Citrus Sinensis ID: 008155

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570------

MEVLQPIPNVKIPKLNTFTNMRTRRIPAPRLNSHSIRAESSSSSFASSPAPLPSTAGEKMVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKRLKAIMLAAAELAALRLKDIPSTNHKGFEFDWRDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQLLDSNSDGSLSSDEFDLFQKQVEFMRNLEDRDDEYRTMLDEKLQMAGDSGLIQVYSTELGNRLAS

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHcHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccEEEEcccccHHHHHHHHHHcccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccccHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccc

ccccccccEEEccccccccccccccccccccccccccccccccHHHcccccccccccccccEEccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccEcHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHcHHHHHHHccccEHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccEEEEcccccHHHHHHHHHHHccccHHHHHHHHHEEEEEccccccccHHHcccHHHHHHHHHHHHcccccccccccEEEcccccccccccEEEEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEEEEccccccEEEcHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccEEEEEEHcccccccc

mevlqpipnvkipklntftnmrtrripaprlnshsiraesssssfasspaplpstagEKMVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSipmlqslplspdsrsplTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVknnvnlklqvLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLsfeledlsfrylfpfsyLFVDTWLrshetgskplIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLlkdgripeevndvLGLRviikpssnlvntsevgeraCYTTREIIQSLWKEMphrtkdyiarpkangyrslhmavdvsdngktrplmEIQIRTEEMDMLAVngtashafykggltnpeEAKRLKAIMLAAAELAALRlkdipstnhkgfefdwRDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQLLdsnsdgslssdeFDLFQKQVEFMRNLEDRDDEYRTMLDEKLQMAGDSGLIQVYSTELGNRLAS

mevlqpipnvkipklntftnmrtrripaprlnSHSIraesssssfasspaplpstagEKMVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSIPMLQSlplspdsrsPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVedvsvqgryksrystmkkllkdgripeevndvlglrviikpssnlvntsevgeracYTTREIIQSLWKEMPHRTKDYIarpkangyrSLHMavdvsdngktrPLMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKRLKAIMLAAAELAALrlkdipstnhkgfefdwrdRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQLLDSNSDGSLSSDEFDLFQKQVEFMRNLEDRDDEYRTMLDEKLqmagdsgliqvYSTELGNRLAS

MEVLQPIPNVKIPKLNTFTNMRTRRIPAPRLNshsiraesssssfasspaplpsTAGEKMVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSIPMlqslplspdsrsplTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYdiralildlairldMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKRlkaimlaaaelaalrlKDIPSTNHKGFEFDWRDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQlldsnsdgslssdEFDLFQKQVEFMRNLEDRDDEYRTMLDEKLQMAGDSGLIQVYSTELGNRLAS

***********************************************************MVVKLVGAFNELTERMNVL*****RLLFKALKLSIPML*************TKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDV********LMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKRLKAIMLAAAELAALRLKDIPSTNHKGFEFDWRDRVFRLLDKNGDGRISIEEL*********************************************************************LIQVY**********

***************************************************************LVGAFNELTERMNVLSSSSSRLLFKALKLSIPMLQS*****DSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLR******KPLIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYK*************AIMLAAAELAA********TNHKGFEFDWRDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQLLDSN***SLSSDEFDLFQKQVEFMR**************EKLQMAGDSGLIQVYSTELGNRL**

MEVLQPIPNVKIPKLNTFTNMRTRRIPAPRLNS********************STAGEKMVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKRLKAIMLAAAELAALRLKDIPSTNHKGFEFDWRDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQLLDSNSDGSLSSDEFDLFQKQVEFMRNLEDRDDEYRTMLDEKLQMAGDSGLIQVYSTELGNRLAS

****QPIPNVKIP*********************************************KMVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKRLKAIMLAAAELAALRLKDIPSTNHKGFEFDWRDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDARE***LL******SLSSDEFDLFQKQVEFMRNLEDRDDEYRTMLDEKLQMAGDSGLIQVYSTEL******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		576	2.2.26 [Sep-21-2011]
Q8CS97		729	GTP pyrophosphokinase OS=	yes	no	0.546	0.432	0.326	2e-39
Q5HNR8		729	GTP pyrophosphokinase OS=	yes	no	0.546	0.432	0.326	2e-39
Q6GG70		736	GTP pyrophosphokinase OS=	yes	no	0.510	0.399	0.329	5e-37
P0A0E9		736	GTP pyrophosphokinase OS=	yes	no	0.510	0.399	0.329	5e-37
P0A0F0		736	GTP pyrophosphokinase OS=	yes	no	0.510	0.399	0.329	5e-37
Q6G8T5		736	GTP pyrophosphokinase OS=	yes	no	0.510	0.399	0.329	5e-37
Q99TL8		736	GTP pyrophosphokinase OS=	yes	no	0.510	0.399	0.329	5e-37
Q931Q4		736	GTP pyrophosphokinase OS=	yes	no	0.510	0.399	0.329	5e-37
O54408		734	GTP pyrophosphokinase OS=	yes	no	0.522	0.410	0.337	5e-36
O67012		696	Guanosine-3',5'-bis(dipho	yes	no	0.517	0.428	0.355	1e-35

>sp\|Q8CS97\|RELA_STAES GTP pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=relA PE=3 SV=1	Back alignment and function desciption

 Score =  164 bits (415), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 111/340 (32%), Positives = 181/340 (53%), Gaps = 25/340 (7%)

Query: 114 LSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNL 173
           + VA +L ++++D   I AG L  V+E    + + V+D      A ++    ++K    +
Sbjct: 55  IQVAGILTEMRLDGPTIVAGFLHDVIEDTSYTFEDVKDMFNEEIARIVDGVTKLKK---V 111

Query: 174 KLQVLDDETAAALRK-FCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIH 232
           K +  +++ A   RK F     D+R +++ LA RL  MR L  +PR +Q+ IS E ++I+
Sbjct: 112 KYRSKEEQQAENHRKLFIAIAKDVRVILVKLADRLHNMRTLKAMPREKQVRISKETLEIY 171

Query: 233 APLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKT 292
           APLAH +  N + +ELED + RY+    Y  +   ++   +  +  I       +  +K 
Sbjct: 172 APLAHRLGINTIKWELEDTALRYIDSVQYFRIVNLMKKKRSEREAYI----TNAINKIKN 227

Query: 293 DATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVG 352
           + T  +L  +++  GR K  YS  +K++K  +  +++ D+L +R+I+    N +N     
Sbjct: 228 EMTKMNLSGEIN--GRPKHIYSIYRKMIKQKKQFDQIFDLLAIRIIV----NSIND---- 277

Query: 353 ERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTE 412
              CY T  ++ +LWK MP R KDYIA PK N Y+SLH  V V  NG   PL EIQIRT 
Sbjct: 278 ---CYATLGLVHTLWKPMPGRFKDYIAMPKQNMYQSLHTTV-VGPNGD--PL-EIQIRTH 330

Query: 413 EMDMLAVNGTASHAFYKGGLTNPEEAKRLKAIMLAAAELA 452
           EM  +A +G A+H  YK G T  ++ +  +  +    ELA
Sbjct: 331 EMHEIAEHGVAAHWAYKEGKTVNQKTQDFQNKLNWLKELA 370

In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to changes in nutritional abundance. This enzyme catalyzes the formation of pppGpp which is then hydrolyzed to form ppGpp.
Staphylococcus epidermidis (strain ATCC 12228) (taxid: 176280)
EC: 2EC: .EC: 7EC: .EC: 6EC: .EC: 5

>sp\|Q5HNR8\|RELA_STAEQ GTP pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=relA PE=3 SV=1	Back alignment and function description

>sp\|Q6GG70\|RELA_STAAR GTP pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=relA PE=3 SV=1	Back alignment and function description

>sp\|P0A0E9\|RELA_STAAW GTP pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=relA PE=3 SV=1	Back alignment and function description

>sp\|P0A0F0\|RELA_STAAU GTP pyrophosphokinase OS=Staphylococcus aureus GN=relA PE=3 SV=1	Back alignment and function description

>sp\|Q6G8T5\|RELA_STAAS GTP pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=relA PE=3 SV=1	Back alignment and function description

>sp\|Q99TL8\|RELA_STAAN GTP pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=relA PE=1 SV=2	Back alignment and function description

>sp\|Q931Q4\|RELA_STAAM GTP pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=relA PE=3 SV=2	Back alignment and function description

>sp\|O54408\|RELA_BACSU GTP pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=relA PE=3 SV=3	Back alignment and function description

>sp\|O67012\|SPOT_AQUAE Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase OS=Aquifex aeolicus (strain VF5) GN=spoT PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		576
356548029		579	PREDICTED: guanosine-3',5'-bis(diphospha	0.956	0.951	0.719	0.0
225432183		580	PREDICTED: guanosine-3',5'-bis(diphospha	0.977	0.970	0.732	0.0
255556586		518	guanosine-3',5'-bis(diphosphate) 3'-pyro	0.897	0.998	0.798	0.0
357479179		580	GTP pyrophosphokinase [Medicago truncatu	0.987	0.981	0.705	0.0
30268668		552	RelA-SpoT like protein RSH4 [Nicotiana t	0.928	0.969	0.719	0.0
449459802		591	PREDICTED: GTP pyrophosphokinase-like [C	0.928	0.905	0.719	0.0
224106980		523	predicted protein [Populus trichocarpa]	0.881	0.971	0.788	0.0
307136207		588	guanosine-3'5'-bis(diphosphate) 3'-pyrop	0.923	0.904	0.710	0.0
30684538		583	Ca2+-activated RelA/spot-like protein [A	0.989	0.977	0.671	0.0
297830360		583	RelA/SpoT domain-containing protein [Ara	0.989	0.977	0.670	0.0

>gi\|356548029\|ref\|XP_003542406.1\| PREDICTED: guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase-like [Glycine max]	Back alignment and taxonomy information

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/578 (71%), Positives = 481/578 (83%), Gaps = 27/578 (4%)

Query: 8   PNVKIPKLNTFTNM--RTRRIP------APRLNSHSIRAESSSSSFASSPAPLPSTAGEK 59
           P V +P  ++ + +  R RR P      APR                +    +  + G K
Sbjct: 20  PTVSLPPTHSLSVVVFRRRRSPCGGRWWAPR----------------ACAVEVSESEGGK 63

Query: 60  MVVKLVGAFNELTERMNVLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALL 119
           MV++LVGAFNELTERMNVLS+SSSRLLFK LKLSIP+LQS PL+PD RSPL+KALSVALL
Sbjct: 64  MVMELVGAFNELTERMNVLSTSSSRLLFKCLKLSIPILQSSPLAPDGRSPLSKALSVALL 123

Query: 120 LADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLD 179
           LADLQMDAEVISAG+ R V+E+G +SI ++R+++G+ TAHLLHESLRV NN   ++ V+D
Sbjct: 124 LADLQMDAEVISAGIFRAVLEAGELSIHEIRNQMGLATAHLLHESLRV-NNFPSRIDVVD 182

Query: 180 DETAAALRKFCLTYYDIRALILDLAIRLDMMRHLDYLPRYQQLMISLEVMKIHAPLAHAV 239
           D+ AAALRKFCLTYYDIRALILDLA++LDMMRHLDYLPRYQQ +IS++VMKIHAPLAHAV
Sbjct: 183 DDNAAALRKFCLTYYDIRALILDLALKLDMMRHLDYLPRYQQQIISMQVMKIHAPLAHAV 242

Query: 240 ATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADL 299
            T YLS ELEDLSF+YLFP+SYL+VD WLRSHETG   LIDIYKE+LL+ LK D+ LA+L
Sbjct: 243 GTTYLSLELEDLSFQYLFPYSYLYVDAWLRSHETGGVSLIDIYKEELLRNLKADSLLAEL 302

Query: 300 VEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTT 359
           V+DVS++GR+KSRYSTMKKLLKDGR PE+VNDVLG+RVI+ P +   N  E GERACY T
Sbjct: 303 VDDVSIKGRFKSRYSTMKKLLKDGRKPEDVNDVLGMRVILNPKAG-ENALEAGERACYRT 361

Query: 360 REIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAV 419
            +IIQS+WKE+P+RTKDYIARPKANGY+SLHMAVDVS+NGKTRPLMEIQIRT EMD LAV
Sbjct: 362 HQIIQSMWKEIPYRTKDYIARPKANGYKSLHMAVDVSENGKTRPLMEIQIRTTEMDRLAV 421

Query: 420 NGTASHAFYKGGLTNPEEAKRLKAIMLAAAELAALRLKDIP-STNHKGFEFDWRDRVFRL 478
            GTA+H+ YK GLT+PEEAKRLK IMLAAAELAALRLKD P STNHKG E   RDRVFRL
Sbjct: 422 GGTAAHSLYKAGLTDPEEAKRLKTIMLAAAELAALRLKDFPTSTNHKGIEIHQRDRVFRL 481

Query: 479 LDKNGDGRISIEELMEVMEELGAPGEDAREMMQLLDSNSDGSLSSDEFDLFQKQVEFMRN 538
           LDKNGDG+ISIEEL EVMEELGAPGEDAREMMQLLDSNSDGSLSSDEF +FQ+QVE +RN
Sbjct: 482 LDKNGDGKISIEELTEVMEELGAPGEDAREMMQLLDSNSDGSLSSDEFHMFQEQVELVRN 541

Query: 539 LEDRDDEYRTMLDEKLQMAGDSGLIQVYSTELGNRLAS 576
           LE RDD+Y+ +LDEKL MA +SGLIQVYS E GNRLAS
Sbjct: 542 LEVRDDQYKKLLDEKLHMADESGLIQVYSKEFGNRLAS 579

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225432183\|ref\|XP_002268377.1\| PREDICTED: guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase [Vitis vinifera] gi\|297736813\|emb\|CBI26014.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255556586\|ref\|XP_002519327.1\| guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase, putative [Ricinus communis] gi\|223541642\|gb\|EEF43191.1\| guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357479179\|ref\|XP_003609875.1\| GTP pyrophosphokinase [Medicago truncatula] gi\|355510930\|gb\|AES92072.1\| GTP pyrophosphokinase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|30268668\|dbj\|BAC76005.1\| RelA-SpoT like protein RSH4 [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|449459802\|ref\|XP_004147635.1\| PREDICTED: GTP pyrophosphokinase-like [Cucumis sativus] gi\|449498783\|ref\|XP_004160632.1\| PREDICTED: GTP pyrophosphokinase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224106980\|ref\|XP_002314331.1\| predicted protein [Populus trichocarpa] gi\|222863371\|gb\|EEF00502.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|307136207\|gb\|ADN34045.1\| guanosine-3'5'-bis(diphosphate) 3'-pyrophosphohydrolase [Cucumis melo subsp. melo]	Back alignment and taxonomy information

>gi\|30684538\|ref\|NP_188374.2\| Ca2+-activated RelA/spot-like protein [Arabidopsis thaliana] gi\|29824407\|gb\|AAP04163.1\| unknown protein [Arabidopsis thaliana] gi\|110737231\|dbj\|BAF00563.1\| hypothetical protein [Arabidopsis thaliana] gi\|332642437\|gb\|AEE75958.1\| Ca2+-activated RelA/spot-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297830360\|ref\|XP_002883062.1\| RelA/SpoT domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297328902\|gb\|EFH59321.1\| RelA/SpoT domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		576
TAIR\|locus:2090487		583	CRSH "Ca2+-activated RelA/spot	0.901	0.890	0.632	2.2e-167
TAIR\|locus:2137869		884	RSH1 "RELA/SPOT homolog 1" [Ar	0.541	0.352	0.296	2.6e-26
TIGR_CMR\|DET_0005		728	DET_0005 "GTP pyrophosphokinas	0.345	0.273	0.385	1.9e-25
TIGR_CMR\|CBU_1375		714	CBU_1375 "GTP pyrophosphokinas	0.520	0.420	0.292	1.5e-24
TIGR_CMR\|CBU_0303		707	CBU_0303 "guanosine-3,5-bis(di	0.345	0.281	0.339	4.1e-18
TIGR_CMR\|CPS_4973		703	CPS_4973 "guanosine-3,5-bis(di	0.347	0.284	0.331	1.1e-17
TAIR\|locus:2088262		709	RSH2 "RELA/SPOT homolog 2" [Ar	0.190	0.155	0.448	2e-16
TAIR\|locus:2014335		715	RSH3 "RELA/SPOT homolog 3" [Ar	0.267	0.215	0.375	1.9e-15
UNIPROTKB\|Q3A9Z8		716	relA "GTP pyrophosphokinase" [	0.383	0.308	0.307	2.5e-15
TIGR_CMR\|CHY_2223		716	CHY_2223 "GTP pyrophosphokinas	0.383	0.308	0.307	2.5e-15

TAIR\|locus:2090487 CRSH "Ca2+-activated RelA/spot homolog" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1628 (578.1 bits), Expect = 2.2e-167, P = 2.2e-167
 Identities = 334/528 (63%), Positives = 397/528 (75%)

Query:    56 AGEKMVVKLVGAFNELTERMNV--LSSSSSRLLFKALKLSIPMXXXXXXXXXXXXXXTKA 113
             AG KMVV+LVGAFNE+TERMN   LS+SSSRLLFKALKLSIP+              +KA
Sbjct:    57 AGGKMVVELVGAFNEVTERMNSVWLSTSSSRLLFKALKLSIPILQSLPLASDGRSPLSKA 116

Query:   114 LSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNL 173
             LS++++LADLQMDAEVISA +L +VV++  +SI +VRD IG GTAHLLHE  RVKN +  
Sbjct:   117 LSLSIILADLQMDAEVISASILSEVVDANAISIYEVRDHIGTGTAHLLHEIFRVKN-IPF 175

Query:   174 KLQVLDDETAAALRKFCLTYYXXXXXXXXXXXXXXMMRHLDYLPRYQQLMISLEVMKIHA 233
             K+ VLDDETAA+LRKF LTYY               MRHLD+LPRY+Q ++SLEV+KI++
Sbjct:   176 KVDVLDDETAASLRKFYLTYYDIRAVIMDLVSKLDEMRHLDHLPRYRQQILSLEVLKIYS 235

Query:   234 PLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTD 293
             PLAHAV  N+LS ELED+SFRYLFP SY+++D+WLR HE GSKPLID+YKEQL + LK D
Sbjct:   236 PLAHAVGANHLSLELEDISFRYLFPCSYIYLDSWLRGHENGSKPLIDVYKEQLHRSLKDD 295

Query:   294 ATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGE 353
               LA++V DV ++GRYKSRYS MKKLL+DGR PEEVNDVLGLRVI+ P+S +VN  EVGE
Sbjct:   296 LVLAEMVNDVYIKGRYKSRYSMMKKLLRDGRKPEEVNDVLGLRVILMPNS-VVNDVEVGE 354

Query:   354 RACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTEE 413
             +ACY T EII+SLWKE+PHRTKDYIARPK NGYRSLHMAVDVSD+ + RPLMEIQIRT +
Sbjct:   355 KACYRTSEIIRSLWKEIPHRTKDYIARPKENGYRSLHMAVDVSDSDQIRPLMEIQIRTMD 414

Query:   414 MDMLAVNGTASHAFYKGGLTNPEEAKRXXXXXXXXXXXXXXXXKDIPSTNHKGFEF--DW 471
             MD  A  GTASH+ YKGGLT+P+EAKR                KDI S  H+ F+   + 
Sbjct:   415 MDGSANAGTASHSLYKGGLTDPKEAKRLKAIMLAAADLAAIRLKDISSNKHQSFKTTTNQ 474

Query:   472 RDRVFRLLDKNGDGRISIEELMEVMEELGAPGEDAREMMQXXXXXXXXXXXXXEFDLFQK 531
             RDRVF LLDKNGDG ISIEELMEVMEELGAPGEDA EMMQ             EFD FQK
Sbjct:   475 RDRVFCLLDKNGDGMISIEELMEVMEELGAPGEDAEEMMQLLDSNSDGSLSSDEFDTFQK 534

Query:   532 QVEFMRNLEDRDDEYRTMLDEKLQ---MAGDSGLIQVYSTELGNRLAS 576
             QVEFMR  EDRD+EY+++LDEKL        +GLIQ+Y+ EL +RL++
Sbjct:   535 QVEFMRKWEDRDNEYKSLLDEKLHDLPHQDTTGLIQLYNKELEDRLST 582

GO:0005509 "calcium ion binding" evidence=IEA;ISS

GO:0015969 "guanosine tetraphosphate metabolic process" evidence=IEA

GO:0008728 "GTP diphosphokinase activity" evidence=IGI

GO:0009507 "chloroplast" evidence=IDA

TAIR\|locus:2137869 RSH1 "RELA/SPOT homolog 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|DET_0005 DET_0005 "GTP pyrophosphokinase" [Dehalococcoides ethenogenes 195 (taxid:243164)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_1375 CBU_1375 "GTP pyrophosphokinase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0303 CBU_0303 "guanosine-3,5-bis(diphosphate) 3-pyrophosphohydrolase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_4973 CPS_4973 "guanosine-3,5-bis(diphosphate) 3-pyrophosphohydrolase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

TAIR\|locus:2088262 RSH2 "RELA/SPOT homolog 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2014335 RSH3 "RELA/SPOT homolog 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3A9Z8 relA "GTP pyrophosphokinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_2223 CHY_2223 "GTP pyrophosphokinase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.6	LOW CONFIDENCE prediction!
4th Layer	2.7.6.5	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00019721001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (580 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		576
COG0317		701	COG0317, SpoT, Guanosine polyphosphate pyrophospho	3e-57
TIGR00691		683	TIGR00691, spoT_relA, (p)ppGpp synthetase, RelA/Sp	2e-55
PRK11092		702	PRK11092, PRK11092, bifunctional (p)ppGpp syntheta	2e-35
pfam04607		116	pfam04607, RelA_SpoT, Region found in RelA / SpoT	3e-35
smart00954		111	smart00954, RelA_SpoT, Region found in RelA / SpoT	3e-32
PRK10872		743	PRK10872, relA, (p)ppGpp synthetase I/GTP pyrophos	1e-30
cd05399		129	cd05399, NT_Rel-Spo_like, Nucleotidyltransferase (	5e-29
pfam13328		156	pfam13328, HD_4, HD domain	1e-19
COG2357		231	COG2357, COG2357, PpGpp synthetase catalytic domai	8e-13
cd00051		63	cd00051, EFh, EF-hand, calcium binding motif; A di	9e-12
pfam13499		60	pfam13499, EF_hand_5, EF-hand domain pair	2e-08
COG5126		160	COG5126, FRQ1, Ca2+-binding protein (EF-Hand super	1e-07
PTZ00183		158	PTZ00183, PTZ00183, centrin; Provisional	8e-06
pfam00036		29	pfam00036, efhand, EF hand	2e-05
PTZ00184		149	PTZ00184, PTZ00184, calmodulin; Provisional	2e-05
PTZ00184		149	PTZ00184, PTZ00184, calmodulin; Provisional	2e-05
smart00054		29	smart00054, EFh, EF-hand, calcium binding motif	2e-05
pfam13202		25	pfam13202, EF_hand_3, EF hand	4e-05
pfam13405		30	pfam13405, EF_hand_4, EF-hand domain	1e-04
cd00052		67	cd00052, EH, Eps15 homology domain; found in prote	2e-04
COG5126		160	COG5126, FRQ1, Ca2+-binding protein (EF-Hand super	0.001
PTZ00183		158	PTZ00183, PTZ00183, centrin; Provisional	0.002
smart00027		96	smart00027, EH, Eps15 homology domain	0.002

>gnl\|CDD\|223394 COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription]	Back alignment and domain information

 Score =  203 bits (519), Expect = 3e-57
 Identities = 116/337 (34%), Positives = 169/337 (50%), Gaps = 25/337 (7%)

Query: 106 SRSP-LTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHES 164
           S  P ++  L VA +LA+L MD E ++A LL   +E   V+ + + +  G   A L+   
Sbjct: 45  SGEPYISHPLEVAEILAELHMDMETLAAALLHDTIEDTPVTEELIEEIFGKEVAKLVEGV 104

Query: 165 LRVKNNVNLKLQVLDDETAAALRKFCLTY-YDIRALILDLAIRLDMMRHLDYLPRYQQLM 223
            ++K     +L   ++  A  LRK  L    DIR +++ LA RL  +R L  L   ++  
Sbjct: 105 TKLKKIG--QLSSEEELQAENLRKMLLAMVKDIRVVLIKLADRLHNLRTLKNLDEEKRRR 162

Query: 224 ISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYK 283
           I+ E + I+APLAH +    + +ELEDLSFRYL P  Y  +   L       +  I+   
Sbjct: 163 IARETLDIYAPLAHRLGIGQIKWELEDLSFRYLHPDQYKRIAKLLDEKRLEREQYIENVV 222

Query: 284 EQLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSS 343
            +L + LK     A+      V GR K  YS  +K+ K     +E+ DV  +R+I     
Sbjct: 223 SELREELKAAGIKAE------VSGRPKHIYSIYRKMQKKKLSFDEIYDVRAVRII----- 271

Query: 344 NLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRP 403
             V+T       CYT   I+ +LWK +P    DYIA PK NGY+SLH  V +   GK   
Sbjct: 272 --VDT----IPDCYTALGIVHTLWKPIPGEFDDYIANPKPNGYQSLHTTV-IGPEGKP-- 322

Query: 404 LMEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEEAKR 440
            +E+QIRT+EM  +A  G A+H  YK G +  EE   
Sbjct: 323 -VEVQIRTKEMHEIAELGVAAHWRYKEGGSAYEEKIA 358

Length = 701

>gnl\|CDD\|213552 TIGR00691, spoT_relA, (p)ppGpp synthetase, RelA/SpoT family	Back alignment and domain information

>gnl\|CDD\|236843 PRK11092, PRK11092, bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional	Back alignment and domain information

>gnl\|CDD\|218170 pfam04607, RelA_SpoT, Region found in RelA / SpoT proteins	Back alignment and domain information

>gnl\|CDD\|214934 smart00954, RelA_SpoT, Region found in RelA / SpoT proteins	Back alignment and domain information

>gnl\|CDD\|182797 PRK10872, relA, (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional	Back alignment and domain information

>gnl\|CDD\|143389 cd05399, NT_Rel-Spo_like, Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases	Back alignment and domain information

>gnl\|CDD\|222047 pfam13328, HD_4, HD domain	Back alignment and domain information

>gnl\|CDD\|225232 COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>gnl\|CDD\|222177 pfam13499, EF_hand_5, EF-hand domain pair	Back alignment and domain information

>gnl\|CDD\|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|185503 PTZ00183, PTZ00183, centrin; Provisional	Back alignment and domain information

>gnl\|CDD\|200946 pfam00036, efhand, EF hand	Back alignment and domain information

>gnl\|CDD\|185504 PTZ00184, PTZ00184, calmodulin; Provisional	Back alignment and domain information

>gnl\|CDD\|185504 PTZ00184, PTZ00184, calmodulin; Provisional	Back alignment and domain information

>gnl\|CDD\|197492 smart00054, EFh, EF-hand, calcium binding motif	Back alignment and domain information

>gnl\|CDD\|205383 pfam13202, EF_hand_3, EF hand	Back alignment and domain information

>gnl\|CDD\|205583 pfam13405, EF_hand_4, EF-hand domain	Back alignment and domain information

>gnl\|CDD\|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>gnl\|CDD\|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|185503 PTZ00183, PTZ00183, centrin; Provisional	Back alignment and domain information

>gnl\|CDD\|197477 smart00027, EH, Eps15 homology domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		576
COG0317		701	SpoT Guanosine polyphosphate pyrophosphohydrolases	100.0
PRK10872		743	relA (p)ppGpp synthetase I/GTP pyrophosphokinase;	100.0
PRK11092		702	bifunctional (p)ppGpp synthetase II/ guanosine-3',	100.0
KOG1157		543	consensus Predicted guanosine polyphosphate pyroph	100.0
TIGR00691		683	spoT_relA (p)ppGpp synthetase, RelA/SpoT family. (	100.0
PF13328		153	HD_4: HD domain; PDB: 3NR1_B.	100.0
COG2357		231	PpGpp synthetase catalytic domain [General functio	99.96
cd05399		129	NT_Rel-Spo_like Nucleotidyltransferase (NT) domain	99.95
PF04607		115	RelA_SpoT: Region found in RelA / SpoT proteins; I	99.94
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	99.43
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.4
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	99.17
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	99.01
PTZ00183		158	centrin; Provisional	99.01
PTZ00184		149	calmodulin; Provisional	98.92
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	98.85
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	98.84
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	98.84
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	98.81
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	98.81
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	98.8
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	98.69
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.68
PTZ00183		158	centrin; Provisional	98.63
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	98.6
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.58
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.56
KOG0036		463	consensus Predicted mitochondrial carrier protein	98.53
PLN02964		644	phosphatidylserine decarboxylase	98.52
PTZ00184		149	calmodulin; Provisional	98.51
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.5
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	98.49
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.48
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	98.43
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	98.41
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	98.38
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	98.33
cd00213		88	S-100 S-100: S-100 domain, which represents the la	98.31
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	98.26
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	98.23
TIGR03276		179	Phn-HD phosphonate degradation operons associated	98.21
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	98.18
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	98.04
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	98.01
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	98.01
PF14658		66	EF-hand_9: EF-hand domain	97.97
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	97.93
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	97.74
PLN02964		644	phosphatidylserine decarboxylase	97.72
KOG0036		463	consensus Predicted mitochondrial carrier protein	97.71
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	97.6
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.55
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.5
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	97.5
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	97.49
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	97.46
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	97.44
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	97.39
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	97.31
KOG0038		189	consensus Ca2+-binding kinase interacting protein	97.25
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	97.25
KOG0751		694	consensus Mitochondrial aspartate/glutamate carrie	97.22
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	97.21
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	97.2
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	97.15
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	97.1
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.75
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	96.61
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	96.57
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.55
cd00052		67	EH Eps15 homology domain; found in proteins implic	96.43
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	96.42
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	96.41
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	96.1
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	96.07
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	95.96
KOG4251		362	consensus Calcium binding protein [General functio	95.88
cd00213		88	S-100 S-100: S-100 domain, which represents the la	95.76
KOG4666		412	consensus Predicted phosphate acyltransferase, con	95.71
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	95.68
KOG0046		627	consensus Ca2+-binding actin-bundling protein (fim	95.66
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	95.63
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	95.58
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	95.53
PRK14707		2710	hypothetical protein; Provisional	95.31
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	95.07
KOG4065		144	consensus Uncharacterized conserved protein [Funct	94.9
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	94.83
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	94.47
KOG2562		493	consensus Protein phosphatase 2 regulatory subunit	94.4
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	94.22
KOG0038		189	consensus Ca2+-binding kinase interacting protein	94.1
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	93.97
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	93.09
PRK14707		2710	hypothetical protein; Provisional	92.9
smart00471		124	HDc Metal dependent phosphohydrolases with conserv	92.68
KOG4251		362	consensus Calcium binding protein [General functio	92.54
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	92.45
KOG4578		421	consensus Uncharacterized conserved protein, conta	92.42
PF01966		122	HD: HD domain; InterPro: IPR006674 This domain is	92.27
KOG0751		694	consensus Mitochondrial aspartate/glutamate carrie	91.65
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	91.61
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	90.55
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	90.5
PRK09169		2316	hypothetical protein; Validated	89.0
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	88.93
KOG3555		434	consensus Ca2+-binding proteoglycan Testican [Gene	87.91
TIGR03401		228	cyanamide_fam HD domain protein, cyanamide hydrata	87.62
COG4341		186	Predicted HD phosphohydrolase [General function pr	86.35
KOG1955		737	consensus Ral-GTPase effector RALBP1 [Intracellula	84.89
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	83.16
KOG3866		442	consensus DNA-binding protein of the nucleobindin	82.87
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	82.78
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	82.18
PRK12703		339	tRNA 2'-O-methylase; Reviewed	81.97
KOG4666		412	consensus Predicted phosphate acyltransferase, con	80.2
PRK03826		195	5'-nucleotidase; Provisional	80.04

>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription]	Back alignment and domain information

Probab=100.00  E-value=1.4e-98  Score=825.91  Aligned_cols=361  Identities=32%  Similarity=0.464  Sum_probs=332.5

Q ss_pred             HHHHHHHHHhh-cCChhhHHHHHHHHHHHHHhhcCCCCCCCCCChhHHHHHHHHHHHHcCCCHHHHHhhhhhhccccCCC
Q 008155           66 GAFNELTERMN-VLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGV  144 (576)
Q Consensus        66 ~~~~~l~~~~~-~~~~~~~~~l~~A~~~A~~~h~gq~rk~~g~pyi~H~l~Va~iL~~~~~d~~~i~AalLHDvvEDt~~  144 (576)
                      ..+.++.+.+. +..+.+.+ +.+|+.||.++|.||.|+ +|+||++||++||.||+++++|.++++||||||++|||++
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~-l~kA~~~A~q~H~~q~r~-SGePYi~Hpl~Va~iLael~~d~~tl~AaLLHD~vEDt~~   84 (701)
T COG0317           7 VELEELLDSLATYLPPVDIE-LKKAWYYARQAHGGQTRK-SGEPYISHPLEVAEILAELHMDMETLAAALLHDTIEDTPV   84 (701)
T ss_pred             ccHHHHHHHHHhcCChHHHH-HHHHHHHHHHHhHhhcCc-CCCchhhCHHHHHHHHHHccCCHHHHHHHHccchHhcCCC
Confidence            34566777777 55455555 999999999999999998 9999999999999999999999999999999999999999


Q ss_pred             CHHHHhhhcCHHHHHHHHHhhhhhhhhhhhcccchHHHHHHHHHHHHhc-CCccEEeehhhhHHhhccccCCCCHHHHHH
Q 008155          145 SIQQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTY-YDIRALILDLAIRLDMMRHLDYLPRYQQLM  223 (576)
Q Consensus       145 t~~~i~~~fG~~Va~lV~~ltk~~~~~~~~~~~~~~~~~~~~r~~lla~-~d~rv~lIKLADrl~Nmr~l~~~~~~k~~~  223 (576)
                      |.++|++.||++|+.||+||||++. ++ +..+....+++++|+|+++| .|+||++||||||||||||+..++++||++
T Consensus        85 t~e~i~~~FG~eVa~LV~GvTkl~~-i~-~~~~~~~~qaen~rkmllAm~~DiRvilIKLADRLhNmrtl~~~~~ek~~r  162 (701)
T COG0317          85 TEELIEEIFGKEVAKLVEGVTKLKK-IG-QLSSEEELQAENLRKMLLAMVKDIRVVLIKLADRLHNLRTLKNLDEEKRRR  162 (701)
T ss_pred             CHHHHHHHHCHHHHHHHhhHHHhhh-hh-ccCccchhHHHHHHHHHHHhccCccEEEeehhhhhhhcccCccCCHHHHHH
Confidence            9999999999999999999999999 73 23345556899999999999 999999999999999999999988999999


Q ss_pred             HHHHHHHHHHhHHhHhCchhHHHHHHHhhhhhcccchHHHHHHHHHhhhcCcHHHHHHHHHHHHHHHHhcccccccccce
Q 008155          224 ISLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDV  303 (576)
Q Consensus       224 ~a~Et~~iy~pLA~rlG~~~lk~eLEdl~f~~l~P~~y~~i~~~l~~~~~~~~~~~~~~~~~l~~~l~~~~il~~~~~~~  303 (576)
                      +|+||++||||||||||||++||||||+||+|++|+.|..|.+.+.+.+..++.+++.+...|++.|.+.||      .+
T Consensus       163 iakETl~IyAPLA~RLGi~~iK~ELEDlsFr~l~P~~Y~~I~~~l~e~r~~re~~i~~~~~~l~~~L~~~gi------~a  236 (701)
T COG0317         163 IARETLDIYAPLAHRLGIGQIKWELEDLSFRYLHPDQYKRIAKLLDEKRLEREQYIENVVSELREELKAAGI------KA  236 (701)
T ss_pred             HHHHHHHHHHHHHHHhhhHHHHHHHHhhhhhhhChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCC------eE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998      89


Q ss_pred             eEEeeccCcchHHHHHhhcCCCCCccCCCceEEEEEecCCCCcccchhcHHHHHHHHHHHHhccccCCCcchhhhcCCCc
Q 008155          304 SVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKA  383 (576)
Q Consensus       304 ~v~~R~K~~~Si~~Kl~r~~~~~~~i~Dl~g~RvI~~~~~~~~~~~~~~~~~cy~~~~~i~~~~~~~~~~~kDyI~~Pk~  383 (576)
                      +|+||+|++||||+||++++..|++|+|+.|+||||++           +.+||++||+||.+|+|+|+|||||||+||+
T Consensus       237 ~v~gR~KhiYSIyrKM~~k~~~f~~I~Dl~avRiIv~~-----------~~dCY~~LGiVH~~~kp~PgrFKDYIA~PK~  305 (701)
T COG0317         237 EVSGRPKHIYSIYRKMQKKKLSFDEIYDVRAVRIIVDT-----------IPDCYTALGIVHTLWKPIPGEFDDYIANPKP  305 (701)
T ss_pred             EEEcCCCcccHHHHHHHHcccChhhhhhheeEEEEECC-----------hHHHHHHHHHHHhcCcCCCCccccccccCCC
Confidence            99999999999999999999999999999999999998           6779999999999999999999999999999


Q ss_pred             CCCcccceEEEecCCCCCcceEEEEeeCHhHHHHHhccCcccccccCCCC-ChHHHHHHHHHHHHHHHH
Q 008155          384 NGYRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYKGGLT-NPEEAKRLKAIMLAAAEL  451 (576)
Q Consensus       384 nGYqSlH~~v~~~~~~~~~~~~EIQIRT~~mh~~A~~g~aah~~yk~~~~-~~~~~krL~~l~~aA~el  451 (576)
                      ||||||||+|.    |+.|.++||||||..||..||+|+||||.||++.. ..+...|++.++....+.
T Consensus       306 NgYQSlHTtv~----gp~g~~vEvQIRT~eMh~~AE~GvAAHW~YKe~~~~~~~~~~Wlr~lle~q~~~  370 (701)
T COG0317         306 NGYQSLHTTVI----GPEGKPVEVQIRTKEMHEIAELGVAAHWRYKEGGSAYEEKIAWLRQLLEWQEES  370 (701)
T ss_pred             CCCceeEEEEE----CCCCceEEEEEecHHHHHHHhhhHHHHhHhhcCCchhhHHHHHHHHHHHHHHhc
Confidence            99999999997    45555799999999999999999999999999863 333357777765544443

>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional	Back alignment and domain information

>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional	Back alignment and domain information

>KOG1157 consensus Predicted guanosine polyphosphate pyrophosphohydrolase/synthase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family	Back alignment and domain information

>PF13328 HD_4: HD domain; PDB: 3NR1_B	Back alignment and domain information

>COG2357 PpGpp synthetase catalytic domain [General function prediction only]	Back alignment and domain information

>cd05399 NT_Rel-Spo_like Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases	Back alignment and domain information

>PF04607 RelA_SpoT: Region found in RelA / SpoT proteins; InterPro: IPR007685 The functions of Escherichia coli RelA and SpoT differ somewhat	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR03276 Phn-HD phosphonate degradation operons associated HDIG domain protein	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>PRK14707 hypothetical protein; Provisional	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification]	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PRK14707 hypothetical protein; Provisional	Back alignment and domain information

>smart00471 HDc Metal dependent phosphohydrolases with conserved 'HD' motif	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only]	Back alignment and domain information

>PF01966 HD: HD domain; InterPro: IPR006674 This domain is found in a superfamily of enzymes with a predicted or known phosphohydrolase activity []	Back alignment and domain information

>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>PRK09169 hypothetical protein; Validated	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]	Back alignment and domain information

>TIGR03401 cyanamide_fam HD domain protein, cyanamide hydratase family	Back alignment and domain information

>COG4341 Predicted HD phosphohydrolase [General function prediction only]	Back alignment and domain information

>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only]	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>PRK12703 tRNA 2'-O-methylase; Reviewed	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>PRK03826 5'-nucleotidase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		576
1vj7_A		393	Crystal Structure Of The Bifunctional Catalytic Fra		8e-30
2be3_A		226	Structure Of A Gtp Pyrophosphokinase Family Protein		1e-04

>pdb|1VJ7|A Chain A, Crystal Structure Of The Bifunctional Catalytic Fragment Of Relseq, The RelaSPOT HOMOLOG FROM STREPTOCOCCUS EQUISIMILIS. Length = 393

Back alignment and structure

Iteration: 1

Score = 128 bits (322), Expect = 8e-30, Method: Compositional matrix adjust. Identities = 95/320 (29%), Positives = 156/320 (48%), Gaps = 26/320 (8%) Query: 114 LSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHLLHESLRVKNNVNL 173 + VA +LADL +DA ++ G L VVE +++ + G ++ ++ + Sbjct: 55 IQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDGVTKLGK---V 111 Query: 174 KLQVLDDETAAALRKFCLTYYXXXXXXXXXXXXXXM-MRHLDYLPRYQQLMISLEVMKIH 232 + + +++ A RK + MR L +L + +Q IS E M+I+ Sbjct: 112 EYKSHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERISRETMEIY 171 Query: 233 APLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKT 292 APLAH + + + +ELEDL+FRYL + + + + L+D ++ +K+ Sbjct: 172 APLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVD----DIVTKIKS 227 Query: 293 DATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVG 352 T L DV GR K YS +K+ + +++ D++ +R +++ S++ Sbjct: 228 YTTEQGLFGDVY--GRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDV------- 278 Query: 353 ERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPLMEIQIRTE 412 Y I LW+ MP R KDYIA PKANGY+S+H V G P+ EIQIRT+ Sbjct: 279 ----YAMVGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTV----YGPKGPI-EIQIRTK 329 Query: 413 EMDMLAVNGTASHAFYKGGL 432 EM +A G A+H YK G+ Sbjct: 330 EMHQVAEYGVAAHWAYKKGV 349

PyMOL of 1vj7

>pdb|2BE3|A Chain A, Structure Of A Gtp Pyrophosphokinase Family Protein From Streptococcus Pneumoniae Length = 226

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		576
1vj7_A		393	Bifunctional RELA/SPOT; HD domain, alpha beta 2-la	5e-65
3l9d_A		255	SMU.1046C, putative GTP pyrophosphokinase; transfe	7e-31
2be3_A		226	GTP pyrophosphokinase; structural genomics, PSI, p	9e-30
3nr1_A		178	HD domain-containing protein 3; stringent response	1e-18
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	8e-16
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	1e-15
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	2e-10
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	3e-08
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	3e-15
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	3e-15
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	1e-08
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	2e-05
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	4e-15
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	1e-08
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	3e-08
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	6e-15
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	1e-14
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	2e-08
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	2e-07
2hps_A		186	Coelenterazine-binding protein with bound coelent;	3e-14
2hps_A		186	Coelenterazine-binding protein with bound coelent;	1e-09
3nqw_A		179	CG11900; stringent response, pyrophosphohydrolase,	8e-14
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	9e-14
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	1e-06
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	9e-14
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	1e-13
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	9e-07
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	1e-13
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	9e-13
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	3e-10
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	1e-12
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	5e-07
3li6_A		66	Calcium-binding protein; calcium signaling protein	1e-12
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	2e-12
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	2e-12
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	2e-12
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	7e-10
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	2e-12
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	3e-12
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	5e-12
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	6e-12
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	9e-10
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	8e-12
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	3e-11
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	9e-12
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	2e-08
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	1e-11
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	2e-05
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	1e-11
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	3e-06
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	1e-11
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	1e-11
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	4e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	2e-11
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	2e-11
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	2e-11
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	2e-11
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	2e-11
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	2e-11
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	3e-11
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	3e-11
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	3e-11
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	2e-08
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	3e-11
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	3e-11
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	3e-11
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	4e-11
1c07_A		95	Protein (epidermal growth factor receptor pathway	4e-11
2jnf_A		158	Troponin C; stretch activated muscle contraction,	6e-11
2jnf_A		158	Troponin C; stretch activated muscle contraction,	9e-08
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	6e-11
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	4e-09
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	7e-11
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	7e-11
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	7e-11
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	2e-07
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	1e-10
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	3e-08
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	1e-10
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	2e-07
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	1e-10
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	3e-09
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	3e-09
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	7e-05
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	9e-04
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	1e-10
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	1e-10
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	1e-06
3fwb_A		161	Cell division control protein 31; gene gating, com	1e-10
3fwb_A		161	Cell division control protein 31; gene gating, com	2e-08
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	2e-10
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	7e-07
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	2e-10
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	3e-08
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	2e-10
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	3e-10
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	2e-07
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	3e-10
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	6e-08
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	4e-10
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	3e-08
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	4e-10
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	5e-10
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	9e-09
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	5e-10
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	1e-08
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	6e-10
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	7e-10
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	9e-10
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	4e-08
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	1e-09
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	7e-08
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	8e-05
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	1e-09
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	2e-09
1y1x_A		191	Leishmania major homolog of programmed cell death	2e-09
1y1x_A		191	Leishmania major homolog of programmed cell death	5e-09
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	2e-09
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	2e-07
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	2e-09
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	2e-06
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	2e-09
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	3e-09
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	6e-09
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	6e-07
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	2e-06
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	5e-04
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	5e-09
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	6e-09
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	8e-05
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	1e-04
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	3e-04
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	7e-09
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	5e-06
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	1e-08
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	3e-07
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	2e-08
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	1e-07
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	3e-08
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	2e-05
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	3e-08
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	4e-08
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	1e-05
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	1e-04
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	4e-08
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	4e-08
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	4e-08
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	4e-04
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	5e-08
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	8e-06
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	6e-08
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	1e-07
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	8e-08
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	5e-06
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	8e-08
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	6e-07
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	1e-07
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	2e-06
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	1e-07
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	3e-04
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	2e-07
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	1e-04
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	2e-07
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	3e-07
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	1e-06
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	5e-04
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	8e-04
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	2e-07
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	4e-06
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	2e-07
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	2e-05
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	5e-07
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	4e-04
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	6e-07
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	3e-05
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	6e-07
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	7e-06
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	9e-07
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	2e-04
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	9e-07
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	1e-06
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	1e-06
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	2e-06
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	3e-04
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	2e-06
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	1e-04
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	1e-04
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	2e-06
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	2e-06
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	3e-04
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	4e-04
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	3e-06
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	2e-05
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	9e-05
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	4e-04
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	3e-06
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	5e-04
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	6e-04
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	3e-06
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	7e-04
2jq6_A		139	EH domain-containing protein 1; metal binding prot	3e-06
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	3e-06
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	4e-06
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	2e-05
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	4e-04
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	4e-06
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	7e-06
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	6e-04
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	6e-06
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	3e-04
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	7e-04
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	8e-06
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	1e-05
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	3e-05
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	3e-04
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	1e-05
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	2e-04
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	2e-05
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	1e-04
1nub_A		229	Basement membrane protein BM-40; extracellular mod	3e-05
3soa_A		444	Calcium/calmodulin-dependent protein kinase type a	8e-05
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	2e-04
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	4e-04

>1vj7_A Bifunctional RELA/SPOT; HD domain, alpha beta 2-layer sandwich, helix bundle, mangan PPG2':3'P, (P)PPGPP, PPGPP; HET: GDP GPX; 2.10A {Streptococcus dysgalactiae subsp} SCOP: a.211.1.1 d.218.1.8 Length = 393	Back alignment and structure

 Score =  216 bits (553), Expect = 5e-65
 Identities = 101/333 (30%), Positives = 154/333 (46%), Gaps = 42/333 (12%)

Query: 114 LSVALLLADLQMDAEVISAGLLRQVVESGGVSIQQVRDRIGIGTAHL------LHESLRV 167
           + VA +LADL +DA  ++ G L  VVE   +++  +    G     +      L      
Sbjct: 55  IQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDGVTKLG----- 109

Query: 168 KNNVNLKLQVLDDETAAA--LRKFCL-TYYDIRALILDLAIRLDMMRHLDYLPRYQQLMI 224
                 K++    E   A   RK  +    DIR +++ LA RL  MR L +L + +Q  I
Sbjct: 110 ------KVEYKSHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERI 163

Query: 225 SLEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKE 284
           S E M+I+APLAH +  + + +ELEDL+FRYL    +  +   +       + L+D    
Sbjct: 164 SRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVT 223

Query: 285 QLLQCLKTDATLADLVEDVSVQGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSN 344
           ++           D      V GR K  YS  +K+    +  +++ D++ +R +      
Sbjct: 224 KIKSYTTEQGLFGD------VYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCV------ 271

Query: 345 LVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSDNGKTRPL 404
            + T    +   Y     I  LW+ MP R KDYIA PKANGY+S+H  V     G     
Sbjct: 272 -MET----QSDVYAMVGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTV-YGPKGP---- 321

Query: 405 MEIQIRTEEMDMLAVNGTASHAFYKGGLTNPEE 437
           +EIQIRT+EM  +A  G A+H  YK G+     
Sbjct: 322 IEIQIRTKEMHQVAEYGVAAHWAYKKGVRGKVN 354

PyMOL of 1vj7

>3l9d_A SMU.1046C, putative GTP pyrophosphokinase; transferase; 2.48A {Streptococcus mutans} Length = 255	Back alignment and structure

>2be3_A GTP pyrophosphokinase; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG, transferase; HET: PG4; 2.40A {Streptococcus pneumoniae} SCOP: d.218.1.8 Length = 226	Back alignment and structure

>3nr1_A HD domain-containing protein 3; stringent response, pyrophosphohydrolase, HD (histidine and acid) family, PPGPP hydrolase, hydrolase; 1.90A {Homo sapiens} Length = 178	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186	Back alignment and structure

>3nqw_A CG11900; stringent response, pyrophosphohydrolase, HD (histidine and acid) family ,PPGPP hydrolase, hydrolase; 2.90A {Drosophila melanogaster} Length = 179	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229	Back alignment and structure

>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		576
1vj7_A		393	Bifunctional RELA/SPOT; HD domain, alpha beta 2-la	100.0
3l9d_A		255	SMU.1046C, putative GTP pyrophosphokinase; transfe	100.0
2be3_A		226	GTP pyrophosphokinase; structural genomics, PSI, p	100.0
3nqw_A		179	CG11900; stringent response, pyrophosphohydrolase,	100.0
3nr1_A		178	HD domain-containing protein 3; stringent response	99.97
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.36
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	99.32
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	99.3
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	99.29
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.29
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	99.28
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.28
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	99.27
3fwb_A		161	Cell division control protein 31; gene gating, com	99.25
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	99.25
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	99.24
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	99.22
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	99.22
2jnf_A		158	Troponin C; stretch activated muscle contraction,	99.21
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	99.21
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	99.21
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	99.2
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	99.2
1y1x_A		191	Leishmania major homolog of programmed cell death	99.2
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	99.19
1y1x_A		191	Leishmania major homolog of programmed cell death	99.18
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	99.18
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	99.17
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	99.17
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	99.17
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	99.16
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	99.16
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	99.16
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	99.16
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	99.15
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	99.15
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	99.14
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	99.14
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	99.14
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	99.13
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	99.13
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	99.13
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	99.12
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	99.11
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	99.1
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	99.1
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	99.09
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	99.08
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	99.08
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	99.07
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	99.06
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	99.06
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	99.06
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	99.05
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	99.05
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	99.04
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	99.03
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	99.03
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	99.03
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	99.02
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	99.01
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	99.01
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	99.01
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	99.01
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	99.01
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	99.01
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	99.0
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	99.0
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	98.99
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	98.98
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	98.98
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	98.97
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	98.97
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	98.96
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	98.95
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	98.95
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.94
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	98.94
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	98.94
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	98.93
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	98.93
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	98.93
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	98.92
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	98.92
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.92
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	98.92
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	98.91
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	98.91
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	98.91
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	98.9
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	98.9
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	98.9
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	98.9
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	98.89
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	98.89
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	98.88
1c07_A		95	Protein (epidermal growth factor receptor pathway	98.88
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	98.88
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	98.88
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	98.87
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	98.86
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	98.86
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	98.86
2jnf_A		158	Troponin C; stretch activated muscle contraction,	98.85
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	98.85
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	98.85
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	98.85
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	98.85
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	98.85
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	98.85
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	98.85
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	98.84
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	98.84
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	98.84
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	98.84
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	98.84
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	98.84
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	98.83
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	98.83
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	98.83
3li6_A		66	Calcium-binding protein; calcium signaling protein	98.83
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	98.83
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	98.83
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	98.83
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	98.83
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	98.82
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	98.82
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	98.82
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	98.82
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	98.82
3fwb_A		161	Cell division control protein 31; gene gating, com	98.81
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.81
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	98.81
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	98.81
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	98.81
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	98.81
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	98.8
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.8
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	98.8
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	98.79
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	98.79
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	98.79
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	98.79
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	98.79
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	98.79
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	98.78
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	98.78
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	98.77
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	98.77
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.77
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	98.77
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	98.77
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	98.77
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	98.77
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	98.77
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	98.76
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.76
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	98.76
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	98.76
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	98.76
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	98.75
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	98.75
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	98.75
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	98.75
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	98.75
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.75
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	98.74
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	98.74
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.73
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.73
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	98.73
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	98.72
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	98.72
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	98.72
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	98.72
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	98.71
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	98.71
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	98.71
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	98.7
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	98.7
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	98.7
2hps_A		186	Coelenterazine-binding protein with bound coelent;	98.7
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	98.69
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	98.69
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	98.69
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	98.68
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	98.68
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	98.68
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	98.68
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	98.67
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	98.67
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.67
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	98.66
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	98.66
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.66
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	98.66
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	98.65
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	98.65
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	98.65
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	98.65
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	98.64
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.64
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	98.64
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	98.64
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	98.63
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.63
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	98.63
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	98.63
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	98.63
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	98.62
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	98.62
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	98.62
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	98.61
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	98.61
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	98.61
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	98.61
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.6
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	98.6
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	98.58
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	98.58
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	98.57
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.57
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	98.57
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	98.56
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	98.54
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	98.54
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	98.53
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	98.53
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.52
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	98.52
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	98.52
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	98.52
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	98.51
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.5
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	98.5
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	98.49
2hps_A		186	Coelenterazine-binding protein with bound coelent;	98.48
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	98.47
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.47
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	98.47
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	98.47
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	98.44
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	98.44
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	98.43
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	98.4
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	98.39
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	98.35
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	98.34
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	98.34
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.29
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	98.23
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	98.13
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	98.12
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	98.01
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.99
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	97.99
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	97.94
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	97.84
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	97.68
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	97.67
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	97.65
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	97.62
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	97.5
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	97.49
3li6_A		66	Calcium-binding protein; calcium signaling protein	97.49
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	97.4
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	97.35
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	97.35
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	97.34
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	97.34
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	97.32
1nub_A		229	Basement membrane protein BM-40; extracellular mod	97.3
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	97.28
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	97.26
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	97.21
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	97.2
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	97.19
1c07_A		95	Protein (epidermal growth factor receptor pathway	97.16
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	97.16
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	97.14
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	97.12
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	97.03
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	97.01
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	97.01
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	97.0
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	96.99
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	96.89
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	96.68
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	96.67
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	96.6
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	96.59
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	96.56
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	96.52
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	96.5
2jq6_A		139	EH domain-containing protein 1; metal binding prot	96.48
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	96.48
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	96.48
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	96.45
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	96.42
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	96.41
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	96.39
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	96.18
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	96.18
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	96.18
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	96.17
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	96.16
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	96.16
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	96.13
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	96.08
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	96.02
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	95.98
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	95.87
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	95.79
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	95.77
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	94.97
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	94.9
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	94.62
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	94.59
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	94.58
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	93.71
3dto_A		223	BH2835 protein; all alpha-helical protein, structu	89.66
1nub_A		229	Basement membrane protein BM-40; extracellular mod	89.36
3b57_A		209	LIN1889 protein; Q92AN1, X-RAY, NESG, structural g	89.17
2qgs_A		225	Protein Se1688; alpha-helical protein, structural	88.07
2pq7_A		220	Predicted HD superfamily hydrolase; 104161995, HD	86.94
2pjq_A		231	Uncharacterized protein LP_2664; LPR71, NESG, stru	86.73
2paq_A		201	5'-deoxynucleotidase YFBR; HD domain phosphoh stru	85.97
1pul_A		125	Hypothetical protein C32E8.3 in chromosome I; alph	84.23
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	83.21
2ccl_B		63	Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d	82.62
4fl4_A		88	Glycoside hydrolase family 9; structural genomics,	80.59

>1vj7_A Bifunctional RELA/SPOT; HD domain, alpha beta 2-layer sandwich, helix bundle, mangan PPG2':3'P, (P)PPGPP, PPGPP; HET: GDP GPX; 2.10A {Streptococcus dysgalactiae subsp} SCOP: a.211.1.1 d.218.1.8	Back alignment and structure

Probab=100.00  E-value=2.8e-97  Score=782.28  Aligned_cols=339  Identities=30%  Similarity=0.448  Sum_probs=302.0

Q ss_pred             HHHHHHHhh-cCChhhHHHHHHHHHHHHHhhcCCCCCCCCCChhHHHHHHHHHHHHcCCCHHHHHhhhhhhccccCCCCH
Q 008155           68 FNELTERMN-VLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSI  146 (576)
Q Consensus        68 ~~~l~~~~~-~~~~~~~~~l~~A~~~A~~~h~gq~rk~~g~pyi~H~l~Va~iL~~~~~d~~~i~AalLHDvvEDt~~t~  146 (576)
                      +++|++.+. |+++.+.+++.+|+.||.++|.||+|+ +|+||+.||++||.||+++|+|.++++||||||++|||++|.
T Consensus         9 ~~~l~~~~~~~~~~~~~~~l~~A~~~A~~aH~gQ~rk-sGePYi~Hpl~VA~iLa~l~~D~~~i~AALLHDvvEDt~~t~   87 (393)
T 1vj7_A            9 GEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRK-SGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITL   87 (393)
T ss_dssp             HHHHHHHHHHHSCHHHHHHHHHHHHHHHHHTTTCBCT-TSCBTTHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHSSCCH
T ss_pred             HHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhccCcCC-CCCcHHHHHHHHHHHHHHhcCCHHHHHHHHhhhHHhcCCCCH
Confidence            466777776 999999999999999999999999999 999999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCHHHHHHHHHhhhhhhhhhhhcccchHHHHHHHHHHHHhc-CCccEEeehhhhHHhhccccCCCCHHHHHHHH
Q 008155          147 QQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTY-YDIRALILDLAIRLDMMRHLDYLPRYQQLMIS  225 (576)
Q Consensus       147 ~~i~~~fG~~Va~lV~~ltk~~~~~~~~~~~~~~~~~~~~r~~lla~-~d~rv~lIKLADrl~Nmr~l~~~~~~k~~~~a  225 (576)
                      ++|++.||++|+.+|+||||+++ +++.  .....+++++|+|+++| .|+||++|||||||||||++..+|+++|+++|
T Consensus        88 e~I~~~FG~~Va~lV~gvTk~~~-~~~~--~~~~~qae~~Rkmllam~~D~RvvlIKLADRlhNmRtl~~~~~ek~~~iA  164 (393)
T 1vj7_A           88 DNIEFDFGKDVRDIVDGVTKLGK-VEYK--SHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERIS  164 (393)
T ss_dssp             HHHHHHHCHHHHHHHHHHHHHC-----------------CCSCTTTSCCCHHHHHHHHHHHHHHHHTCC------HHHHH
T ss_pred             HHHHHHhCHHHHHHHHHHHhccc-CCcc--cHHHHHHHHHHHHHHhhcCCcceeeeeHHHHHHccCchhhCChHHHHHHH
Confidence            99999999999999999999998 7642  34456889999999999 89999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHhHhCchhHHHHHHHhhhhhcccchHHHHHHHHHhhhcCcHHHHHHHHHHHHHHHHhcccccccccceeE
Q 008155          226 LEVMKIHAPLAHAVATNYLSFELEDLSFRYLFPFSYLFVDTWLRSHETGSKPLIDIYKEQLLQCLKTDATLADLVEDVSV  305 (576)
Q Consensus       226 ~Et~~iy~pLA~rlG~~~lk~eLEdl~f~~l~P~~y~~i~~~l~~~~~~~~~~~~~~~~~l~~~l~~~~il~~~~~~~~v  305 (576)
                      +||++||||||||||||+||||||||||+||+|+.|..|.+++.+.+..++.+++.+...|++.|.+.||      .+.|
T Consensus       165 ~Etl~iyaPLA~rLGi~~ik~ELEdl~f~~l~p~~y~~i~~~l~~~r~~r~~~i~~i~~~l~~~L~~~gi------~~~v  238 (393)
T 1vj7_A          165 RETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVTKIKSYTTEQGL------FGDV  238 (393)
T ss_dssp             HHHHHTHHHHHHHTTCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHTTTC------CCEE
T ss_pred             HHHHHHHHHHHhhcChhHHHHHHHHHHhcccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC------ceEE
Confidence            9999999999999999999999999999999999999999999999999999999999999999999998      7899


Q ss_pred             EeeccCcchHHHHHhhcCCCCCccCCCceEEEEEecCCCCcccchhcHHHHHHHHHHHHhccccCCCcchhhhcCCCcCC
Q 008155          306 QGRYKSRYSTMKKLLKDGRIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTTREIIQSLWKEMPHRTKDYIARPKANG  385 (576)
Q Consensus       306 ~~R~K~~~Si~~Kl~r~~~~~~~i~Dl~g~RvI~~~~~~~~~~~~~~~~~cy~~~~~i~~~~~~~~~~~kDyI~~Pk~nG  385 (576)
                      +||+|++||||+||.|+|.++++|+|++|+||||++           +.+||+++++||+.|+|+|+++||||++||+||
T Consensus       239 ~~R~K~~~Si~~Km~rk~~~~~~i~Di~giRIi~~~-----------~~dcy~vl~~i~~~~~~~~~~~kDyIa~PK~nG  307 (393)
T 1vj7_A          239 YGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMET-----------QSDVYAMVGYIHELWRPMPGRFKDYIAAPKANG  307 (393)
T ss_dssp             EECCCCHHHHHHHHHHHGGGCCTTGGGCEEEEEESS-----------HHHHHHHHHHHHHHSCBCTTCCEETTTSCCTTC
T ss_pred             EEEeCChHHHHHHHHHhCCChhhhcccceEEEEECC-----------HHHHHHHHHHHHhcCCCCCCcccccccCCCcCC
Confidence            999999999999999999999999999999999998           778999999999999999999999999999999


Q ss_pred             CcccceEEEecCCCCCcceEEEEeeCHhHHHHHhccCcccccccCCC
Q 008155          386 YRSLHMAVDVSDNGKTRPLMEIQIRTEEMDMLAVNGTASHAFYKGGL  432 (576)
Q Consensus       386 YqSlH~~v~~~~~~~~~~~~EIQIRT~~mh~~A~~g~aah~~yk~~~  432 (576)
                      |||||++|..    +.+ ++||||||..||.||++|+++||.||++.
T Consensus       308 YqSlH~~v~~----p~~-~vEIQIRT~~mh~~Ae~g~aah~~YK~~~  349 (393)
T 1vj7_A          308 YQSIHTTVYG----PKG-PIEIQIRTKEMHQVAEYGVAAHWAYKKGV  349 (393)
T ss_dssp             CCCEEEEEEC----SSS-EEEEEEEEHHHHHHHHHTTCC--------
T ss_pred             cceeEEEEEe----CCc-eEEEEEecHHHHHHHHhhHHHHhccccCC
Confidence            9999999973    455 79999999999999999999999999864

PyMOL of 1vj7

>3l9d_A SMU.1046C, putative GTP pyrophosphokinase; transferase; 2.48A {Streptococcus mutans}	Back alignment and structure

>2be3_A GTP pyrophosphokinase; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG, transferase; HET: PG4; 2.40A {Streptococcus pneumoniae} SCOP: d.218.1.8	Back alignment and structure

>3nqw_A CG11900; stringent response, pyrophosphohydrolase, HD (histidine and acid) family ,PPGPP hydrolase, hydrolase; 2.90A {Drosophila melanogaster}	Back alignment and structure

>3nr1_A HD domain-containing protein 3; stringent response, pyrophosphohydrolase, HD (histidine and acid) family, PPGPP hydrolase, hydrolase; 1.90A {Homo sapiens}	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3dto_A BH2835 protein; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 3.30A {Bacillus halodurans} SCOP: a.211.1.1	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>3b57_A LIN1889 protein; Q92AN1, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 3.00A {Listeria innocua CLIP11262} SCOP: a.211.1.1	Back alignment and structure

>2qgs_A Protein Se1688; alpha-helical protein, structural genomics, PSI-2, protein S initiative, northeast structural genomics consortium; 2.00A {Staphylococcus epidermidis} SCOP: a.211.1.1	Back alignment and structure

>2pq7_A Predicted HD superfamily hydrolase; 104161995, HD domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.45A {Uncultured thermotogales bacterium} SCOP: a.211.1.1	Back alignment and structure

>2pjq_A Uncharacterized protein LP_2664; LPR71, NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Lactobacillus plantarum WCFS1} SCOP: a.211.1.1	Back alignment and structure

>2paq_A 5'-deoxynucleotidase YFBR; HD domain phosphoh structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; 2.10A {Escherichia coli} SCOP: a.211.1.1 PDB: 2par_A* 2pau_A*	Back alignment and structure

>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11	Back alignment and structure

>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B	Back alignment and structure

>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		576
d2be3a1		203	d.218.1.8 (A:1-203) Putative GTP pyrophosphokinase	1e-20
d1vj7a1		192	a.211.1.1 (A:5-196) Stringent response-like protei	4e-19
d1vj7a2		175	d.218.1.8 (A:197-371) Stringent response-like prot	1e-15
d2opoa1		81	a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che	5e-12
d2opoa1		81	a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che	2e-04
d1c7va_		68	a.39.1.5 (A:) Calcium vector protein {Amphioxus (B	1e-10
d1oqpa_		77	a.39.1.5 (A:) Caltractin (centrin 2) {Green algae	2e-10
d1oqpa_		77	a.39.1.5 (A:) Caltractin (centrin 2) {Green algae	0.002
d1pvaa_		109	a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax	1e-09
d1tiza_		67	a.39.1.5 (A:) Calmodulin-related protein T21P5.17	2e-09
d1tiza_		67	a.39.1.5 (A:) Calmodulin-related protein T21P5.17	5e-05
d1jc2a_		75	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	2e-09
d1jc2a_		75	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	3e-04
d1fi5a_		81	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus),	3e-09
d1fi5a_		81	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus),	0.002
d2obha1		141	a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien	4e-09
d2obha1		141	a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien	1e-06
d1topa_		162	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	6e-09
d1topa_		162	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	0.002
d1ij5a_		321	a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind	1e-08
d1ij5a_		321	a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind	6e-06
d1rroa_		108	a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus)	1e-08
d2pvba_		107	a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax	1e-08
d5pala_		109	a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis	1e-08
d1rwya_		109	a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta	2e-08
d1rwya_		109	a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta	0.002
d2fcea1		61	a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [	2e-08
d1snla_		99	a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo	3e-08
d1snla_		99	a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo	0.002
d1s6ja_		87	a.39.1.5 (A:) Calcium-dependent protein kinase sk5	3e-08
d1fw4a_		65	a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId:	4e-08
d1c07a_		95	a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId:	5e-08
d1qjta_		99	a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId:	8e-08
d1df0a1		186	a.39.1.8 (A:515-700) Calpain large subunit, C-term	8e-08
d1avsa_		81	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	9e-08
d1dtla_		156	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	1e-07
d2sasa_		185	a.39.1.5 (A:) Sarcoplasmic calcium-binding protein	2e-07
d2sasa_		185	a.39.1.5 (A:) Sarcoplasmic calcium-binding protein	2e-04
d2sasa_		185	a.39.1.5 (A:) Sarcoplasmic calcium-binding protein	0.004
d1nyaa_		176	a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth	2e-07
d1nyaa_		176	a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth	6e-06
d1nyaa_		176	a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth	2e-04
d1f54a_		77	a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom	2e-07
d1fi6a_		92	a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId:	3e-07
d1cb1a_		78	a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax	4e-07
d2pq3a1		73	a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T	4e-07
d2scpa_		174	a.39.1.5 (A:) Sarcoplasmic calcium-binding protein	8e-07
d2scpa_		174	a.39.1.5 (A:) Sarcoplasmic calcium-binding protein	9e-05
d1lkja_		146	a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom	8e-07
d1lkja_		146	a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom	1e-05
d1k94a_		165	a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta	9e-07
d1k94a_		165	a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta	0.003
d3c1va1		93	a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa	1e-06
d3c1va1		93	a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa	0.004
d1fpwa_		190	a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1	1e-06
d1fpwa_		190	a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1	3e-04
d1ksoa_		93	a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien	2e-06
d2jxca1		95	a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [	2e-06
d1omra_		201	a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId:	3e-06
d1g8ia_		187	a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1	3e-06
d1g8ia_		187	a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1	0.002
d1bjfa_		181	a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId	4e-06
d1bjfa_		181	a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId	0.003
d1bjfa_		181	a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId	0.004
d1juoa_		172	a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId:	4e-06
d1juoa_		172	a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId:	0.001
d1xo5a_		180	a.39.1.5 (A:) Calcium- and integrin-binding protei	4e-06
d1yuta1		98	a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa	5e-06
d1a4pa_		92	a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien	7e-06
d1uhka1		187	a.39.1.5 (A:3-189) Calcium-regulated photoprotein	8e-06
d1uhka1		187	a.39.1.5 (A:3-189) Calcium-regulated photoprotein	3e-05
d1exra_		146	a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr	8e-06
d1exra_		146	a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr	1e-04
d1exra_		146	a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr	0.004
d1wrka1		82	a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens)	1e-05
d1m45a_		146	a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye	1e-05
d2hf5a1		33	a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien	2e-05
d1qx2a_		76	a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax	2e-05
d1k8ua_		89	a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien	2e-05
d1alva_		173	a.39.1.8 (A:) Calpain small (regulatory) subunit (	2e-05
d1jfja_		134	a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly	2e-05
d1jfja_		134	a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly	0.002
d1wlza1		83	a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H	3e-05
d1qxpa2		188	a.39.1.8 (A:515-702) Calpain large subunit, C-term	3e-05
d1qxpa2		188	a.39.1.8 (A:515-702) Calpain large subunit, C-term	4e-05
d1qxpa2		188	a.39.1.8 (A:515-702) Calpain large subunit, C-term	0.002
d1zfsa1		93	a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no	4e-05
d2zfda1		183	a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {	4e-05
d2zfda1		183	a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {	2e-04
d1iq3a_		110	a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9	6e-05
d1xk4a1		87	a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa	7e-05
d1psra_		100	a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien	8e-05
d1w7jb1		139	a.39.1.5 (B:11-149) Myosin Essential Chain {Human	1e-04
d1w7jb1		139	a.39.1.5 (B:11-149) Myosin Essential Chain {Human	5e-04
d1e8aa_		87	a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien	1e-04
d1e8aa_		87	a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien	0.002
d1s6ca_		178	a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera	1e-04
d1s6ca_		178	a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera	4e-04
d1s6ca_		178	a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera	7e-04
d1s6ca_		178	a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera	0.002
d1jbaa_		189	a.39.1.5 (A:) Guanylate cyclase activating protein	2e-04
d1jbaa_		189	a.39.1.5 (A:) Guanylate cyclase activating protein	3e-04
d1jbaa_		189	a.39.1.5 (A:) Guanylate cyclase activating protein	0.002
d1s6ia_		182	a.39.1.5 (A:) Calcium-dependent protein kinase sk5	3e-04
d1qv0a_		189	a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr	3e-04
d1y1xa_		182	a.39.1.8 (A:) Programmed cell death 6 protein-like	4e-04
d1hqva_		181	a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous	6e-04
d1hqva_		181	a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous	0.001
d1ggwa_		140	a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo	7e-04
d2zkmx1		170	a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human	8e-04
d1ctda_		34	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	0.002
d3cr5x1		90	a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru	0.003
d1auib_		165	a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch	0.003

>d2be3a1 d.218.1.8 (A:1-203) Putative GTP pyrophosphokinase SP1097 {Streptococcus pneumoniae [TaxId: 1313]} Length = 203	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Nucleotidyltransferase
superfamily: Nucleotidyltransferase
family: RelA/SpoT domain
domain: Putative GTP pyrophosphokinase SP1097
species: Streptococcus pneumoniae [TaxId: 1313]

 Score = 87.9 bits (217), Expect = 1e-20
 Identities = 43/182 (23%), Positives = 73/182 (40%), Gaps = 30/182 (16%)

Query: 304 SVQGRYKSRYSTMKKLLKDG----RIPEEVNDVLGLRVIIKPSSNLVNTSEVGERACYTT 359
            V GR K   S  +K+ + G     +  ++ D+ GLRV+++                   
Sbjct: 41  FVTGRVKPIESIKEKMARRGITYATLEHDLQDIAGLRVMVQF-----------VDDVKEV 89

Query: 360 REIIQSLWKEMPHRTKDYIARPKANGYRSLHMAVDVSD---NGKTRPLMEIQIRTEEMDM 416
            +I+         + +DYI   KA+GYRS H+ V+ +    NG    L EIQIRT  M+ 
Sbjct: 90  VDILHKRQDMRIIQERDYITHRKASGYRSYHVVVEYTVDTINGAKTILAEIQIRTLAMNF 149

Query: 417 LAVNGTASHAFYKGGLTNPEEAKRLKAI--MLAAAELAALRLKDIPSTNHKGFEFDWRDR 474
            A    + +  Y+G   + E  KRL+    +    +     ++D         +      
Sbjct: 150 WATIEHSLNYKYQGDFPD-EIKKRLEITARIAHQLDEEMGEIRD---------DIQEAQA 199

Query: 475 VF 476
           +F
Sbjct: 200 LF 201

PyMOL of d2be3a1

>d1vj7a1 a.211.1.1 (A:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]} Length = 192	Back information, alignment and structure

>d1vj7a2 d.218.1.8 (A:197-371) Stringent response-like protein RelA domain 2 {Streptococcus equisimilis [TaxId: 119602]} Length = 175	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 34	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		576
d1vj7a1		192	Stringent response-like protein RelA N-terminal do	100.0
d1vj7a2		175	Stringent response-like protein RelA domain 2 {Str	100.0
d2be3a1		203	Putative GTP pyrophosphokinase SP1097 {Streptococc	99.97
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	99.26
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	99.22
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	99.21
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	99.2
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	99.16
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.15
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	99.15
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	99.14
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	99.14
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.13
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	99.13
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	99.1
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	99.1
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	99.1
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	99.1
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	99.08
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	99.08
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	99.08
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	99.07
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	99.07
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	99.06
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.06
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	99.06
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	99.05
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.04
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	99.04
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.04
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.03
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.03
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	99.03
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	99.02
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	99.02
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	99.01
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	99.01
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.99
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	98.99
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	98.98
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	98.93
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	98.92
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	98.9
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	98.89
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	98.88
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	98.86
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.85
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	98.83
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	98.83
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	98.79
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.78
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	98.78
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.77
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	98.77
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.77
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.77
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	98.77
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.77
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	98.75
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	98.72
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	98.72
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	98.71
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	98.69
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	98.68
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	98.68
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.67
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	98.67
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.64
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.63
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	98.62
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.61
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	98.61
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	98.61
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.6
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.59
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	98.59
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.58
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	98.56
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	98.56
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	98.56
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.54
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.53
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	98.51
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	98.5
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	98.5
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	98.48
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	98.47
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	98.47
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	98.47
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	98.46
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	98.46
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	98.45
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	98.45
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	98.45
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	98.44
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	98.44
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	98.44
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	98.42
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	98.42
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	98.42
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	98.41
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	98.4
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.39
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	98.37
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	98.37
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	98.37
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	98.36
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	98.35
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.34
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.32
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	98.31
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	98.3
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.28
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.27
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	98.2
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	98.12
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	98.03
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.03
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	97.87
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	97.82
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	97.78
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	97.75
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	97.67
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.67
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	97.66
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	97.66
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	97.64
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	97.64
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.64
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	97.61
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	97.6
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.51
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	97.51
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	97.49
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	97.47
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	97.42
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	97.34
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	97.32
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	97.28
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	97.18
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	97.08
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	97.06
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	96.96
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	96.95
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	96.36
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	96.33
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	96.31
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	96.23
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	96.05
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	95.81
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	95.76
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	95.73
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	95.42
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	95.3
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	95.29
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	95.1
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	93.85
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	93.78
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	92.5
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	92.13
d1qasa1		94	Phosphoinositide-specific phospholipase C, isozyme	91.15
d3dtoa1		212	Uncharacterized protein BH2835 {Bacillus haloduran	88.2
d2qgsa1		216	Uncharacterized protein SE1688 {Staphylococcus epi	87.3
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	87.28
d3b57a1		201	Uncharacterized protein Lin1889 {Listeria innocua	85.82
d2cclb1		59	Endo-1,4-beta-xylanase Y {Clostridium thermocellum	85.63
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	84.91
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	84.84
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	83.04
d1wlma1		138	Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090	80.48

>d1vj7a1 a.211.1.1 (A:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]}	Back information, alignment and structure

class: All alpha proteins
fold: HD-domain/PDEase-like
superfamily: HD-domain/PDEase-like
family: HD domain
domain: Stringent response-like protein RelA N-terminal domain
species: Streptococcus equisimilis [TaxId: 119602]

Probab=100.00  E-value=1.9e-52  Score=401.74  Aligned_cols=186  Identities=29%  Similarity=0.419  Sum_probs=160.7

Q ss_pred             HHHHHHHhh-cCChhhHHHHHHHHHHHHHhhcCCCCCCCCCChhHHHHHHHHHHHHcCCCHHHHHhhhhhhccccCCCCH
Q 008155           68 FNELTERMN-VLSSSSSRLLFKALKLSIPMLQSLPLSPDSRSPLTKALSVALLLADLQMDAEVISAGLLRQVVESGGVSI  146 (576)
Q Consensus        68 ~~~l~~~~~-~~~~~~~~~l~~A~~~A~~~h~gq~rk~~g~pyi~H~l~Va~iL~~~~~d~~~i~AalLHDvvEDt~~t~  146 (576)
                      .++++..+. |+++.+.+++.+|+.||.++|+||+|+ +|+||++||++||.+|+++++|+++++||||||++|||++|.
T Consensus         5 ~e~~l~~~~~yl~~~d~~~i~~A~~~A~~~H~gq~r~-sG~py~~H~~~VA~iL~~~~~d~~~i~AalLhd~~edt~~t~   83 (192)
T d1vj7a1           5 GEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRK-SGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITL   83 (192)
T ss_dssp             HHHHHHHHHHHSCHHHHHHHHHHHHHHHHHTTTCBCT-TSCBTTHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHSSCCH
T ss_pred             HHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHcCCccc-ChHHHHHHHHHHHHHHHHhcCChHHhhhhheechhhhchhHH
Confidence            356666666 999999999999999999999999998 999999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCHHHHHHHHHhhhhhhhhhhhcccchHHHHHHHHHHHHhc-CCccEEeehhhhHHhhccccCCCCHHHHHHHH
Q 008155          147 QQVRDRIGIGTAHLLHESLRVKNNVNLKLQVLDDETAAALRKFCLTY-YDIRALILDLAIRLDMMRHLDYLPRYQQLMIS  225 (576)
Q Consensus       147 ~~i~~~fG~~Va~lV~~ltk~~~~~~~~~~~~~~~~~~~~r~~lla~-~d~rv~lIKLADrl~Nmr~l~~~~~~k~~~~a  225 (576)
                      ++|++.||++|+.+|.++|++.. ++.+  .....+++++|+|++++ .|+||++|||||||||||++..+|+++++++|
T Consensus        84 e~I~~~FG~~Va~lV~~ltk~~~-~~~~--~~~~~~ae~~rkmlla~~~d~rvvlIKLADRLhnlrtl~~~~~~k~~~~a  160 (192)
T d1vj7a1          84 DNIEFDFGKDVRDIVDGVTKLGK-VEYK--SHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERIS  160 (192)
T ss_dssp             HHHHHHHCHHHHHHHHHHHHHC-----------------CCSCTTTSCCCHHHHHHHHHHHHHHHHTCC------HHHHH
T ss_pred             HHHHHhcchhHHHHHHHHHhhcc-cccc--ccchHHHHHHHHHHHhhccCceeehhHHHHHHhhccccccCChHHHHHHH
Confidence            99999999999999999999988 6643  34456678999999999 89999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHhHhCchhHHHHHHHhhhhhcc
Q 008155          226 LEVMKIHAPLAHAVATNYLSFELEDLSFRYLF  257 (576)
Q Consensus       226 ~Et~~iy~pLA~rlG~~~lk~eLEdl~f~~l~  257 (576)
                      +||+++|+|||+|||+|++|||||||||+||+
T Consensus       161 ~Et~~iyaplA~rLG~~~ik~eLEdl~f~~L~  192 (192)
T d1vj7a1         161 RETMEIYAPLAHRLGISRIKWELEDLAFRYLN  192 (192)
T ss_dssp             HHHHHTHHHHHHHTTCHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHhCcHHHHHHHHHHHHHhcC
Confidence            99999999999999999999999999999986

PyMOL of d1vj7a1

>d1vj7a2 d.218.1.8 (A:197-371) Stringent response-like protein RelA domain 2 {Streptococcus equisimilis [TaxId: 119602]}	Back information, alignment and structure

>d2be3a1 d.218.1.8 (A:1-203) Putative GTP pyrophosphokinase SP1097 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d3dtoa1 a.211.1.1 (A:2-213) Uncharacterized protein BH2835 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2qgsa1 a.211.1.1 (A:1-216) Uncharacterized protein SE1688 {Staphylococcus epidermidis [TaxId: 1282]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d3b57a1 a.211.1.1 (A:1-201) Uncharacterized protein Lin1889 {Listeria innocua [TaxId: 1642]}	Back information, alignment and structure

>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure