
1id1_A		153	Putative potassium channel protein; RCK domain, E.	94.63
3ado_A		319	Lambda-crystallin; L-gulonate 3-dehydrogenase, str	94.54
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	94.38
2e1m_B		130	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	94.36
2x5o_A		439	UDP-N-acetylmuramoylalanine--D-glutamate ligase; A	94.3
3lk7_A		451	UDP-N-acetylmuramoylalanine--D-glutamate ligase; a	94.2
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	94.19
2hmt_A		144	YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane	94.05
1f0y_A		302	HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive	94.0
4a5l_A		314	Thioredoxin reductase; oxidoreductase, redox metab	93.94
3c85_A		183	Putative glutathione-regulated potassium-efflux S	93.92
1pzg_A		331	LDH, lactate dehydrogenase; apicomplexa, APAD, tet	93.77
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	93.44
2dpo_A		319	L-gulonate 3-dehydrogenase; structural genomics, N	93.39
4e12_A		283	Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1	93.34
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	93.32
3l4b_C		218	TRKA K+ channel protien TM1088B; potassium channel	93.31
3i83_A		320	2-dehydropantoate 2-reductase; structural genomics	93.28
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	93.14
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	93.12
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	93.11
3hn2_A		312	2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str	93.04
2ewd_A		317	Lactate dehydrogenase,; protein-substrate_cofactor	92.89
1kyq_A		274	Met8P, siroheme biosynthesis protein Met8; homodim	92.85
1pjq_A		457	CYSG, siroheme synthase; rossman fold, nucleotide	92.81
1ks9_A		291	KPA reductase;, 2-dehydropantoate 2-reductase; PAN	92.78
2raf_A		209	Putative dinucleotide-binding oxidoreductase; NP_7	92.77
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	92.76
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	92.65
2y0c_A		478	BCEC, UDP-glucose dehydrogenase; oxidoreductase, c	92.64
3k96_A		356	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA	92.51
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	92.48
3k6j_A		460	Protein F01G10.3, confirmed by transcript evidenc;	92.47
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	92.46
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	92.43
3g17_A		294	Similar to 2-dehydropantoate 2-reductase; structur	92.38
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	92.37
2ew2_A		316	2-dehydropantoate 2-reductase, putative; alpha-str	92.34
3eag_A		326	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME	92.29
1zej_A		293	HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural	92.28
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	92.22
3doj_A		310	AT3G25530, dehydrogenase-like protein; gamma-hydro	92.18
3qha_A		296	Putative oxidoreductase; seattle structural genomi	92.18
4dio_A		405	NAD(P) transhydrogenase subunit alpha PART 1; stru	92.15
3g0o_A		303	3-hydroxyisobutyrate dehydrogenase; NAD(P), valine	92.09
3gg2_A		450	Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd	92.08
3dtt_A		245	NADP oxidoreductase; structural genomics, joint ce	92.08
1lld_A		319	L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N	91.95
3ghy_A		335	Ketopantoate reductase protein; oxidoreductase, NA	91.92
4a7p_A		446	UDP-glucose dehydrogenase; oxidoreductase, carbohy	91.9
3p2y_A		381	Alanine dehydrogenase/pyridine nucleotide transhy;	91.84
3g79_A		478	NDP-N-acetyl-D-galactosaminuronic acid dehydrogen;	91.77
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	91.59
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	91.53
4g65_A		461	TRK system potassium uptake protein TRKA; structur	91.52
1bg6_A		359	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L	91.5
3vtf_A		444	UDP-glucose 6-dehydrogenase; two discrete alpha/be	91.45
1z82_A		335	Glycerol-3-phosphate dehydrogenase; TM0378, struct	91.44
3pef_A		287	6-phosphogluconate dehydrogenase, NAD-binding; gam	91.4
2hjr_A		328	Malate dehydrogenase; malaria, structural genomics	91.38
1t2d_A		322	LDH-P, L-lactate dehydrogenase; ternary complex, o	91.3
4dna_A		463	Probable glutathione reductase; structural genomic	91.27
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	91.08
2vns_A		215	Metalloreductase steap3; metal-binding, transmembr	91.01
1mv8_A		436	GMD, GDP-mannose 6-dehydrogenase; rossman fold, do	91.0
3qsg_A		312	NAD-binding phosphogluconate dehydrogenase-like P;	90.98
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	90.95
3tl2_A		315	Malate dehydrogenase; center for structural genomi	90.87
3ego_A		307	Probable 2-dehydropantoate 2-reductase; structural	90.86
2uyy_A		316	N-PAC protein; long-chain dehydrogenase, cytokine;	90.84
3oj0_A		144	Glutr, glutamyl-tRNA reductase; structural genomic	90.82
3hwr_A		318	2-dehydropantoate 2-reductase; YP_299159.1, PANE/A	90.81
4dll_A		320	2-hydroxy-3-oxopropionate reductase; structural ge	90.81
3pdu_A		287	3-hydroxyisobutyrate dehydrogenase family protein;	90.8
2v6b_A		304	L-LDH, L-lactate dehydrogenase; oxidoreductase, ra	90.78
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	90.76
2qyt_A		317	2-dehydropantoate 2-reductase; APC81190, porphyrom	90.75
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	90.73
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	90.7
3l6d_A		306	Putative oxidoreductase; structural genomics, prot	90.67
1jw9_B		249	Molybdopterin biosynthesis MOEB protein; MOEB: mod	90.6
1zcj_A		463	Peroxisomal bifunctional enzyme; peroxisomal multi	90.58
1txg_A		335	Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid	90.52
3pid_A		432	UDP-glucose 6-dehydrogenase; rossmann fold, oxidor	90.48
4e21_A		358	6-phosphogluconate dehydrogenase (decarboxylating;	90.38
1nyt_A		271	Shikimate 5-dehydrogenase; alpha/beta domains, WID	90.34
1x13_A		401	NAD(P) transhydrogenase subunit alpha; NAD(H)-bind	90.34
3phh_A		269	Shikimate dehydrogenase; shikimate pathway, helico	90.18
3dfu_A		232	Uncharacterized protein from 6-phosphogluconate de	90.17
3l9w_A		413	Glutathione-regulated potassium-efflux system Pro	90.16
2vdc_G		456	Glutamate synthase [NADPH] small chain; oxidoreduc	90.15
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	90.06
1l7d_A		384	Nicotinamide nucleotide transhydrogenase, subunit	90.01
1y6j_A		318	L-lactate dehydrogenase; southeast collaboratory f	90.01
2h78_A		302	Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601	89.93
3pqe_A		326	L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas	89.88
1guz_A		310	Malate dehydrogenase; oxidoreductase, tricarboxyli	89.78
3cky_A		301	2-hydroxymethyl glutarate dehydrogenase; rossmann	89.73
1jay_A		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma	89.7
2a9f_A		398	Putative malic enzyme ((S)-malate:NAD+ oxidoreduct	89.65
3mog_A		483	Probable 3-hydroxybutyryl-COA dehydrogenase; struc	89.6
4ezb_A		317	Uncharacterized conserved protein; structural geno	89.58
1pjc_A		361	Protein (L-alanine dehydrogenase); oxidoreductase,	89.56
4huj_A		220	Uncharacterized protein; PSI-biology, nysgrc, stru	89.45
2q3e_A		467	UDP-glucose 6-dehydrogenase; hexamer, structural g	89.39
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	89.36
1vl6_A		388	Malate oxidoreductase; TM0542, NAD-dependent malic	89.3
1p77_A		272	Shikimate 5-dehydrogenase; NADPH, oxidoreductase;	89.21
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	89.21
1ur5_A		309	Malate dehydrogenase; oxidoreductase, tricarboxyli	89.2
1a5z_A		319	L-lactate dehydrogenase; oxidoreductase, glycolysi	89.14
3gvi_A		324	Malate dehydrogenase; NAD, oxidoreductase, tricarb	89.11
2eez_A		369	Alanine dehydrogenase; TTHA0216, structural genomi	89.01
1dlj_A		402	UDP-glucose dehydrogenase; rossmann fold, ternary	89.0
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	88.86
4gbj_A		297	6-phosphogluconate dehydrogenase NAD-binding; stru	88.86
1yqg_A		263	Pyrroline-5-carboxylate reductase; structural geno	88.85
3ggo_A		314	Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b	88.79
2gf2_A		296	Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct	88.65
2egg_A		297	AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff	88.64
2f1k_A		279	Prephenate dehydrogenase; tyrosine synthesis, X-RA	88.61
3ktd_A		341	Prephenate dehydrogenase; structural genomics, joi	88.4
1hyh_A		309	L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2	88.37
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	88.36
4gwg_A		484	6-phosphogluconate dehydrogenase, decarboxylating;	88.36
3c24_A		286	Putative oxidoreductase; YP_511008.1, structural g	88.32
2zyd_A		480	6-phosphogluconate dehydrogenase, decarboxylating;	88.27
1oju_A		294	MDH, malate dehydrogenase; hyperthermophilic, oxid	88.26
2vhw_A		377	Alanine dehydrogenase; NAD, secreted, oxidoreducta	88.22
2o3j_A		481	UDP-glucose 6-dehydrogenase; structural genomics,	88.15
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	88.14
2izz_A		322	Pyrroline-5-carboxylate reductase 1; amino-acid bi	88.05
3r9u_A		315	Thioredoxin reductase; structural genomics, center	88.04
1evy_A		366	Glycerol-3-phosphate dehydrogenase; rossmann fold,	88.01
1ldn_A		316	L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA	87.98
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	87.91
2p4q_A		497	6-phosphogluconate dehydrogenase, decarboxylating;	87.91
2pv7_A		298	T-protein [includes: chorismate mutase (EC 5.4.99	87.87
1yj8_A		375	Glycerol-3-phosphate dehydrogenase; SGPP, structur	87.84
2pgd_A		482	6-phosphogluconate dehydrogenase; oxidoreductase (	87.81
1vpd_A		299	Tartronate semialdehyde reductase; structural geno	87.78
3gpi_A		286	NAD-dependent epimerase/dehydratase; structural ge	87.76
3tnl_A		315	Shikimate dehydrogenase; structural genomics, cent	87.74
2rcy_A		262	Pyrroline carboxylate reductase; malaria, structur	87.71
3don_A		277	Shikimate dehydrogenase; alpha-beta structure, ros	87.69
2rir_A		300	Dipicolinate synthase, A chain; structural genomic	87.67
3d0o_A		317	L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly	87.64
3d4o_A		293	Dipicolinate synthase subunit A; NP_243269.1, stru	87.54
2hk9_A		275	Shikimate dehydrogenase; shikimate pathway, drug d	87.48
1ju2_A		536	HydroxynitrIle lyase; flavin, GMC oxidoreductase,	87.48
3u62_A		253	Shikimate dehydrogenase; shikimate pathway, oxidor	87.48
3ojo_A		431	CAP5O; rossmann fold, complex with cofactor NAD an	87.46
4ffl_A		363	PYLC; amino acid, biosynthesis of pyrrolysine, iso	87.44
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	87.41
3p7m_A		321	Malate dehydrogenase; putative dehydrogenase, enzy	87.39
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	87.36
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	87.31
1x0v_A		354	GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase	87.3
3ond_A		488	Adenosylhomocysteinase; plant protein, enzyme-subs	87.28
3ldh_A		330	Lactate dehydrogenase; oxidoreductase, CHOH donor,	87.27
2wtb_A		725	MFP2, fatty acid multifunctional protein (ATMFP2);	87.26
2cvz_A		289	Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase;	87.24
3nep_X		314	Malate dehydrogenase; halophIle, molecular adpatat	87.24
3fbt_A		282	Chorismate mutase and shikimate 5-dehydrogenase fu	87.17
3jyo_A		283	Quinate/shikimate dehydrogenase; enzyme-cofactor c	87.14
2g5c_A		281	Prephenate dehydrogenase; TYRA, oxidoreductase; HE	87.11
3gt0_A		247	Pyrroline-5-carboxylate reductase; structural geno	87.1
2i6t_A		303	Ubiquitin-conjugating enzyme E2-like isoform A; L-	87.1
3ius_A		286	Uncharacterized conserved protein; APC63810, silic	87.06
1pgj_A		478	6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o	87.05
4b4o_A		298	Epimerase family protein SDR39U1; isomerase; HET:	87.03
3pwz_A		272	Shikimate dehydrogenase 3; alpha-beta, oxidoreduct	86.83
3vku_A		326	L-LDH, L-lactate dehydrogenase; rossmann fold, NAD	86.76
3tri_A		280	Pyrroline-5-carboxylate reductase; amino acid bios	86.55
3h28_A		430	Sulfide-quinone reductase; monotopic membrane prot	86.52
3h8v_A		292	Ubiquitin-like modifier-activating enzyme 5; rossm	86.51
1i36_A		264	Conserved hypothetical protein MTH1747; NADP bindi	86.43
3o8q_A		281	Shikimate 5-dehydrogenase I alpha; structural geno	86.41
3d1l_A		266	Putative NADP oxidoreductase BF3122; structural ge	86.38
2ahr_A		259	Putative pyrroline carboxylate reductase; pyrrolin	86.25
3c7a_A		404	Octopine dehydrogenase; L) stereospecific opine de	86.19
3t4e_A		312	Quinate/shikimate dehydrogenase; structural genomi	86.18
4aj2_A		331	L-lactate dehydrogenase A chain; oxidoreductase-in	86.17
2aef_A		234	Calcium-gated potassium channel MTHK; rossmann fol	86.11
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	85.91
1wdk_A		715	Fatty oxidation complex alpha subunit; alpha2BETA2	85.9
2qrj_A		394	Saccharopine dehydrogenase, NAD+, L-lysine- formin	85.85
1zud_1		251	Adenylyltransferase THIF; thiamin, thiazole, prote	85.78
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	85.77
1ez4_A		318	Lactate dehydrogenase; rossmann fold, oxidoreducta	85.73
1np3_A		338	Ketol-acid reductoisomerase; A DEEP figure-OF-eigh	85.73
1nvt_A		287	Shikimate 5'-dehydrogenase; structural genomics, P	85.64
1cjc_A		460	Protein (adrenodoxin reductase); flavoenzyme, MAD	85.6
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	85.59
1yb4_A		295	Tartronic semialdehyde reductase; structural genom	85.59
2d5c_A		263	AROE, shikimate 5-dehydrogenase; substrate, dimer,	85.57
1edz_A		320	5,10-methylenetetrahydrofolate dehydrogenase; nucl	85.4
3rui_A		340	Ubiquitin-like modifier-activating enzyme ATG7; au	85.31
1o94_A		729	Tmadh, trimethylamine dehydrogenase; electron tran	85.3
1lu9_A		287	Methylene tetrahydromethanopterin dehydrogenase; a	85.17
3gvp_A		435	Adenosylhomocysteinase 3; protein CO-factor comple	85.09
3vps_A		321	TUNA, NAD-dependent epimerase/dehydratase; tunicam	85.03
1npy_A		271	Hypothetical shikimate 5-dehydrogenase-like protei	84.91
2iz1_A		474	6-phosphogluconate dehydrogenase, decarboxylating;	84.9
1leh_A		364	Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi	84.79
1gpe_A		587	Protein (glucose oxidase); oxidoreductase(flavopro	84.66
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	84.58
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	84.49
4hv4_A		494	UDP-N-acetylmuramate--L-alanine ligase; MURC, yers	84.4
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	84.18
3fi9_A		343	Malate dehydrogenase; structural genomics, oxidore	84.18
2dbq_A		334	Glyoxylate reductase; D-3-phosphoglycerate dehydro	84.09
1gpj_A		404	Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro	83.93
3h5n_A		353	MCCB protein; ubiquitin-activating enzyme, microci	83.92
3ce6_A		494	Adenosylhomocysteinase; protein-substrate complex,	83.86
3obb_A		300	Probable 3-hydroxyisobutyrate dehydrogenase; struc	83.79
3q2o_A		389	Phosphoribosylaminoimidazole carboxylase, ATPase;	83.67
3orq_A		377	N5-carboxyaminoimidazole ribonucleotide synthetas;	83.66
2zqz_A		326	L-LDH, L-lactate dehydrogenase; oxidoreductase, ro	83.35
1mld_A		314	Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D	83.33
2yjz_A		201	Metalloreductase steap4; oxidoreductase, metabolic	83.86
3zwc_A		742	Peroxisomal bifunctional enzyme; beta oxidation pa	83.21
2gcg_A		330	Glyoxylate reductase/hydroxypyruvate reductase; NA	83.07
2d4a_B		308	Malate dehydrogenase; archaea, hyperthermophIle, o	82.95
2x0j_A		294	Malate dehydrogenase; oxidoreductase, hyperthermop	82.87
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	82.82
3h9u_A		436	Adenosylhomocysteinase; NAD CO-factor complex, str	82.74
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	82.49
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	82.45
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	82.44
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	82.31
3b1f_A		290	Putative prephenate dehydrogenase; enzyme, 4-hydro	82.26

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

Probab=100.00  E-value=2.8e-46  Score=408.22  Aligned_cols=403  Identities=24%  Similarity=0.349  Sum_probs=282.9

Q ss_pred             ccEEEECCChhHHHHHHHHHHcCCcEEEEecCCCCCcceeEEeeCCeeeccccccccCCCCCCChHHHHHHHHHcCCc--
Q 008069          158 YDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCE--  235 (579)
Q Consensus       158 ~~v~viG~g~~g~~~a~~l~~~g~~v~~~e~~~~~gg~~~t~~~~g~~~~~G~~~~~g~~~~~~~~~~~~~l~~~g~~--  235 (579)
                      ++|||||||++||+||++|+++|++|+||||++.+||++.|++.+||.+|.|++++.+      +..+.+++..+|..  
T Consensus         2 k~VvVIGaG~~GL~aA~~La~~G~~V~VlEa~~~~GG~~~t~~~~G~~~D~G~~~~~~------~~~~~~l~~~~g~~~~   75 (501)
T 4dgk_A            2 KPTTVIGAGFGGLALAIRLQAAGIPVLLLEQRDKPGGRAYVYEDQGFTFDAGPTVITD------PSAIEELFALAGKQLK   75 (501)
T ss_dssp             CCEEEECCHHHHHHHHHHHHHTTCCEEEECCC-------CEEEETTEEEECSCCCBSC------THHHHHHHHTTTCCGG
T ss_pred             CCEEEECCcHHHHHHHHHHHHCCCcEEEEccCCCCCCcEEEEEeCCEEEecCceeecC------chhHHHHHHHhcchhh
Confidence            6899999999999999999999999999999999999999999999999999998863      34567788887754  


Q ss_pred             --eeEeeCCCeEEEEcCCCceEEecCCHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHhhh-hhhhccchhhHHHhhhh
Q 008069          236 --MEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHEKEGVLAFYGECWKIFNALNS-LELKSLEEPIYLFGQFF  312 (579)
Q Consensus       236 --~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~p~~~~~i~~f~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~  312 (579)
                        ++..+......+.+++|..+.++.+...+...+.+.+|.+.+++.+|++.....+..... +...+....    ..+.
T Consensus        76 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~  151 (501)
T 4dgk_A           76 EYVELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLKLGTVPFLSF----RDML  151 (501)
T ss_dssp             GTCCEEEESSSEEEEETTSCEEEECSCHHHHHHHHHHHCTHHHHHHHHHHHHHHHHTSSSCC--CCCCCCCH----HHHH
T ss_pred             hceeeEecCcceEEEcCCCCEEEeeccHHHHHHHHhhcCccccchhhhHHHHHHHhhhhhhhhccccccchh----hhhh
Confidence              334454555667778999999999999999999999999999999988776554332110 000001111    1111


Q ss_pred             cChhhhhHHhhhccccHHHHHHHhcCCHHHHHHHhhhhhhhhcCCCCCchHHHHHHHHhhhhcCccceeCCChHHHHHHH
Q 008069          313 KRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMINASMVLCDRHFGGINYPVGGVGGIAKSL  392 (579)
Q Consensus       313 ~~~~~~~~~~~~~~~s~~~~l~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~p~gG~~~l~~aL  392 (579)
                      ........+  ...+++.+.+.+++.++.++.++...+.+.+ ..+...++.+..+... ....|.++|+||+++++++|
T Consensus       152 ~~~~~~~~l--~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~g-~~p~~~~~~~~~~~~~-~~~~G~~~p~GG~~~l~~aL  227 (501)
T 4dgk_A          152 RAAPQLAKL--QAWRSVYSKVASYIEDEHLRQAFSFHSLLVG-GNPFATSSIYTLIHAL-EREWGVWFPRGGTGALVQGM  227 (501)
T ss_dssp             HSGGGTTTS--HHHHHHHHHHHTTCCCHHHHHHHHHHHHHHH-SCC--CCCTHHHHHHH-HSCCCEEEETTHHHHHHHHH
T ss_pred             hhhhhhhhh--hhcccHHHHHHHHhccHHHHhhhhhhhcccC-CCcchhhhhhhhhhhh-hccCCeEEeCCCCcchHHHH
Confidence            100000000  0123677889999999999999887766654 4555655554443332 33467889999999999999


Q ss_pred             HHHHHHcCceEEeCceeeEEEEeCCEEEEEEeCCCcEEEcCEEEECCChhHHHhhccCCCCCChHHHHHHHhhccCCCeE
Q 008069          393 AKGLADKGSEILYKANVTKVILEQGKAVGVRLSDGREFYAKTIISNATRWDTFGKLLKGEQLPKEEENFQKLYVKAPSFL  472 (579)
Q Consensus       393 ~~~l~~~G~~I~l~~~V~~I~~~~~~v~gV~~~dG~~i~Ad~VV~a~~~~~~~~~Ll~~~~lp~~~~~~~~~~~~~~s~~  472 (579)
                      ++.++++|++|++|++|++|..+++++++|+++||+++.||.||++++++.++..|+++...+....+.++.++++++.+
T Consensus       228 ~~~~~~~Gg~I~~~~~V~~I~~~~~~~~gV~~~~g~~~~ad~VV~~a~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~s~~  307 (501)
T 4dgk_A          228 IKLFQDLGGEVVLNARVSHMETTGNKIEAVHLEDGRRFLTQAVASNADVVHTYRDLLSQHPAAVKQSNKLQTKRMSNSLF  307 (501)
T ss_dssp             HHHHHHTTCEEECSCCEEEEEEETTEEEEEEETTSCEEECSCEEECCC---------------------------CCEEE
T ss_pred             HHHHHHhCCceeeecceeEEEeeCCeEEEEEecCCcEEEcCEEEECCCHHHHHHHhccccccchhhhhhhhccccCCcee
Confidence            99999999999999999999999999999999999999999999999999998889988777766666777788889999


Q ss_pred             EEEEeecCCcCCCCCCccceeeccchhhh-cC--------CcceEEEEcCCCCCCCCCCCCeeEEEEEeccchhhhcCCC
Q 008069          473 SIHMGVKAEVLPPDTDCHHFVLEDDWNRL-EE--------PYGSIFLSIPTVLDSSLAPEGHHILHIFTICSIEDWEGLA  543 (579)
Q Consensus       473 ~v~lg~~~~~~~~~~~~~~~~~~~~~~~~-~~--------p~~~i~~~~~s~~dp~~aP~G~~~l~~~~~~~~~~w~~~~  543 (579)
                      ++|++++.+.  +....|++++.+++... +.        ...++|+++||..||+++|+|++++++++++++..|.   
T Consensus       308 ~~~~~l~~~~--~~l~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~s~~dp~~ap~G~~~~~~~~~~p~~~~~---  382 (501)
T 4dgk_A          308 VLYFGLNHHH--DQLAHHTVCFGPRYRELIDEIFNHDGLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPHLGTA---  382 (501)
T ss_dssp             EEEEEESSCC--TTSCSEEEEEECC-------------CCCEEEEEEECGGGTCGGGSSTTCEEEEEEEEECCTTTS---
T ss_pred             EEEecccCCc--cccccceeccccchhhhccccccccccccCCceecccCCCCCCCcCCCCCceEEEEEecCccccc---
Confidence            9999999875  34455677776655431 10        1246899999999999999999999999987755554   


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHhhCCCCCCCeEEEEC
Q 008069          544 QKDYDAKKELVADEIINRLENKLFPGLKQSIAFREV  579 (579)
Q Consensus       544 ~~~y~~~ke~~~~~il~~le~~~~P~l~~~I~~~~v  579 (579)
                      +.+|++.|+++++++++.|+++++|+|+++|+++++
T Consensus       383 ~~~~~~~~~~~~~~vl~~l~~~~~P~~~~~i~~~~~  418 (501)
T 4dgk_A          383 NLDWTVEGPKLRDRIFAYLEQHYMPGLRSQLVTHRM  418 (501)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHTCTTHHHHEEEEEE
T ss_pred             cccHHHHHHHHHHHHHHHHHHhhCCChHHceEEEEE
Confidence            357999999999999999996678999999998764

PyMOL of 4dgk

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5	Back alignment and structure

>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense}	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A*	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A*	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A*	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R*	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7	Back alignment and structure

>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A*	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A*	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A*	Back alignment and structure

>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A*	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A*	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A*	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ...	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A*	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae}	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp}	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A*	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae}	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A*	Back alignment and structure

>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii}	Back alignment and structure

>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti}	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A*	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A*	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida}	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472}	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ...	Back alignment and structure

>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A*	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A*	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A*	Back alignment and structure

>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A*	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A*	Back alignment and structure

>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}	Back alignment and structure

>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium}	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9	Back alignment and structure

>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi}	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp}	Back alignment and structure

>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9	Back alignment and structure

>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A*	Back alignment and structure

>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae}	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A*	Back alignment and structure

>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A*	Back alignment and structure

>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A*	Back alignment and structure

>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima}	Back alignment and structure

>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus}	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens}	Back alignment and structure

>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A	Back alignment and structure

>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1	Back alignment and structure

>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A*	Back alignment and structure

>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A*	Back alignment and structure

>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A*	Back alignment and structure

>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii}	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans}	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp}	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis}	Back alignment and structure

>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58}	Back alignment and structure

>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium}	Back alignment and structure

>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti}	Back alignment and structure

>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium}	Back alignment and structure

>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis}	Back alignment and structure

>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP}	Back alignment and structure

>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T*	Back alignment and structure

>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum}	Back alignment and structure

>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea}	Back alignment and structure

>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str}	Back alignment and structure

>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1}	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus}	Back alignment and structure

>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6	Back alignment and structure

>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum}	Back alignment and structure

>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima}	Back alignment and structure

>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens}	Back alignment and structure

>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum}	Back alignment and structure

>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A*	Back alignment and structure

>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A*	Back alignment and structure

>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis}	Back alignment and structure

>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis}	Back alignment and structure

>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens}	Back alignment and structure

>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium}	Back alignment and structure

>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha}	Back alignment and structure

>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP}	Back alignment and structure

>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens}	Back alignment and structure

>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis}	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida}	Back alignment and structure

>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B*	Back alignment and structure

>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus}	Back alignment and structure

>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6	Back alignment and structure

>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A*	Back alignment and structure

>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens}	Back alignment and structure

>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A*	Back alignment and structure

>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A*	Back alignment and structure

>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum}	Back alignment and structure

>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A*	Back alignment and structure

>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense}	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A*	Back alignment and structure

>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A*	Back alignment and structure

>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A*	Back alignment and structure

>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri}	Back alignment and structure

>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A*	Back alignment and structure

>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes}	Back alignment and structure

>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli}	Back alignment and structure

>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A	Back alignment and structure

>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti}	Back alignment and structure

>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A*	Back alignment and structure

>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A*	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A*	Back alignment and structure

>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A*	Back alignment and structure

>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus}	Back alignment and structure

>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans}	Back alignment and structure

>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A*	Back alignment and structure

>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A*	Back alignment and structure

>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A*	Back alignment and structure

>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus}	Back alignment and structure

>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A	Back alignment and structure

>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP}	Back alignment and structure

>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A*	Back alignment and structure

>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A*	Back alignment and structure

>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A*	Back alignment and structure

>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans}	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A*	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A*	Back alignment and structure

>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae}	Back alignment and structure

>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum}	Back alignment and structure

>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A*	Back alignment and structure

>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6	Back alignment and structure

>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}	Back alignment and structure

>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A*	Back alignment and structure

>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum}	Back alignment and structure

>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A*	Back alignment and structure

>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis}	Back alignment and structure

>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A*	Back alignment and structure

>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans}	Back alignment and structure

>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A	Back alignment and structure

>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A*	Back alignment and structure

>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima}	Back alignment and structure

>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A*	Back alignment and structure

>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A*	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis}	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A*	Back alignment and structure

>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A*	Back alignment and structure

>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1	Back alignment and structure

>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana}	Back alignment and structure

>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A*	Back alignment and structure

>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber}	Back alignment and structure

>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A	Back alignment and structure

>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6	Back alignment and structure

>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579}	Back alignment and structure

>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A	Back alignment and structure

>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6	Back alignment and structure

>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens}	Back alignment and structure

>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida}	Back alignment and structure

>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A*	Back alignment and structure

>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii}	Back alignment and structure

>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A*	Back alignment and structure

>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6	Back alignment and structure

>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B*	Back alignment and structure

>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis}	Back alignment and structure

>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A	Back alignment and structure

>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B*	Back alignment and structure

>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A*	Back alignment and structure

>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ...	Back alignment and structure

>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A*	Back alignment and structure

>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A*	Back alignment and structure

>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1	Back alignment and structure

>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6	Back alignment and structure

>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A*	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium}	Back alignment and structure

>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A*	Back alignment and structure

>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A*	Back alignment and structure

>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A*	Back alignment and structure

>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A*	Back alignment and structure

>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A*	Back alignment and structure

>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A*	Back alignment and structure

>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis}	Back alignment and structure

>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5	Back alignment and structure

>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A*	Back alignment and structure

>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1	Back alignment and structure

>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ...	Back alignment and structure

>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis}	Back alignment and structure

>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A*	Back alignment and structure

>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1	Back alignment and structure

>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A	Back alignment and structure

>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A*	Back alignment and structure

>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A*	Back alignment and structure

>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A*	Back alignment and structure

>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A	Back alignment and structure

>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A*	Back alignment and structure

>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A*	Back alignment and structure

>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus}	Back alignment and structure

>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A*	Back alignment and structure

>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A	Back alignment and structure

>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix}	Back alignment and structure

>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A*	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		579
d2bcgg1		297	c.3.1.3 (G:5-301) Guanine nucleotide dissociation	4e-32
d1d5ta1		336	c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di	3e-30
d2f5va1		379	c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W	3e-21
d2v5za1		383	c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H	4e-20
d2ivda1		347	c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox	9e-19
d2dw4a2		449	c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist	6e-18
d1seza1		373	c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox	4e-16
d1b5qa1		347	c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai	1e-13
d2iida1		370	c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M	2e-13
d3coxa1		370	c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of	1e-12
d1y0pa2		308	c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (	1e-10
d1d4ca2		322	c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (	6e-10
d1ryia1		276	c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {	8e-10
d1i8ta1		298	c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu	1e-09
d2bs2a2		336	c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo	1e-09
d1qo8a2		317	c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (	1e-09
d1ojta1		229	c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh	2e-09
d1dxla1		221	c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd	2e-09
d2i0za1		251	c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B	3e-09
d2gf3a1		281	c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac	6e-09
d3lada1		229	c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd	8e-09
d1h6va1		235	c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin	1e-08
d3grsa1		221	c.3.1.5 (A:18-165,A:291-363) Glutathione reductase	1e-08
d1n4wa1		367	c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of	1e-08
d1kdga1		360	c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain	1e-08
d1v59a1		233	c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd	2e-08
d2gqfa1		253	c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H	4e-08
d1ebda1		223	c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd	4e-08
d1neka2		330	c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase	5e-08
d2gmha1		380	c.3.1.2 (A:4-236,A:336-482) Electron transfer flav	6e-08
d1chua2		305	c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E	9e-08
d1onfa1		259	c.3.1.5 (A:1-153,A:271-376) Glutathione reductase	1e-07
d2bi7a1		314	c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu	1e-07
d1gesa1		217	c.3.1.5 (A:3-146,A:263-335) Glutathione reductase	2e-07
d1jnra2		356	c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct	3e-07
d1lvla1		220	c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd	3e-07
d1rp0a1		278	c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi	5e-07
d1mo9a1		261	c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop	6e-07
d1kf6a2		311	c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es	8e-07
d1w4xa1		298	c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy	8e-07
d1c0pa1		268	c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida	3e-06
d2gjca1		311	c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th	5e-06
d1feca1		240	c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas	7e-06
d1kifa1		246	c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N	8e-06
d1aoga1		238	c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas	1e-05
d1pj5a2		305	c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox	2e-05
d1ju2a1		351	c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {	2e-05
d1k0ia1		292	c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr	3e-05
d2voua1		265	c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr	4e-05
d1fl2a1		184	c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide	6e-05
d1cf3a1		385	c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper	7e-05
d1gpea1		391	c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic	9e-05
d1xdia1		233	c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd	1e-04
d2cula1		230	c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T	1e-04
d1trba1		190	c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase	1e-04
d2gv8a1		335	c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox	3e-04
d3c96a1		288	c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps	4e-04
d1pn0a1		360	c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So	6e-04
d1vdca1		192	c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase	0.001
d1vg0a1		491	c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {	0.002
d1cjca2		230	c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase	0.003

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Guanine nucleotide dissociation inhibitor, GDI
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  123 bits (309), Expect = 4e-32
 Identities = 45/294 (15%), Positives = 93/294 (31%), Gaps = 15/294 (5%)

Query: 156 DDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDGYTFDVGSSVMFG 215
            DYD IV+G+GI   + +  L+V G +VL ++K    GG +              + +  
Sbjct: 4   TDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISK 63

Query: 216 FSDKGNLNLITQALAAVGCEMEVIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPHE 275
              +            +  +  +     T      +     V R         +  F   
Sbjct: 64  EERESKFGKDRDWNVDLIPKFLMANGELTNILIHTD-----VTRYVDFKQVSGSYVFKQG 118

Query: 276 KEGVLAFYGECWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARK 335
           K   +            +   E + +++ +     + +  L               +  K
Sbjct: 119 KIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVYYK 178

Query: 336 YIKDPQLLSFIDAECFIVSTINALQTPMINASMVLC-------DRHFGGINYPVGGVGGI 388
           +        FI     + +  + LQ P   +   +                YP+ G+G +
Sbjct: 179 FGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLGEL 238

Query: 389 AKSLAKGLADKGSEILYKANVTKVIL--EQGKAVGVRLSDGREFYAKTIISNAT 440
            +  A+  A  G   +    + +V+   + GK  GV+ +    F A  +I++ T
Sbjct: 239 PQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVK-TKLGTFKAPLVIADPT 291

PyMOL of d2bcgg1

>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276	Back information, alignment and structure

>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229	Back information, alignment and structure

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281	Back information, alignment and structure

>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360	Back information, alignment and structure

>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330	Back information, alignment and structure

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380	Back information, alignment and structure

>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305	Back information, alignment and structure

>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259	Back information, alignment and structure

>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314	Back information, alignment and structure

>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217	Back information, alignment and structure

>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356	Back information, alignment and structure

>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220	Back information, alignment and structure

>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278	Back information, alignment and structure

>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298	Back information, alignment and structure

>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311	Back information, alignment and structure

>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240	Back information, alignment and structure

>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246	Back information, alignment and structure

>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305	Back information, alignment and structure

>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265	Back information, alignment and structure

>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184	Back information, alignment and structure

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391	Back information, alignment and structure

>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230	Back information, alignment and structure

>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360	Back information, alignment and structure

>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192	Back information, alignment and structure

>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491	Back information, alignment and structure

>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		579
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	99.9
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	99.87
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	99.86
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	99.85
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	99.81
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	99.71
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	99.64
d1gtea1		182	Dihydropyrimidine dehydrogenase, N-terminal domain	99.58
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	99.58
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	99.54
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	99.51
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	99.51
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	99.47
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	99.42
d2bi7a1		314	UDP-galactopyranose mutase, N-terminal domain {Kle	99.42
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	99.42
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	99.33
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	99.32
d1vg0a1		491	Rab escort protein 1 {Rat (Rattus norvegicus) [Tax	99.3
d1i8ta1		298	UDP-galactopyranose mutase, N-terminal domain {Esc	99.26
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	99.16
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	99.06
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	99.05
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	98.98
d1kf6a2		311	Fumarate reductase {Escherichia coli [TaxId: 562]}	98.97
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	98.95
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	98.94
d1ps9a3		179	2,4-dienoyl-CoA reductase, middle domain {Escheric	98.93
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	98.91
d1chua2		305	L-aspartate oxidase {Escherichia coli [TaxId: 562]	98.88
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	98.87
d1neka2		330	Succinate dehydogenase {Escherichia coli [TaxId: 5	98.85
d2cula1		230	GidA-related protein TTHA1897 {Thermus thermophilu	98.81
d1rp0a1		278	Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara	98.77
d3c96a1		288	Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId:	98.74
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	98.73
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	98.72
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	98.71
d1k0ia1		292	p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a	98.7
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	98.69
d1djqa3		233	Trimethylamine dehydrogenase, middle domain {Methy	98.69
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	98.69
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	98.69
d1v59a1		233	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	98.63
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	98.63
d1lqta2		239	Ferredoxin:NADP reductase FprA {Mycobacterium tube	98.61
d1dxla1		221	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	98.61
d1jnra2		356	Adenylylsulfate reductase A subunit {Archaeon Arch	98.6
d1c0pa1		268	D-aminoacid oxidase, N-terminal domain {Rhodotorul	98.6
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	98.59
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	98.57
d1kdga1		360	Flavoprotein domain of flavocytochrome cellobiose	98.56
d1ojta1		229	Dihydrolipoamide dehydrogenase {Neisseria meningit	98.53
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	98.52
d3lada1		229	Dihydrolipoamide dehydrogenase {Azotobacter vinela	98.52
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	98.48
d2gmha1		380	Electron transfer flavoprotein-ubiquinone oxidored	98.48
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	98.45
d1gesa1		217	Glutathione reductase {Escherichia coli [TaxId: 56	98.43
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	98.42
d1gtea4		196	Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su	98.41
d1cf3a1		385	Glucose oxidase {Aspergillus niger [TaxId: 5061]}	98.39
d1cjca2		230	Adrenodoxin reductase of mitochondrial p450 system	98.39
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	98.38
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	98.37
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	98.37
d1h6va1		235	Mammalian thioredoxin reductase {Rat (Rattus norve	98.29
d1ebda1		223	Dihydrolipoamide dehydrogenase {Bacillus stearothe	98.26
d3grsa1		221	Glutathione reductase {Human (Homo sapiens) [TaxId	98.25
d1fl2a1		184	Alkyl hydroperoxide reductase subunit F (AhpF), C-	98.24
d1lvla1		220	Dihydrolipoamide dehydrogenase {Pseudomonas putida	98.23
d2f5va1		379	Pyranose 2-oxidase {White-rot fungus (Peniophora s	98.22
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	98.21
d1onfa1		259	Glutathione reductase {Plasmodium falciparum [TaxI	98.2
d1vdca1		192	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	98.18
d1mo9a1		261	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	98.17
d1trba1		190	Thioredoxin reductase {Escherichia coli [TaxId: 56	98.16
d1feca1		240	Trypanothione reductase {Crithidia fasciculata [Ta	98.08
d1pn0a1		360	Phenol hydroxylase {Soil-living yeast (Trichosporo	98.04
d1aoga1		238	Trypanothione reductase {Trypanosoma cruzi [TaxId:	98.03
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	97.87
d1kifa1		246	D-aminoacid oxidase, N-terminal domain {Pig (Sus s	97.64
d1xdia1		233	Dihydrolipoamide dehydrogenase {Mycobacterium tube	97.55
d1gpea1		391	Glucose oxidase {Penicillium amagasakiense [TaxId:	97.53
d1ju2a1		351	Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI	97.39
d2jfga1		93	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase	97.12
d1fcda1		186	Flavocytochrome c sulfide dehydrogenase, FCSD, fla	97.11
d1e5qa1		182	Saccharopine reductase {Rice blast fungus (Magnapo	96.87
d1bg6a2		184	N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A	96.78
d1q1ra1		185	Putidaredoxin reductase {Pseudomonas putida [TaxId	96.69
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	96.57
d1djqa2		156	Trimethylamine dehydrogenase, C-terminal domain {M	96.51
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	96.5
d1ks9a2		167	Ketopantoate reductase PanE {Escherichia coli [Tax	96.48
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	96.41
d2ivda2		108	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	96.04
d1f0ya2		192	Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum	96.01
d1lssa_		132	Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax	95.94
d1wdka3		186	Fatty oxidation complex alpha subunit, middle doma	95.82
d1mv8a2		202	GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos	95.82
d1pjca1		168	L-alanine dehydrogenase {Phormidium lapideum [TaxI	95.62
d2hmva1		134	Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	95.54
d1seza2		112	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	95.49
d1l7da1		183	Nicotinamide nucleotide transhydrogenase dI compon	95.31
d1pzga1		154	Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5	95.12
d2f1ka2		165	Prephenate dehydrogenase TyrA {Synechocystis sp. p	95.12
d1ez4a1		146	Lactate dehydrogenase {Lactobacillus pentosus [Tax	95.1
d2pv7a2		152	Prephenate dehydrogenase TyrA {Haemophilus influen	94.98
d1gtea3		153	Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su	94.96
d1txga2		180	Glycerol-3- phosphate dehydrogenase {Archaeoglobus	94.8
d1n1ea2		189	Glycerol-3- phosphate dehydrogenase {Trypanosome (	94.72
d1jaya_		212	Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae	94.69
d1ldna1		148	Lactate dehydrogenase {Bacillus stearothermophilus	94.59
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	93.84
d1vpda2		161	Hydroxyisobutyrate dehydrogenase {Salmonella typhi	93.79
d2pgda2		176	6-phosphogluconate dehydrogenase {Sheep (Ovis orie	93.56
d1dlja2		196	UDP-glucose dehydrogenase (UDPGDH) {Streptococcus	93.42
d1pjqa1		113	Siroheme synthase CysG, domain 1 {Salmonella typhi	93.4
d1nyta1		170	Shikimate 5-dehydrogenase AroE {Escherichia coli [	93.32
d1kyqa1		150	Bifunctional dehydrogenase/ferrochelatase Met8p, N	93.17
d1kjqa2		111	Glycinamide ribonucleotide transformylase PurT, N-	93.13
d3cuma2		162	Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru	93.0
d1i0za1		160	Lactate dehydrogenase {Human (Homo sapiens), heart	92.94
d1uxja1		142	Malate dehydrogenase {Chloroflexus aurantiacus [Ta	92.92
d1pgja2		178	6-phosphogluconate dehydrogenase {Trypanosoma bruc	92.8
d1y6ja1		142	Lactate dehydrogenase {Clostridium thermocellum [T	92.38
d1hyha1		146	L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La	92.18
d2ldxa1		159	Lactate dehydrogenase {Mouse (Mus musculus) [TaxId	92.07
d2gv8a2		107	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	91.95
d1guza1		142	Malate dehydrogenase {Chlorobium vibrioforme [TaxI	91.91
d1npya1		167	Shikimate 5-dehydrogenase-like protein HI0607 {Hae	91.9
d1p3da1		96	UDP-N-acetylmuramate-alanine ligase MurC {Haemophi	91.67
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	91.62
d1i36a2		152	Conserved hypothetical protein MTH1747 {Archaeon M	91.44
d1ojua1		142	Malate dehydrogenase {Archaeon Archaeoglobus fulgi	91.38
d1llda1		143	Lactate dehydrogenase {Bifidobacterium longum, str	91.37
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	91.18
d1hyea1		145	MJ0490, lactate/malate dehydrogenase {Archaeon Met	91.14
d1llua2		166	Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax	91.07
d1t2da1		150	Lactate dehydrogenase {Malaria parasite (Plasmodiu	91.02
d1piwa2		168	Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas	90.83
d1trba2		126	Thioredoxin reductase {Escherichia coli [TaxId: 56	90.73
d1a5za1		140	Lactate dehydrogenase {Thermotoga maritima [TaxId:	90.72
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	90.48
d1a9xa3		127	Carbamoyl phosphate synthetase (CPS), large subuni	90.26
d1vdca2		130	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	89.96
d1mlda1		144	Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982	89.75
d1id1a_		153	Rck domain from putative potassium channel Kch {Es	89.28
d2g5ca2		171	Prephenate dehydrogenase TyrA {Aquifex aeolicus [T	89.26
d1a9xa4		121	Carbamoyl phosphate synthetase (CPS), large subuni	89.24
d1vi2a1		182	Putative shikimate dehydrogenase YdiB {Escherichia	89.2
d3etja2		78	N5-carboxyaminoimidazole ribonucleotide synthetase	88.93
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	88.88
d2ahra2		152	Pyrroline-5-carboxylate reductase ProC {Streptococ	88.74
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	88.61
d1trba2		126	Thioredoxin reductase {Escherichia coli [TaxId: 56	88.51
d1v8ba1		163	S-adenosylhomocystein hydrolase {Plasmodium falcip	88.49
d1vj0a2		182	Hypothetical protein TM0436 {Thermotoga maritima [	88.4
d1ps9a2		162	2,4-dienoyl-CoA reductase, C-terminal domain {Esch	88.3
d1p77a1		171	Shikimate 5-dehydrogenase AroE {Haemophilus influe	88.07
d1uufa2		168	Hypothetical protein YahK {Escherichia coli [TaxId	88.05
d1li4a1		163	S-adenosylhomocystein hydrolase {Human (Homo sapie	87.96
d1yqga2		152	Pyrroline-5-carboxylate reductase ProC {Neisseria	87.93
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	87.9
d1gpea1		391	Glucose oxidase {Penicillium amagasakiense [TaxId:	87.58
d1ps9a1		330	2,4-dienoyl-CoA reductase, N-terminal domain {Esch	87.49
d2f5va1		379	Pyranose 2-oxidase {White-rot fungus (Peniophora s	87.46
d1djqa3		233	Trimethylamine dehydrogenase, middle domain {Methy	87.36
d1nvta1		177	Shikimate 5-dehydrogenase AroE {Archaeon Methanoco	87.07
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	86.96
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	86.9
d2c5aa1		363	GDP-mannose-3', 5'-epimerase {Thale cress (Arabido	86.85
d1rjwa2		168	Alcohol dehydrogenase {Bacillus stearothermophilus	86.66
d1ps9a2		162	2,4-dienoyl-CoA reductase, C-terminal domain {Esch	86.4
d1gpja2		159	Glutamyl tRNA-reductase middle domain {Archaeon Me	86.05
d1jw9b_		247	Molybdenum cofactor biosynthesis protein MoeB {Esc	85.5
d1d1ta2		176	Alcohol dehydrogenase {Human (Homo sapiens), diffe	85.37
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	85.31
d1e3ia2		174	Alcohol dehydrogenase {Mouse (Mus musculus), class	85.31
d1kola2		195	Formaldehyde dehydrogenase {Pseudomonas putida [Ta	84.93
d2cmda1		145	Malate dehydrogenase {Escherichia coli [TaxId: 562	84.85
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	84.76
d1o6za1		142	Malate dehydrogenase {Archaeon Haloarcula marismor	84.74
d1w4xa2		235	Phenylacetone monooxygenase {Thermobifida fusca [T	84.24
d1ju2a1		351	Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI	83.97
d1qp8a1		181	Putative formate dehydrogenase {Archaeon Pyrobacul	83.45
d2iida2		113	L-aminoacid oxidase {Malayan pit viper (Calloselas	83.37
d2dt5a2		126	Transcriptional repressor Rex, C-terminal domain {	83.36
d1vl0a_		281	DTDP-4-dehydrorhamnose reductase RfbD {Clostridium	82.9
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	82.34
d1fjha_		257	3-alpha-hydroxysteroid dehydrogenase {Comamonas te	82.12
d1z41a1		337	NADPH dehydrogenase NamA {Bacillus subtilis [TaxId	81.61
d1udca_		338	Uridine diphosphogalactose-4-epimerase (UDP-galact	81.59
d1f8fa2		174	Benzyl alcohol dehydrogenase {Acinetobacter calcoa	81.57
d1djqa1		340	Trimethylamine dehydrogenase, N-terminal domain {M	81.44
d1j6ua1		89	UDP-N-acetylmuramate-alanine ligase MurC {Thermoto	81.35
d1p0fa2		174	Alcohol dehydrogenase {Frog (Rana perezi) [TaxId:	81.15
d1cjca1		225	Adrenodoxin reductase of mitochondrial p450 system	80.65
d1b5qa2		112	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	80.53
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	80.39
d1lqta1		216	Ferredoxin:NADP reductase FprA {Mycobacterium tube	80.12

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Guanine nucleotide dissociation inhibitor, GDI
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.90  E-value=2.9e-23  Score=200.83  Aligned_cols=251  Identities=19%  Similarity=0.214  Sum_probs=146.5

Q ss_pred             CCCCccEEEECCChhHHHHHHHHHHcCCcEEEEecCCCCCcceeEEeeCC------------------------eeeccc
Q 008069          154 GADDYDAIVIGSGIGGLVAATQLAVKGARVLVLEKYVIPGGSSGYYERDG------------------------YTFDVG  209 (579)
Q Consensus       154 ~~~~~~v~viG~g~~g~~~a~~l~~~g~~v~~~e~~~~~gg~~~t~~~~g------------------------~~~~~G  209 (579)
                      |+..|||||||||++||+||+.|+++|++|+||||++.+||+++|+..++                        +.+|.+
T Consensus         2 m~~~yDviViGaG~~Gl~~A~~La~~G~~V~vlE~~~~~GG~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~   81 (297)
T d2bcgg1           2 IDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEERESKFGKDRDWNVDLI   81 (297)
T ss_dssp             CCCBCSEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEECHHHHHHHHCSSCCCHHHHHHHHCCGGGCCEESS
T ss_pred             CCCcCCEEEECcCHHHHHHHHHHHHCCCCEEEEcCCCCCCcceEEeeccccccccCCCccccccccccccccccceeccC
Confidence            45689999999999999999999999999999999999999999876543                        334545


Q ss_pred             cccccCCCCCCChHHHHHHHHHcCCcee--EeeCCCeEEEEcCCCceEEecCCHHHHHHHHHHhCCC--cHHHHHHHHHH
Q 008069          210 SSVMFGFSDKGNLNLITQALAAVGCEME--VIPDPTTVHFHLPNDLSVRVHREYSDFVAELTSKFPH--EKEGVLAFYGE  285 (579)
Q Consensus       210 ~~~~~g~~~~~~~~~~~~~l~~~g~~~~--~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~p~--~~~~i~~f~~~  285 (579)
                      ++.+..      ...+.+.+...+....  .......  +.+.++....++........   .....  ....+..|...
T Consensus        82 ~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~  150 (297)
T d2bcgg1          82 PKFLMA------NGELTNILIHTDVTRYVDFKQVSGS--YVFKQGKIYKVPANEIEAIS---SPLMGIFEKRRMKKFLEW  150 (297)
T ss_dssp             CCBEET------TSHHHHHHHHHTGGGTCCEEECCCE--EEEETTEEEECCSSHHHHHH---CTTSCHHHHHHHHHHHHH
T ss_pred             cccccC------CCcceeeeeeccccccccccccCcc--cccccCCccccccchhhhhh---ccccccccchhhhhhhhh
Confidence            444431      1123344444443211  1111111  22344544545444332211   11100  01111111111


Q ss_pred             HHHHHHHhhhhhhhccchhhHHHhhhhcChhhhhHHhhhccccHHHHHHHhcCCHHHHHHHhhhhhhhhcCCCCCchHHH
Q 008069          286 CWKIFNALNSLELKSLEEPIYLFGQFFKRPLECLTLAYYLPQNAGNIARKYIKDPQLLSFIDAECFIVSTINALQTPMIN  365 (579)
Q Consensus       286 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~  365 (579)
                             ......               ..........+...++.+++.++..++.++.++...............++..
T Consensus       151 -------~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  208 (297)
T d2bcgg1         151 -------ISSYKE---------------DDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARP  208 (297)
T ss_dssp             -------HHHCBT---------------TBGGGSTTCCTTTSBHHHHHHHTTCCHHHHHHHHHHTSCCSSSGGGGSBHHH
T ss_pred             -------hhhhhh---------------ccccchhhhcccchhhhhhhhhhccCHHHHHHHHHHHhhhccccccchhhhh
Confidence                   100000               0000001112234467778888877877776654432211111112222222


Q ss_pred             HHHH-------HhhhhcCccceeCCChHHHHHHHHHHHHHcCceEEeCceeeEEEEe--CCEEEEEEeCCCcEEEcCEEE
Q 008069          366 ASMV-------LCDRHFGGINYPVGGVGGIAKSLAKGLADKGSEILYKANVTKVILE--QGKAVGVRLSDGREFYAKTII  436 (579)
Q Consensus       366 ~~~~-------~~~~~~~g~~~p~gG~~~l~~aL~~~l~~~G~~I~l~~~V~~I~~~--~~~v~gV~~~dG~~i~Ad~VV  436 (579)
                      ....       ......+++.+|+||+++++++|++.++++|++|++|++|++|.++  ++++.+|+ .+|++++||.||
T Consensus       209 ~~~~~~~~~~~~~~~~~~~~~~~~gG~~~l~~~l~~~~~~~G~~i~~~~~V~~I~~~~~~~~v~~v~-~~g~~~~ad~VI  287 (297)
T d2bcgg1         209 SFERILLYCQSVARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVK-TKLGTFKAPLVI  287 (297)
T ss_dssp             HHHHHHHHHHHHHHHSSCSEEEETTCTTHHHHHHHHHHHHTTCEEECSCCCCEEEEETTTTEEEEEE-ETTEEEECSCEE
T ss_pred             hhhhhhhhhhcccccccCcceeccCcHHHHHHHHHHHHHhcCCEEEeCCEeeEEEEECCCCEEEEEE-cCCEEEECCEEE
Confidence            1111       1112235778999999999999999999999999999999999875  46788775 578899999999


Q ss_pred             EC
Q 008069          437 SN  438 (579)
Q Consensus       437 ~a  438 (579)
                      ++
T Consensus       288 ~~  289 (297)
T d2bcgg1         288 AD  289 (297)
T ss_dssp             EC
T ss_pred             EC
Confidence            86

PyMOL of d2bcgg1

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}	Back information, alignment and structure

>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}	Back information, alignment and structure

>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}	Back information, alignment and structure

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]}	Back information, alignment and structure

>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}	Back information, alignment and structure

>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}	Back information, alignment and structure

>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}	Back information, alignment and structure

>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}	Back information, alignment and structure

>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}	Back information, alignment and structure

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}	Back information, alignment and structure

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}	Back information, alignment and structure

>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}	Back information, alignment and structure

>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}	Back information, alignment and structure

>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]}	Back information, alignment and structure

>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]}	Back information, alignment and structure

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}	Back information, alignment and structure

>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]}	Back information, alignment and structure

>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}	Back information, alignment and structure

>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]}	Back information, alignment and structure

>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}	Back information, alignment and structure

>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}	Back information, alignment and structure

>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure