Citrus Sinensis ID: 008196

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570----
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERISTTSGTSLSVGSPKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
cccccccEEEEEEccccEEEEEcccccEEEcccccccccEEEEEEEcccccEEEEEEccccEEEEEcccccccEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEEcccccEEEEEEcccccccEEEcccccEEEEccccccEEcccccccccEEEccccccccccEEEcccccccEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccEEEEEEEccccEEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccccccccHHHHccccccEEEEcccccEEEEEEccccccEEEEcccccHHEEEcccccccEEEcccccccccccccccHccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHc
mynckdehlASISLSGDLILHNLasgakaaelkdpneqVLRVLDYSRNSRHLLVtagddgtlhlwdttgrspkvswlkqhsaptagisfssddkAVSSLCwqrakpvfidettCKAETALlggavgdsilmpdplpsvttssvSLSTavsgsrpnsrsgpsaeassltvggtgeetpqrsylrpggplarlhaprssynfkddmevfsplvdvqpitpsldklwdghegakkdhlpidkkpssmlfpsssrrfpyaedgsnehsvfdwkssstskqddarsfallgstpspssksedssitppeawggeklsdkFALLrqplnmpsrygmstssgltsssmysglqdvslsqtsissltdsnlsrenmrtkdvtsyqetsslgfpehlsssfpslslgtkgilgsgnldssrpssltlthreprrtyaeristtsgtslsvgspktkktgAETKEELLSNFlsrsdtsavvepgippainggmsqslkspqpdppqgsnftLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
MYNCKDEHLASISLSGDLILHNLASGAkaaelkdpnEQVLRVLDYSRNSRHLLvtagddgtlhLWDTTGRSPKVSWLKQHSAPtagisfssddKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVsgsrpnsrsgpsaeassltvggtgeetpqrsylrpggpLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEgakkdhlpidkkpssmlfpSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLgstpspssksedssITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSltdsnlsrenmrtKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILgsgnldssrpssltlthreprrtyaeristtsgtslsvgspktkktgaeTKEELLSnflsrsdtsaVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLrkenhqlrqll
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPsvttssvslstavsgsrpnsrsgpsAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLGstpspssksedssitppEAWGGEKLSDKFALLRQPLNMPSRygmstssgltsssmysglQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERIsttsgtslsvgsPktkktgaetkeeLLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
***********ISLSGDLILHNLASG***********QVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQ*******I*F***DKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSIL*************************************************************************MEVFSPLVDVQPITPSLDKLW*************************************************************************************************************************************************************************************************************************************************************************************LQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHM*************************************
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEASSLTVGGTGEETPQRSYLRP*******************MEVFSPLVDV*P*TPSLDKLWDGHEG***************************************************************************************************************MY******************************************************************************************************************************************************************FQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNV****************SLRKENHQLRQ**
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPS*******************************************YLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPY***********************ARSFALL*****************PEAWGGEKLSDKFALLRQPLNMPSRY**************SGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERI*******************AETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQ***********GSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSL**************************TGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLD**********************************************************************************************************************************************************************************************************************************************************************************QGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLR*LL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAEASSLTVGGTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARSFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERISTTSGTSLSVGSPKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query574 2.2.26 [Sep-21-2011]
Q3B7M6659 Protein NEDD1 OS=Bos taur yes no 0.172 0.150 0.316 8e-11
P33215660 Protein NEDD1 OS=Mus musc yes no 0.172 0.15 0.316 2e-10
Q8NHV4660 Protein NEDD1 OS=Homo sap yes no 0.172 0.15 0.316 2e-10
Q54S59299 WD repeat-containing prot yes no 0.149 0.287 0.351 0.0003
>sp|Q3B7M6|NEDD1_BOVIN Protein NEDD1 OS=Bos taurus GN=NEDD1 PE=2 SV=1 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 64/101 (63%), Gaps = 2/101 (1%)

Query: 471 VEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKSIHEDMRNLHIE 530
           V  G+  +++  +  ++ + +P+ P  S+  ++  Q  ++ETLD F+++ H D+ NL +E
Sbjct: 558 VTAGVAGSLSEKIVDTIGNSRPNAPL-SSVQIRFIQNMIQETLDDFREACHRDIVNLQVE 616

Query: 531 ILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLR 571
           +++QFHMQ  +M +++     N+  L+ EI+ LR+EN +LR
Sbjct: 617 MIKQFHMQLNEMHSLLERYSVNEG-LVAEIERLREENKRLR 656
Required for mitosis progression. Promotes the nucleation of microtubules from the spindle.
Bos taurus (taxid: 9913)
>sp|P33215|NEDD1_MOUSE Protein NEDD1 OS=Mus musculus GN=Nedd1 PE=2 SV=2 Back     alignment and function description
>sp|Q8NHV4|NEDD1_HUMAN Protein NEDD1 OS=Homo sapiens GN=NEDD1 PE=1 SV=1 Back     alignment and function description
>sp|Q54S59|WDR61_DICDI WD repeat-containing protein 61 homolog OS=Dictyostelium discoideum GN=wdr61 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query574
359486608 805 PREDICTED: uncharacterized protein LOC10 0.987 0.704 0.616 0.0
296086168 779 unnamed protein product [Vitis vinifera] 0.963 0.709 0.611 0.0
224101047 785 predicted protein [Populus trichocarpa] 0.973 0.712 0.592 0.0
449441356 799 PREDICTED: protein NEDD1-like [Cucumis s 0.979 0.703 0.599 1e-178
356499133 795 PREDICTED: protein NEDD1-like [Glycine m 0.968 0.699 0.562 1e-175
224109450 777 predicted protein [Populus trichocarpa] 0.952 0.703 0.569 1e-172
356553817 846 PREDICTED: protein NEDD1-like [Glycine m 0.965 0.654 0.554 1e-171
225459552 785 PREDICTED: protein NEDD1-like [Vitis vin 0.968 0.708 0.547 1e-164
255566510 799 protein with unknown function [Ricinus c 0.979 0.703 0.572 1e-159
302141821 797 unnamed protein product [Vitis vinifera] 0.952 0.686 0.537 1e-157
>gi|359486608|ref|XP_002277667.2| PREDICTED: uncharacterized protein LOC100246247 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/672 (61%), Positives = 478/672 (71%), Gaps = 105/672 (15%)

Query: 1   MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLV------ 54
           MYNCKDEHLASISL+GDLILHNLASGA+AAELKDPNEQV RVLDYSR SRHLLV      
Sbjct: 141 MYNCKDEHLASISLNGDLILHNLASGARAAELKDPNEQVSRVLDYSRISRHLLVTAGDDG 200

Query: 55  --------------------------------------TAGDDGTLHLWDTTGRSPKVSW 76
                                                 T G D  L+ +DT  R P  S 
Sbjct: 201 SIHMWDTTGRSPKVSWLKQHSAPTAGVSFSPSNDKIIATVGLDKKLYTFDTGSRRP--SS 258

Query: 77  LKQHSAPTAGISFSSD---------------------------------DKAVSSLCWQR 103
              + AP + ++F  D                                  +AV+SLCWQR
Sbjct: 259 CIPYEAPFSSLAFRDDGLILAAGTSNGRVVFYDVRGKPQPFTVLRAYSSSEAVTSLCWQR 318

Query: 104 AKPVFIDETTCKAETALLGGAVGDSILMPDPLPSVTTSSVSLSTAVSGSRPNSRSGPSAE 163
           +KPV ++E+ C  ETALLGGAV DSILMPDPLPSVT+SS+SLSTA+  SR   RSGPS E
Sbjct: 319 SKPVIVNESNCTPETALLGGAVEDSILMPDPLPSVTSSSLSLSTAIPASRNPGRSGPSTE 378

Query: 164 ASSLTVG-----------GTGEETPQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVD 212
            SSLT              T EETPQ+++LRPGG LARLHAPRS+YNFKDDMEVFSPLVD
Sbjct: 379 TSSLTAASGGSVSSSLYLSTEEETPQKNHLRPGGTLARLHAPRSNYNFKDDMEVFSPLVD 438

Query: 213 VQPITPSLDKLWDGHEGAKKDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSS 272
           +QPITPSLDKLWD HE AKKDHLP+DKKPSS+LFPSSSRRFP+ +DG+ +H +FDWKSSS
Sbjct: 439 IQPITPSLDKLWDNHEAAKKDHLPVDKKPSSLLFPSSSRRFPFVDDGAIDHPIFDWKSSS 498

Query: 273 TSKQDDAR-SFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMS 331
           TS+QDD R S +LLGSTP+PSSKS + SITPPEAWGGE+LSDKFA  RQ  N+PSR+GM 
Sbjct: 499 TSRQDDTRASLSLLGSTPAPSSKSGEDSITPPEAWGGERLSDKFAHHRQSANLPSRFGML 558

Query: 332 TSSGLTSSSMYSGLQD--VSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLS 389
           T+SGLTS SM SGLQD  VS SQTS+SSL++SNL   N+R KDV+S QET SLGF EH+ 
Sbjct: 559 TTSGLTSGSMLSGLQDLSVSTSQTSMSSLSNSNLGYANLRPKDVSSSQET-SLGFSEHVP 617

Query: 390 SSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRR--TYAERISTTS----GTSLSVGS 443
            S  S+SLGTKG+ G  NL+   P+SL L    PRR  TYAERI TTS    G SLS+GS
Sbjct: 618 FSSISMSLGTKGVTGQTNLELPGPTSLNL----PRRFSTYAERIGTTSSFSDGISLSMGS 673

Query: 444 PKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSP-QPDPPQGSNFTL 502
           PKTKK+GAET+EELL + LSR+D S  +EPGI P+INGG SQ  K+P Q D  QG++FTL
Sbjct: 674 PKTKKSGAETREELLHSLLSRTDISTAMEPGILPSINGGTSQPQKAPIQTDSQQGNSFTL 733

Query: 503 QLFQRTLEETLDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKS 562
           QLFQRTL+ETL SFQKSIHEDM+NLHIEILRQFH+QET MS+VMSSIL+NQ ELMKE++S
Sbjct: 734 QLFQRTLDETLGSFQKSIHEDMKNLHIEILRQFHIQETDMSSVMSSILKNQVELMKEVQS 793

Query: 563 LRKENHQLRQLL 574
           LRKEN QLRQLL
Sbjct: 794 LRKENQQLRQLL 805

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086168|emb|CBI31609.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101047|ref|XP_002312120.1| predicted protein [Populus trichocarpa] gi|222851940|gb|EEE89487.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449441356|ref|XP_004138448.1| PREDICTED: protein NEDD1-like [Cucumis sativus] gi|449495290|ref|XP_004159790.1| PREDICTED: protein NEDD1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356499133|ref|XP_003518397.1| PREDICTED: protein NEDD1-like [Glycine max] Back     alignment and taxonomy information
>gi|224109450|ref|XP_002315198.1| predicted protein [Populus trichocarpa] gi|222864238|gb|EEF01369.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553817|ref|XP_003545248.1| PREDICTED: protein NEDD1-like [Glycine max] Back     alignment and taxonomy information
>gi|225459552|ref|XP_002284487.1| PREDICTED: protein NEDD1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566510|ref|XP_002524240.1| protein with unknown function [Ricinus communis] gi|223536517|gb|EEF38164.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|302141821|emb|CBI19024.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query574
TAIR|locus:2153629782 NEDD1 "AT5G05970" [Arabidopsis 0.858 0.630 0.405 8.8e-130
UNIPROTKB|Q3B7M6659 NEDD1 "Protein NEDD1" [Bos tau 0.172 0.150 0.316 2.9e-20
UNIPROTKB|E2R5C6734 NEDD1 "Uncharacterized protein 0.172 0.134 0.316 1.3e-19
UNIPROTKB|Q8NHV4660 NEDD1 "Protein NEDD1" [Homo sa 0.172 0.15 0.316 3.4e-19
UNIPROTKB|G3V3F1667 NEDD1 "Neural cell expressed, 0.172 0.148 0.316 3.5e-19
RGD|1307750659 Nedd1 "neural precursor cell e 0.172 0.150 0.326 1.1e-18
MGI|MGI:97293660 Nedd1 "neural precursor cell e 0.172 0.15 0.316 2.4e-18
UNIPROTKB|F1P0W9671 NEDD1 "Uncharacterized protein 0.172 0.147 0.316 2.9e-17
ZFIN|ZDB-GENE-040426-2906677 nedd1 "neural precursor cell e 0.153 0.129 0.344 2.2e-11
UNIPROTKB|G3V4I9160 NEDD1 "Protein NEDD1" [Homo sa 0.155 0.556 0.370 3.8e-10
TAIR|locus:2153629 NEDD1 "AT5G05970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 858 (307.1 bits), Expect = 8.8e-130, Sum P(2) = 8.8e-130
 Identities = 217/535 (40%), Positives = 282/535 (52%)

Query:    57 GDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKA 116
             GD+G + +  T+        ++    P   +   S+ + V+SL WQ +KPV ++E    +
Sbjct:   273 GDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYTS 332

Query:   117 ETALLGGAVGDSILMPDPLPXXXXXXXXXXXXXXXXXXXXXXXXXAEASSLTVGGTGEET 176
             E ALLG  V DS+++PDPLP                           ASS+      E+T
Sbjct:   333 EMALLGSTVEDSVVIPDPLPSTTPSASQSAMAPGSRGVSAST---VNASSV------EQT 383

Query:   177 PQRSYLRPGGPLARLHAPRSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAK-KDHL 235
             P R++L P GPL RLHA R++ ++ DDM VFSP++DV     S++K W   EG   KDHL
Sbjct:   384 PNRNHLWPSGPLGRLHALRANDSYNDDMGVFSPIIDVS----SVEK-WADSEGYNNKDHL 438

Query:   236 PIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFDWKSSSTSKQDDARS-FALLGXXXXXXXX 294
              +D KPSS+LFPSSS+ + + ++GS EH +FDWK SSTSKQDD R+ F+  G        
Sbjct:   439 VVDNKPSSLLFPSSSKGYSFGDNGSKEHPIFDWKPSSTSKQDDPRAAFSSFGSITPTASS 498

Query:   295 XXXXXXXXX-EAWGGEKLSDKFALLRQP--------LNMPSRXXXXXXXXXXXXXXXXXX 345
                       EAWGG+K S+KF  L           L+ PSR                  
Sbjct:   499 KSEDSALTPPEAWGGDKFSEKFNQLANEKFSDKFSHLHAPSRLAVSSTGASTSGSMFSSS 558

Query:   346 QDVSLSQTSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGS 405
             +D  LS    +    +N S E  R +D +S  ETSS        ++ PS  L TKGI   
Sbjct:   559 RDFPLSHGQTNF---ANASLEFPRIRDFSSTFETSST----QTDNNLPSSPLFTKGITAP 611

Query:   406 GNLDSSRPSSLTLTHREPRRTYAERIXXXXXXXXXXX-----XPXXXXXXXXXXXXLLSN 460
             GN+DS R S    T R    TYAERI                 P            +L++
Sbjct:   612 GNIDSLRLSP-NFTRRFS--TYAERISTTSSFSDGASLSLGGSPKIKKTGSETREEVLNH 668

Query:   461 FLSRSDTSAVVEPGIPPAIN-GGMSQSLKSPQPDPPQGSNFTLQLFQRTLEETLDSFQKS 519
              L+R +T    E G  P +N GG+ QS ++ Q      SNFTLQLFQRTLE TLDSFQ S
Sbjct:   669 LLARPETVVATEAGAMPLMNQGGLKQS-QTDQQQVMGSSNFTLQLFQRTLEGTLDSFQNS 727

Query:   520 IHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL 574
             IH+D+RNLHIEILRQFHM E +MS V+SSILENQAE MKE+K LRKEN +LRQ L
Sbjct:   728 IHDDVRNLHIEILRQFHMHEMEMSKVLSSILENQAEQMKELKLLRKENQELRQRL 782
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0000919 "cell plate assembly" evidence=IMP
GO:0005828 "kinetochore microtubule" evidence=IDA
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
GO:0032467 "positive regulation of cytokinesis" evidence=IMP
GO:0060236 "regulation of mitotic spindle organization" evidence=IMP
GO:2000694 "regulation of phragmoplast microtubule organization" evidence=IMP
UNIPROTKB|Q3B7M6 NEDD1 "Protein NEDD1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5C6 NEDD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NHV4 NEDD1 "Protein NEDD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V3F1 NEDD1 "Neural cell expressed, developmentally down-regulated 1, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307750 Nedd1 "neural precursor cell expressed, developmentally down-regulated 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97293 Nedd1 "neural precursor cell expressed, developmentally down-regulated gene 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0W9 NEDD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2906 nedd1 "neural precursor cell expressed, developmentally down-regulated 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3V4I9 NEDD1 "Protein NEDD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_VIII000230
hypothetical protein (785 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query574
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.001
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 48.1 bits (115), Expect = 5e-06
 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

Query: 1   MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDG 60
             +    +LAS S    + L +L +G     L      V  V  +S     +L ++  D 
Sbjct: 58  AASADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSV-AFS-PDGRILSSSSRDK 115

Query: 61  TLHLWDTTGRSPKVSWLKQHSAPTAGISFSSDDKAVSS 98
           T+ +WD        + L+ H+     ++FS D   V+S
Sbjct: 116 TIKVWDVETGKCLTT-LRGHTDWVNSVAFSPDGTFVAS 152

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 574
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.55
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.52
KOG0263707 consensus Transcription initiation factor TFIID, s 99.5
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.49
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.48
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.47
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.47
KOG0266456 consensus WD40 repeat-containing protein [General 99.46
KOG0263707 consensus Transcription initiation factor TFIID, s 99.43
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.37
PTZ00421493 coronin; Provisional 99.37
KOG0266456 consensus WD40 repeat-containing protein [General 99.3
KOG0645312 consensus WD40 repeat protein [General function pr 99.29
KOG0286343 consensus G-protein beta subunit [General function 99.26
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.25
PTZ00420568 coronin; Provisional 99.23
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.21
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.2
KOG0295406 consensus WD40 repeat-containing protein [Function 99.2
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.2
KOG0283712 consensus WD40 repeat-containing protein [Function 99.19
KOG0295406 consensus WD40 repeat-containing protein [Function 99.17
KOG0645312 consensus WD40 repeat protein [General function pr 99.17
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.16
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.15
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.14
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.14
PTZ00421493 coronin; Provisional 99.14
KOG0283712 consensus WD40 repeat-containing protein [Function 99.13
KOG0286343 consensus G-protein beta subunit [General function 99.12
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.11
KOG0302440 consensus Ribosome Assembly protein [General funct 99.11
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.11
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.11
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.1
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.09
KOG0289506 consensus mRNA splicing factor [General function p 99.09
KOG0315311 consensus G-protein beta subunit-like protein (con 99.08
KOG0315311 consensus G-protein beta subunit-like protein (con 99.08
PTZ00420568 coronin; Provisional 99.08
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.07
KOG0293519 consensus WD40 repeat-containing protein [Function 99.06
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.04
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.02
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.01
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.99
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.99
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.99
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 98.98
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 98.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 98.97
KOG0291893 consensus WD40-repeat-containing subunit of the 18 98.95
KOG0269 839 consensus WD40 repeat-containing protein [Function 98.95
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.95
KOG0772641 consensus Uncharacterized conserved protein, conta 98.94
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.93
KOG0310487 consensus Conserved WD40 repeat-containing protein 98.93
KOG0641350 consensus WD40 repeat protein [General function pr 98.92
KOG1273405 consensus WD40 repeat protein [General function pr 98.92
KOG0303472 consensus Actin-binding protein Coronin, contains 98.92
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 98.92
KOG0265338 consensus U5 snRNP-specific protein-like factor an 98.91
KOG0772641 consensus Uncharacterized conserved protein, conta 98.91
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 98.9
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.9
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 98.89
KOG0313423 consensus Microtubule binding protein YTM1 (contai 98.89
PLN00181793 protein SPA1-RELATED; Provisional 98.88
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 98.88
PLN00181793 protein SPA1-RELATED; Provisional 98.87
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.87
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.87
KOG0316307 consensus Conserved WD40 repeat-containing protein 98.87
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.86
KOG0289506 consensus mRNA splicing factor [General function p 98.85
KOG0267 825 consensus Microtubule severing protein katanin p80 98.85
KOG0306888 consensus WD40-repeat-containing subunit of the 18 98.82
KOG0639705 consensus Transducin-like enhancer of split protei 98.8
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.8
KOG0313423 consensus Microtubule binding protein YTM1 (contai 98.79
KOG0293519 consensus WD40 repeat-containing protein [Function 98.78
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 98.78
KOG0308735 consensus Conserved WD40 repeat-containing protein 98.78
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 98.78
KOG0296399 consensus Angio-associated migratory cell protein 98.77
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.76
KOG0643327 consensus Translation initiation factor 3, subunit 98.76
KOG0306888 consensus WD40-repeat-containing subunit of the 18 98.75
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.75
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.75
KOG0294362 consensus WD40 repeat-containing protein [Function 98.75
KOG0639705 consensus Transducin-like enhancer of split protei 98.74
KOG0296399 consensus Angio-associated migratory cell protein 98.74
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.73
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 98.7
KOG0281499 consensus Beta-TrCP (transducin repeats containing 98.7
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.7
KOG0278334 consensus Serine/threonine kinase receptor-associa 98.69
KOG4283397 consensus Transcription-coupled repair protein CSA 98.68
KOG0643327 consensus Translation initiation factor 3, subunit 98.68
KOG0267 825 consensus Microtubule severing protein katanin p80 98.66
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 98.66
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.65
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.62
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.62
KOG0299479 consensus U3 snoRNP-associated protein (contains W 98.6
KOG1274 933 consensus WD40 repeat protein [General function pr 98.59
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.58
KOG2096420 consensus WD40 repeat protein [General function pr 98.58
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 98.57
KOG0300481 consensus WD40 repeat-containing protein [Function 98.57
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.56
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.54
KOG1539910 consensus WD repeat protein [General function pred 98.54
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.53
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.53
KOG0646476 consensus WD40 repeat protein [General function pr 98.52
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.51
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.5
KOG0270463 consensus WD40 repeat-containing protein [Function 98.49
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.48
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.48
KOG0269 839 consensus WD40 repeat-containing protein [Function 98.47
KOG0646476 consensus WD40 repeat protein [General function pr 98.47
KOG0308735 consensus Conserved WD40 repeat-containing protein 98.46
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 98.45
KOG0270463 consensus WD40 repeat-containing protein [Function 98.44
KOG0303472 consensus Actin-binding protein Coronin, contains 98.43
KOG0294362 consensus WD40 repeat-containing protein [Function 98.43
PRK01742429 tolB translocation protein TolB; Provisional 98.42
KOG0301745 consensus Phospholipase A2-activating protein (con 98.4
KOG1274 933 consensus WD40 repeat protein [General function pr 98.39
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.37
KOG14081080 consensus WD40 repeat protein [Function unknown] 98.36
KOG0300481 consensus WD40 repeat-containing protein [Function 98.35
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.35
KOG0647347 consensus mRNA export protein (contains WD40 repea 98.34
KOG0268433 consensus Sof1-like rRNA processing protein (conta 98.34
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.31
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.3
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.29
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 98.29
KOG2110391 consensus Uncharacterized conserved protein, conta 98.28
KOG0641350 consensus WD40 repeat protein [General function pr 98.28
KOG0302440 consensus Ribosome Assembly protein [General funct 98.28
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.27
KOG0299479 consensus U3 snoRNP-associated protein (contains W 98.26
KOG4328498 consensus WD40 protein [Function unknown] 98.25
KOG2096420 consensus WD40 repeat protein [General function pr 98.25
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.24
COG2319466 FOG: WD40 repeat [General function prediction only 98.21
KOG14081080 consensus WD40 repeat protein [Function unknown] 98.2
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 98.2
KOG0301745 consensus Phospholipase A2-activating protein (con 98.19
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 98.16
KOG2055514 consensus WD40 repeat protein [General function pr 98.13
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.12
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.12
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.11
PRK02889427 tolB translocation protein TolB; Provisional 98.1
KOG0278334 consensus Serine/threonine kinase receptor-associa 98.1
KOG2139445 consensus WD40 repeat protein [General function pr 98.1
PRK05137435 tolB translocation protein TolB; Provisional 98.09
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.08
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.08
KOG2048691 consensus WD40 repeat protein [General function pr 98.08
KOG0771398 consensus Prolactin regulatory element-binding pro 98.07
KOG1310 758 consensus WD40 repeat protein [General function pr 98.06
KOG0268433 consensus Sof1-like rRNA processing protein (conta 98.05
KOG1273405 consensus WD40 repeat protein [General function pr 98.04
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.03
KOG0771398 consensus Prolactin regulatory element-binding pro 98.01
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.0
PRK03629429 tolB translocation protein TolB; Provisional 97.98
KOG4283397 consensus Transcription-coupled repair protein CSA 97.97
PRK04922433 tolB translocation protein TolB; Provisional 97.97
KOG1539 910 consensus WD repeat protein [General function pred 97.97
KOG0322323 consensus G-protein beta subunit-like protein GNB1 97.95
COG2319466 FOG: WD40 repeat [General function prediction only 97.95
PRK01742429 tolB translocation protein TolB; Provisional 97.93
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 97.92
KOG1188376 consensus WD40 repeat protein [General function pr 97.91
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.9
KOG2055514 consensus WD40 repeat protein [General function pr 97.89
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.87
KOG2106626 consensus Uncharacterized conserved protein, conta 97.85
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 97.85
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 97.84
KOG0649325 consensus WD40 repeat protein [General function pr 97.81
KOG1963792 consensus WD40 repeat protein [General function pr 97.8
PRK03629429 tolB translocation protein TolB; Provisional 97.78
KOG4547541 consensus WD40 repeat-containing protein [General 97.77
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.77
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.77
KOG2048691 consensus WD40 repeat protein [General function pr 97.75
KOG4227609 consensus WD40 repeat protein [General function pr 97.75
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.75
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 97.74
PRK04792448 tolB translocation protein TolB; Provisional 97.74
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 97.74
KOG2111346 consensus Uncharacterized conserved protein, conta 97.72
PRK11028330 6-phosphogluconolactonase; Provisional 97.71
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.69
KOG1188376 consensus WD40 repeat protein [General function pr 97.66
PRK01029428 tolB translocation protein TolB; Provisional 97.65
KOG2111346 consensus Uncharacterized conserved protein, conta 97.64
PRK05137435 tolB translocation protein TolB; Provisional 97.63
PRK04922433 tolB translocation protein TolB; Provisional 97.62
PRK02889427 tolB translocation protein TolB; Provisional 97.57
PRK11028330 6-phosphogluconolactonase; Provisional 97.57
KOG2110391 consensus Uncharacterized conserved protein, conta 97.57
KOG1272545 consensus WD40-repeat-containing subunit of the 18 97.56
KOG2106626 consensus Uncharacterized conserved protein, conta 97.51
PRK00178430 tolB translocation protein TolB; Provisional 97.5
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.46
KOG0290364 consensus Conserved WD40 repeat-containing protein 97.46
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 97.44
KOG1272545 consensus WD40-repeat-containing subunit of the 18 97.44
PRK01029428 tolB translocation protein TolB; Provisional 97.4
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.36
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 97.36
KOG0649325 consensus WD40 repeat protein [General function pr 97.29
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.29
KOG4328498 consensus WD40 protein [Function unknown] 97.28
KOG1963792 consensus WD40 repeat protein [General function pr 97.2
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.15
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 97.15
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 97.11
PRK04792448 tolB translocation protein TolB; Provisional 97.1
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.1
PRK04043419 tolB translocation protein TolB; Provisional 97.05
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.04
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.03
KOG3881412 consensus Uncharacterized conserved protein [Funct 97.02
PRK00178430 tolB translocation protein TolB; Provisional 97.01
PRK13169110 DNA replication intiation control protein YabA; Re 96.95
KOG1310 758 consensus WD40 repeat protein [General function pr 96.93
KOG2321703 consensus WD40 repeat protein [General function pr 96.91
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.91
KOG15171387 consensus Guanine nucleotide binding protein MIP1 96.91
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 96.87
KOG0280339 consensus Uncharacterized conserved protein [Amino 96.87
KOG2315566 consensus Predicted translation initiation factor 96.86
KOG2315566 consensus Predicted translation initiation factor 96.75
KOG4227609 consensus WD40 repeat protein [General function pr 96.7
KOG12401431 consensus Protein kinase containing WD40 repeats [ 96.62
KOG2139445 consensus WD40 repeat protein [General function pr 96.6
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 96.59
KOG15171387 consensus Guanine nucleotide binding protein MIP1 96.58
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.54
KOG0644 1113 consensus Uncharacterized conserved protein, conta 96.52
KOG4714319 consensus Nucleoporin [Nuclear structure] 96.51
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.51
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 96.51
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.47
KOG2321703 consensus WD40 repeat protein [General function pr 96.47
KOG3621 726 consensus WD40 repeat-containing protein [General 96.46
KOG3881412 consensus Uncharacterized conserved protein [Funct 96.45
KOG1334559 consensus WD40 repeat protein [General function pr 96.43
COG4467114 Regulator of replication initiation timing [Replic 96.25
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.22
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.18
PRK04043419 tolB translocation protein TolB; Provisional 96.05
KOG4547541 consensus WD40 repeat-containing protein [General 95.89
KOG4532344 consensus WD40-like repeat containing protein [Gen 95.71
KOG2695425 consensus WD40 repeat protein [General function pr 95.7
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 95.63
KOG2314698 consensus Translation initiation factor 3, subunit 95.55
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 95.52
KOG1334559 consensus WD40 repeat protein [General function pr 95.52
KOG2695425 consensus WD40 repeat protein [General function pr 95.47
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 95.42
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 95.34
KOG1409404 consensus Uncharacterized conserved protein, conta 95.32
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 94.81
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.75
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 94.75
PLN029191057 haloacid dehalogenase-like hydrolase family protei 94.74
PF05769181 DUF837: Protein of unknown function (DUF837); Inte 94.69
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.58
COG4946668 Uncharacterized protein related to the periplasmic 94.4
KOG41901034 consensus Uncharacterized conserved protein [Funct 94.33
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 94.31
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 94.28
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 94.26
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 94.2
PRK13922 276 rod shape-determining protein MreC; Provisional 94.2
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 94.05
KOG1912 1062 consensus WD40 repeat protein [General function pr 93.97
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 93.91
PF1477560 NYD-SP28_assoc: Sperm tail C-terminal domain 93.75
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 93.62
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 93.61
PLN029191057 haloacid dehalogenase-like hydrolase family protei 93.46
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.02
COG4946668 Uncharacterized protein related to the periplasmic 93.01
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 92.8
KOG4714319 consensus Nucleoporin [Nuclear structure] 92.68
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 92.59
KOG1912 1062 consensus WD40 repeat protein [General function pr 92.58
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 92.46
smart0034044 HALZ homeobox associated leucin zipper. 92.43
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.21
KOG4532344 consensus WD40-like repeat containing protein [Gen 92.2
PF10392132 COG5: Golgi transport complex subunit 5; InterPro: 92.18
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 92.02
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 91.93
KOG41901034 consensus Uncharacterized conserved protein [Funct 91.85
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 91.73
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 91.66
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 91.6
KOG12401431 consensus Protein kinase containing WD40 repeats [ 91.57
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 91.56
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 91.39
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 91.25
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 91.18
PF10226 195 DUF2216: Uncharacterized conserved proteins (DUF22 91.0
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 90.99
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 90.81
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 90.7
PRK14127109 cell division protein GpsB; Provisional 90.6
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.53
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 90.47
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 90.36
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 90.07
PF15294 278 Leu_zip: Leucine zipper 89.97
smart0032040 WD40 WD40 repeats. Note that these repeats are per 89.82
KOG1409404 consensus Uncharacterized conserved protein, conta 89.63
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 89.41
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 89.12
PRK02888635 nitrous-oxide reductase; Validated 88.97
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 88.81
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 88.79
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 88.66
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 88.51
KOG3612588 consensus PHD Zn-finger protein [General function 88.46
PRK02888635 nitrous-oxide reductase; Validated 88.42
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 88.31
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 88.14
PF15397258 DUF4618: Domain of unknown function (DUF4618) 88.07
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 87.73
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 87.73
COG4026 290 Uncharacterized protein containing TOPRIM domain, 87.22
COG1792 284 MreC Cell shape-determining protein [Cell envelope 86.82
KOG2314698 consensus Translation initiation factor 3, subunit 86.78
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 86.53
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 86.5
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 86.46
PRK1542279 septal ring assembly protein ZapB; Provisional 86.44
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 86.39
TIGR0244965 conserved hypothetical protein TIGR02449. Members 85.6
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 85.27
COG4026 290 Uncharacterized protein containing TOPRIM domain, 85.25
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 85.2
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 85.15
PRK13616591 lipoprotein LpqB; Provisional 84.53
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 84.38
PF08961243 DUF1875: Domain of unknown function (DUF1875); Int 84.37
PF14988206 DUF4515: Domain of unknown function (DUF4515) 84.25
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 84.01
PF0870087 Vps51: Vps51/Vps67; InterPro: IPR014812 The VFT te 83.74
PF13097175 CENP-U: CENP-A nucleosome associated complex (NAC) 83.73
COG3490366 Uncharacterized protein conserved in bacteria [Fun 83.32
smart0033865 BRLZ basic region leucin zipper. 82.93
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 82.75
KOG4657 246 consensus Uncharacterized conserved protein [Funct 82.65
PRK13922 276 rod shape-determining protein MreC; Provisional 82.23
KOG2395644 consensus Protein involved in vacuole import and d 82.23
TIGR01834320 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synth 81.88
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 81.72
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 81.58
PRK11546143 zraP zinc resistance protein; Provisional 81.5
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 81.39
PRK04654 214 sec-independent translocase; Provisional 81.28
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 81.04
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 80.77
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 80.71
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 80.25
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=8.5e-51  Score=428.61  Aligned_cols=498  Identities=26%  Similarity=0.309  Sum_probs=367.9

Q ss_pred             CccCCCCEEEEEeCCCcEEEEECCCCceeEEecCCCCCeEEEEEEccCCCeEEEEEeCCCcEEEEeCCCCCceeEEeccC
Q 008196            1 MYNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQH   80 (574)
Q Consensus         1 ~FSpDG~~LASGS~DGtVrIWDl~Tg~~l~t~~gh~~~Vvs~LafSPdGr~LLaSgS~DGtVrLWDl~~~~~ll~tl~gH   80 (574)
                      +|+++++|||+++..|.|+|+.+.++.....|....++.++.|.|++..+.+|.+++++|.|.+||+.+..++..+...|
T Consensus       128 ~YN~~DeyiAsvs~gGdiiih~~~t~~~tt~f~~~sgqsvRll~ys~skr~lL~~asd~G~VtlwDv~g~sp~~~~~~~H  207 (673)
T KOG4378|consen  128 DYNNTDEYIASVSDGGDIIIHGTKTKQKTTTFTIDSGQSVRLLRYSPSKRFLLSIASDKGAVTLWDVQGMSPIFHASEAH  207 (673)
T ss_pred             EecCCcceeEEeccCCcEEEEecccCccccceecCCCCeEEEeecccccceeeEeeccCCeEEEEeccCCCcccchhhhc
Confidence            58999999999999999999999999998899877788889999999999999999999999999999988888899999


Q ss_pred             CCCeEEEEEcCCCCEE-EEEEecCCcCEEEecc-------------CC------CcceeEecccCCCeEeccCCC----C
Q 008196           81 SAPTAGISFSSDDKAV-SSLCWQRAKPVFIDET-------------TC------KAETALLGGAVGDSILMPDPL----P  136 (574)
Q Consensus        81 ~~~VtSVaFSPDG~~L-aS~sWD~sg~viv~e~-------------~~------s~e~aLlg~~~~dsVi~PDPl----p  136 (574)
                      ..+...|||+|....| ++.++|+.  +++++.             ..      .....+..+...+-++..|..    |
T Consensus       208 sAP~~gicfspsne~l~vsVG~Dkk--i~~yD~~s~~s~~~l~y~~Plstvaf~~~G~~L~aG~s~G~~i~YD~R~~k~P  285 (673)
T KOG4378|consen  208 SAPCRGICFSPSNEALLVSVGYDKK--INIYDIRSQASTDRLTYSHPLSTVAFSECGTYLCAGNSKGELIAYDMRSTKAP  285 (673)
T ss_pred             cCCcCcceecCCccceEEEecccce--EEEeecccccccceeeecCCcceeeecCCceEEEeecCCceEEEEecccCCCC
Confidence            9999999999977654 45555532  222221             11      012233334444444444422    1


Q ss_pred             CCccccc-cc--------c-cccCC---------CCCCCCC---CCCCcccccccCCCCcCCCCcccCCCCCCccccccC
Q 008196          137 SVTTSSV-SL--------S-TAVSG---------SRPNSRS---GPSAEASSLTVGGTGEETPQRSYLRPGGPLARLHAP  194 (574)
Q Consensus       137 s~t~ss~-ss--------s-ts~~~---------~~SS~~~---~s~g~~sS~~~~st~e~tPsr~~~~~~G~ls~~~~p  194 (574)
                      ..+.+.- .+        + +....         ..++.-.   +.++-+...-+....|++| +.++|+.+++.++++-
T Consensus       286 v~v~sah~~sVt~vafq~s~tvltkssln~G~~~~~~~vn~~s~~~~aat~g~rNsgiVe~aP-~~~l~~s~p~~~lsa~  364 (673)
T KOG4378|consen  286 VAVRSAHDASVTRVAFQPSPTVLTKSSLNSGDNQQNGSVNSSSNATGAATEGPRNSGIVERAP-SDELRKSIPANLLSAQ  364 (673)
T ss_pred             ceEeeecccceeEEEeeecceeeeccccccCccCCCceeccccccccccCCCCccccchhcCc-hhhhhhccCchhhhhh
Confidence            1111100 00        0 00000         0000000   0011112233456689999 6899999999999999


Q ss_pred             CCCCCCCCccccccccccCCCCCCcccccCCCCCCCc-CCCCCCcCCCCccccCCCCCCCCccCCCCCcccccc-ccCCC
Q 008196          195 RSSYNFKDDMEVFSPLVDVQPITPSLDKLWDGHEGAK-KDHLPIDKKPSSMLFPSSSRRFPYAEDGSNEHSVFD-WKSSS  272 (574)
Q Consensus       195 ~~~~~~~~~~~vfSPl~d~~~~~~s~~~~w~~~~g~~-~d~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~-~~~~~  272 (574)
                      +.+.+..++|.+|+|++++..+..     |.+..|.. +|.+.+|-++| ++          .+..   -||+| |.+-.
T Consensus       365 ~~~ts~~~~~~g~p~iI~~ds~~k-----~~Ds~G~n~~d~~~~d~g~S-S~----------gD~f---sPIrDD~~~~n  425 (673)
T KOG4378|consen  365 NQLTSLGYGVSGTPTIIRRDSFCK-----FLDSQGPNAVDRMSTDLGAS-SY----------GDSF---SPIRDDWETLN  425 (673)
T ss_pred             ccccccccCccCCCceeehhhhhh-----hhhccCCccccceeeccCcc-cc----------cccC---CccccchhhcC
Confidence            999999999999999999888877     88888865 68888888885 22          1111   16664 43221


Q ss_pred             CccCcccccccccCCCCCCCCCCCCCCCCCCccccccccchhhhhcccCCCCCCccccccCccccccccccccccccccc
Q 008196          273 TSKQDDARSFALLGSTPSPSSKSEDSSITPPEAWGGEKLSDKFALLRQPLNMPSRYGMSTSSGLTSSSMYSGLQDVSLSQ  352 (574)
Q Consensus       273 ~~~~~~~~s~~~~~~t~~~~~~~~~~~~t~p~a~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (574)
                      -                    |.++..++  |   |++|  +|..+...--.|.|-. +.++++|++.|+|.+.| ....
T Consensus       426 ~--------------------K~~d~~~~--k---Gd~f--~f~p~~ns~fsp~~n~-V~Ss~ttS~~~~spl~d-f~~s  476 (673)
T KOG4378|consen  426 R--------------------KPQDYETA--K---GDRF--SFCPPVNSGFSPVDNS-VNSSTTTSLQRNSPLKD-FSNS  476 (673)
T ss_pred             C--------------------CCCchhcc--c---cCcc--ccccccccCCCcccCc-ccccccchhhccCcccc-ccCC
Confidence            1                    44555555  2   5766  3333322222255554 56668999999999999 5555


Q ss_pred             cccccccCCccccccccccccccccccCCCCCCCCCCCCCCcccccccccccCCCCCCCCCCcCCCCCCCCCcchhhhcc
Q 008196          353 TSISSLTDSNLSRENMRTKDVTSYQETSSLGFPEHLSSSFPSLSLGTKGILGSGNLDSSRPSSLTLTHREPRRTYAERIS  432 (574)
Q Consensus       353 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  432 (574)
                      ++.--..+..+.++..  ++.+.++|+++    +.+..   +.++.++++.+..|+++. +.+ +++|+  |++|+++|.
T Consensus       477 ~G~~~~~n~~lt~e~~--~~~s~~~e~~s----d~~~~---s~kl~t~gv~a~gn~~~~-~lS-N~TRn--s~~~~~~i~  543 (673)
T KOG4378|consen  477 SGDGKLMNIALTDELC--EEQSANIEVAS----DTGGG---SDKLNTPGVDAEGNRRLR-LLS-NATRN--STPHHANIT  543 (673)
T ss_pred             CCcchhhcccccchHH--HHhhcceeeec----cCCCC---cccccCCCCCCccccccc-ccc-ccccc--CCcccccCC
Confidence            5655555555555544  57788888883    33332   236899999888888886 444 99999  999999999


Q ss_pred             ccCCCccccCCCCCcCCchhhHHHHhhhhccccCccccccCCCCCCCCCCCCCCCCCCCCCCCCCchHHHHHHHHHHHHH
Q 008196          433 TTSGTSLSVGSPKTKKTGAETKEELLSNFLSRSDTSAVVEPGIPPAINGGMSQSLKSPQPDPPQGSNFTLQLFQRTLEET  512 (574)
Q Consensus       433 ~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~  512 (574)
                      +++--.+=.++|++||++.+          .|.....+.+.|..+.+++.+-|.... +.+-.+-..|++|+||++++++
T Consensus       544 ~~s~~~~L~~~p~i~ksss~----------n~p~~~~a~~ag~~s~l~~~v~qs~~~-~~q~~~~~~fs~q~~q~~~~~t  612 (673)
T KOG4378|consen  544 PQSSNPLLKPQPLIAKSSSG----------NLPAQMDADWAGEFSELRDFVDQSCEK-VEQELEYVTFSNQRLQANKMTT  612 (673)
T ss_pred             CcccCccccCCcccccCCCC----------CCchhhhhhhhhhhHHHHHHHHhhhhh-HHhhcccchhHHHHHHHHhhhh
Confidence            99944444599999999996          277888889999999999998887766 4466678999999999999999


Q ss_pred             HHHHHHHHHHHHHHhHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhC
Q 008196          513 LDSFQKSIHEDMRNLHIEILRQFHMQETQMSNVMSSILENQAELMKEIKSLRKENHQLRQLL  574 (574)
Q Consensus       513 l~~~~~~~~~d~~nlh~e~lrqf~~~~~e~~~~~~~~~~~~~~l~~E~~~lr~en~~lr~~~  574 (574)
                      ||+||.++|+|||||||||||||||+.+||+.+++.|.|++. |++|+|.||||||+||+.+
T Consensus       613 lddfq~~~hrdirNl~~ell~Qfhm~~~Ems~llery~eNe~-l~aelk~lreenq~lr~~~  673 (673)
T KOG4378|consen  613 LDDFQVENHRDIRNLALELLLQFHMFMREMSRLLERYNENEM-LKAELKFLREENQTLRCGE  673 (673)
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHH-HHHHHHHHHHhhhhhhccC
Confidence            999999999999999999999999999999999999999888 9999999999999999864

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF05769 DUF837: Protein of unknown function (DUF837); InterPro: IPR008555 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14775 NYD-SP28_assoc: Sperm tail C-terminal domain Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF10392 COG5: Golgi transport complex subunit 5; InterPro: IPR019465 The conserved oligomeric Golgi (COG) complex is a peripheral membrane complex involved in intra-Golgi protein trafficking Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>KOG3612 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08961 DUF1875: Domain of unknown function (DUF1875); InterPro: IPR015056 MIT can be found in the Nuclear receptor-binding factor 2, it has no known function Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PF08700 Vps51: Vps51/Vps67; InterPro: IPR014812 The VFT tethering complex (also known as GARP complex, Golgi associated retrograde protein complex, Vps53 tethering complex) is a conserved eukaryotic docking complex which is involved in recycling of proteins from endosomes to the late Golgi Back     alignment and domain information
>PF13097 CENP-U: CENP-A nucleosome associated complex (NAC) subunit Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG4657 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01834 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, class III, PhaE subunit Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PRK04654 sec-independent translocase; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query574
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 3e-09
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 9e-07
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 8e-06
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 2e-05
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 3e-05
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 1e-04
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 6e-04
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 6e-04
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-07
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 8e-07
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-06
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-06
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-05
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-05
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-04
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-04
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 6e-04
2xyi_A430 Probable histone-binding protein CAF1; transcripti 7e-07
2xyi_A430 Probable histone-binding protein CAF1; transcripti 7e-05
2xyi_A430 Probable histone-binding protein CAF1; transcripti 3e-04
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 3e-06
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 3e-06
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 1e-05
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 1e-05
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 5e-05
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 9e-05
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 1e-04
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 7e-04
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 3e-05
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 1e-04
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 1e-04
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 1e-04
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 1e-04
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 5e-04
4e54_B435 DNA damage-binding protein 2; beta barrel, double 2e-04
4e54_B435 DNA damage-binding protein 2; beta barrel, double 3e-04
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 2e-04
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 2e-04
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 2e-04
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 2e-04
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 3e-04
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 4e-04
3ow8_A321 WD repeat-containing protein 61; structural genomi 5e-04
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 6e-04
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
 Score = 58.4 bits (142), Expect = 3e-09
 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 7   EHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWD 66
           + L SIS +G +   N   G+        N+ +   L  S + + L  +A  +G ++ WD
Sbjct: 295 QALVSISANGFINFVNPELGSIDQVRYGHNKAI-TALSSSADGKTL-FSADAEGHINSWD 352

Query: 67  TTGRSPKVSWLKQHSAPTAGISFSSDDKAVSS 98
            +       +   H+    GI  +S     + 
Sbjct: 353 ISTGISNRVFPDVHATMITGIKTTSKGDLFTV 384
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query574
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.66
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.57
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.55
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.55
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.54
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.54
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.53
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.52
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.51
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.5
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.5
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.49
2pm7_B297 Protein transport protein SEC13, protein transport 99.48
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.48
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.47
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.47
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.47
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.47
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.47
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.46
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.46
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.45
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.45
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.44
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.44
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.44
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.44
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.43
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.43
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.43
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.43
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.42
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.42
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.42
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.41
2pm7_B297 Protein transport protein SEC13, protein transport 99.4
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.39
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.38
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.36
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.36
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.36
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.36
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.36
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.36
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.35
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.35
3jrp_A379 Fusion protein of protein transport protein SEC13 99.35
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.34
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.34
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.34
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.34
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.33
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.32
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.32
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.32
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.32
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.31
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.31
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.31
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.31
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.3
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.29
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.29
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.29
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.29
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.29
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.28
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.28
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.28
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.28
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.27
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.27
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.27
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.27
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.25
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.25
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.25
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.24
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.24
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.24
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.24
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.24
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.24
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.24
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.24
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.24
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.24
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.23
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.23
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.23
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.23
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.23
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.22
3jrp_A379 Fusion protein of protein transport protein SEC13 99.22
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.22
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.22
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.22
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.21
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.2
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.2
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.2
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.2
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.19
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.19
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.18
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.18
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.16
3jro_A 753 Fusion protein of protein transport protein SEC13 99.15
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.14
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.14
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.14
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.13
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.13
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.12
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.1
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.08
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.06
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.05
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.03
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.01
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.99
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.99
3jro_A 753 Fusion protein of protein transport protein SEC13 98.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.94
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.76
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.72
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.71
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.63
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.62
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.61
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.61
1k32_A1045 Tricorn protease; protein degradation, substrate g 98.61
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.59
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.55
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.53
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.53
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.49
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.49
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.48
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.46
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.45
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.44
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.44
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.43
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.41
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.4
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.38
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.36
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.28
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.28
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.28
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.27
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.27
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.25
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.22
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.19
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.19
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.15
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.11
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.11
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.07
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.03
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.97
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.94
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.91
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.9
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.9
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.87
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.79
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.78
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.68
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.67
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.66
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.64
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.58
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.57
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.56
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.52
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.48
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.46
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.44
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.43
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.31
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.28
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.19
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.13
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.13
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.12
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.11
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.11
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.11
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.03
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.01
2qe8_A343 Uncharacterized protein; structural genomics, join 96.78
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.71
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 96.7
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.69
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.66
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.48
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 96.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.24
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.21
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 96.21
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.18
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.15
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.14
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.08
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.94
2ece_A462 462AA long hypothetical selenium-binding protein; 95.94
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.83
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.73
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 95.73
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.71
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 95.66
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 95.63
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 95.45
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 95.34
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 95.25
2qe8_A343 Uncharacterized protein; structural genomics, join 94.99
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.87
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 94.75
3m48_A33 General control protein GCN4; leucine zipper, synt 94.67
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 94.58
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.54
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 94.43
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.31
2ece_A462 462AA long hypothetical selenium-binding protein; 94.21
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.19
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 93.9
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 93.53
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 93.33
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 93.21
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 93.13
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.94
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 92.85
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.51
2wuj_A57 Septum site-determining protein diviva; bacterial 92.38
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 92.32
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 92.18
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 92.02
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 91.86
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 91.84
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 91.39
1uo4_A34 General control protein GCN4; four helix bundle, c 91.22
2bni_A34 General control protein GCN4; four helix bundle, a 91.07
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.05
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 91.01
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 90.93
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 90.86
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 90.23
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 89.99
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 89.97
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 89.95
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 89.82
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 89.54
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 89.54
3q4f_C186 DNA repair protein XRCC4; DSB repair, nuclear, rec 89.51
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 89.45
3w03_C184 DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS 89.18
2p4o_A306 Hypothetical protein; putative lactonase, structur 89.13
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 88.88
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 88.58
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 88.51
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 88.51
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 87.92
3v65_B386 Low-density lipoprotein receptor-related protein; 87.76
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 87.71
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 87.61
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 87.56
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 87.54
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 87.53
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 87.43
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 87.36
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.07
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 86.87
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 86.8
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 86.46
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 86.37
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 86.36
2p4o_A306 Hypothetical protein; putative lactonase, structur 86.31
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 86.24
1ez3_A127 Syntaxin-1A; three helix bundle, endocytosis/exocy 86.06
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 85.99
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 85.94
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 85.56
2fp8_A322 Strictosidine synthase; six bladed beta propeller 85.11
3lay_A175 Zinc resistance-associated protein; salmonella typ 85.09
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 85.08
3p5b_L400 Low density lipoprotein receptor variant; B-propel 84.82
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 84.76
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 84.71
2p22_A174 Suppressor protein STP22 of temperature- sensitive 84.64
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.6
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 84.58
1deb_A54 APC protein, adenomatous polyposis coli protein; c 84.31
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 84.0
2hy6_A34 General control protein GCN4; protein design, para 83.93
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 83.91
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 83.82
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 83.77
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 83.58
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 83.56
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-bindin 83.1
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 82.92
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 82.69
3v65_B386 Low-density lipoprotein receptor-related protein; 82.01
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 80.75
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 80.67
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 80.09
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 80.02
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=99.66  E-value=4.8e-16  Score=154.22  Aligned_cols=100  Identities=14%  Similarity=0.169  Sum_probs=90.4

Q ss_pred             ccCCCCEEEEEeCCCcEEEEECCCCceeEEecCCCCCeEEEEEEccCCCeEEEEEeCCCcEEEEeCCCCCceeEEeccCC
Q 008196            2 YNCKDEHLASISLSGDLILHNLASGAKAAELKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHS   81 (574)
Q Consensus         2 FSpDG~~LASGS~DGtVrIWDl~Tg~~l~t~~gh~~~Vvs~LafSPdGr~LLaSgS~DGtVrLWDl~~~~~ll~tl~gH~   81 (574)
                      |+|+|++|++|+.||.|+|||+.++..+..+..|...+ .+++|+|++ .+|++|+.|++|++||+... ..+..+.+|.
T Consensus        21 fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v-~~~~~~~~~-~~l~s~s~d~~i~vwd~~~~-~~~~~~~~h~   97 (304)
T 2ynn_A           21 FHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPV-RAGKFIARK-NWIIVGSDDFRIRVFNYNTG-EKVVDFEAHP   97 (304)
T ss_dssp             ECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCE-EEEEEEGGG-TEEEEEETTSEEEEEETTTC-CEEEEEECCS
T ss_pred             ECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcE-EEEEEeCCC-CEEEEECCCCEEEEEECCCC-cEEEEEeCCC
Confidence            89999999999999999999999999999999888777 777999998 56999999999999999764 3456789999


Q ss_pred             CCeEEEEEcCCCCEEEEEEecCC
Q 008196           82 APTAGISFSSDDKAVSSLCWQRA  104 (574)
Q Consensus        82 ~~VtSVaFSPDG~~LaS~sWD~s  104 (574)
                      ..|.+++|+|++.+|+++++|..
T Consensus        98 ~~v~~~~~~~~~~~l~sgs~D~~  120 (304)
T 2ynn_A           98 DYIRSIAVHPTKPYVLSGSDDLT  120 (304)
T ss_dssp             SCEEEEEECSSSSEEEEEETTSC
T ss_pred             CcEEEEEEcCCCCEEEEECCCCe
Confidence            99999999999999999997643
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3q4f_C DNA repair protein XRCC4; DSB repair, nuclear, recombination-recombination complex, DN protein-protein binding complex; HET: DNA; 5.50A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3w03_C DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS repair, KU70/80, DNA-PKCS, DNA ligas binding protein; HET: DNA; 8.49A {Homo sapiens} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p22_A Suppressor protein STP22 of temperature- sensitive alpha-factor receptor and arginine...; endosome, trafficking complex, VPS23, VPS28, VPS37, MVB12; 2.70A {Saccharomyces cerevisiae} PDB: 2caz_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 574
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 7e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.003
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.003
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.001
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-04
d1sumb_ 225 a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga mari 0.001
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Cdc4 propeller domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 46.0 bits (107), Expect = 6e-06
 Identities = 12/71 (16%), Positives = 27/71 (38%), Gaps = 4/71 (5%)

Query: 32  LKDPNEQVLRVLDYSRNSRHLLVTAGDDGTLHLWDTTGRSPKVSWLKQHSAPTAGISFSS 91
           L+     V+  L +  N    ++T  DD  + ++D+  +   +  L  H      + ++ 
Sbjct: 8   LRGHMTSVITCLQFEDN---YVITGADDKMIRVYDSINKKFLLQ-LSGHDGGVWALKYAH 63

Query: 92  DDKAVSSLCWQ 102
               VS    +
Sbjct: 64  GGILVSGSTDR 74
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query574
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.5
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.48
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.46
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.46
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.38
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.38
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.35
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.34
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.32
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.31
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.3
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.28
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.27
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.27
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.27
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.26
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.23
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.23
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.22
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.21
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.17
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.1
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.09
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.08
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.05
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.05
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.02
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.02
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.98
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.84
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.82
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.79
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.75
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.73
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.69
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.68
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.61
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.6
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.43
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.36
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.29
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.18
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.09
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.05
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.04
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.9
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.86
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.7
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.14
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.69
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.69
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.67
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.42
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.41
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.34
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.17
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.02
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.01
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 95.73
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.11
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 94.73
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.65
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.05
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.59
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 92.65
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.36
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.36
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.08
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 89.38
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 88.82
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 87.53
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 82.74
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 80.19
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.50  E-value=1.1e-13  Score=138.76  Aligned_cols=117  Identities=16%  Similarity=0.194  Sum_probs=87.8

Q ss_pred             ccCCCCEEEEEeCCCcEEEEECCCCceeEEec------CCCCCeEEEEEEccCCCeEEEEEeCCCc---EEEEeCCCCCc
Q 008196            2 YNCKDEHLASISLSGDLILHNLASGAKAAELK------DPNEQVLRVLDYSRNSRHLLVTAGDDGT---LHLWDTTGRSP   72 (574)
Q Consensus         2 FSpDG~~LASGS~DGtVrIWDl~Tg~~l~t~~------gh~~~Vvs~LafSPdGr~LLaSgS~DGt---VrLWDl~~~~~   72 (574)
                      |++|+ +||+|+.|+.|+|||+.+++.+..+.      +|...| .+|+|+|+| .+|++|+.|++   |++||+.....
T Consensus       192 ~s~dg-~lasgs~Dg~i~iwd~~~~~~~~~~~~~~~l~~h~~~V-~~l~~spdg-~~l~sgs~D~t~~~i~lwd~~~g~~  268 (393)
T d1sq9a_         192 ISERG-LIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSI-RSVKFSPQG-SLLAIAHDSNSFGCITLYETEFGER  268 (393)
T ss_dssp             ECTTS-EEEEECTTSEEEEEETTTTEEEEEEECCC---CCCCCE-EEEEECSST-TEEEEEEEETTEEEEEEEETTTCCE
T ss_pred             ECCCC-EEEEEeCCCcEEEEeecccccccccccccccccccceE-EEccccccc-ceeeeecCCCCcceeeeccccccee
Confidence            67776 89999999999999999998876554      455566 888999998 66999999875   99999965332


Q ss_pred             ee------------EEeccCCCCeEEEEEcCCCCEEEEEEecCCcCEEEeccCCCcceeEecc
Q 008196           73 KV------------SWLKQHSAPTAGISFSSDDKAVSSLCWQRAKPVFIDETTCKAETALLGG  123 (574)
Q Consensus        73 ll------------~tl~gH~~~VtSVaFSPDG~~LaS~sWD~sg~viv~e~~~s~e~aLlg~  123 (574)
                      ..            ..+.+|...|++|+|+||+++|+++++|  +.+.+|+......+..+.+
T Consensus       269 ~~~l~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l~S~s~D--~~v~vWd~~~g~~~~~l~g  329 (393)
T d1sq9a_         269 IGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWD--GKLRFWDVKTKERITTLNM  329 (393)
T ss_dssp             EEEECBC--------CCBSBSSCEEEEEECSSSSEEEEEETT--SEEEEEETTTTEEEEEEEC
T ss_pred             eeeeccccccccceeeeecccCceeeeccCCCCCeeEEECCC--CEEEEEECCCCCEEEEECC
Confidence            21            1235899999999999999999999966  4455555333333333333
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure