Citrus Sinensis ID: 008227

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570---

MVAWERLGFLLLLWRRRKLGFWVHFVFGLWFGFLVLKPVEGLRPLRERARARSWGDEWLFVRKDENELGPYSEWNITGTYRGTWKFLDSTNSSSRFRDFRKSNGNSITELVSTPTKINGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSGKQGELSQEDDYILSNPYHLLGVFSSQVFQESPREKIWRRKNSPIYEMEKHCNIEIAAQISRVSSTQHEGDHDRYHIEGLMESPAVDDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASRPMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA

cHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccccccccccccEEEEEEEEEEEEccccccccccccccccccccccEEEEEccccccccEEEEEEEEEEEEEcccccccccEEEEEEEEEEccccEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccccccccccccc

ccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccHEEEEccccccccccEEEEEEEEEEEEEEcccccccccccccccccccEEEEEEEcccccccEEEEEEEEEEEEEccccccccccEEEEEEEEEccccEEEEEEccccccccccccHHcccccHHHcccccHHHcccccHHHHHHHcccccHHcHccccEEEEEEEccccccccccccccccccccccccccEcccccccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHEHHHHHHHHcHHHHHEcccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccccccccccccccccccccccEEEEccEEEEEccccEEEccccccccHHHHHHHHHHHHcccccccccccc

MVAWERLGFLLLLWRRRKLGFWVHFVFGLWFGFlvlkpveglrplRERARARSWGDEWLFVrkdenelgpysewnitgtyrgtwkfldstnsssrfRDFRksngnsitelvstptkingvHYVQGVIIFHdvfdnehnvggaqirVEGVYIWPFRQLRMVAhsgkqgelsqeddyilsnpyhllgvfssqvfqesprekiwrrknspiyemEKHCNIEIAAQISRvsstqhegdhdryhieglmespavdddgdcfsplllnATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEhsntqsgaAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKasrpmnngegWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRdsrkflhphyilgiSVTRLAIplyifgcphnfmriepdknwcICLCVFIGLQASILLLQHYlgsrwfiprqilpekysyyrrfdqgtyhttdcVICMTAIDLmqrsndcmvtpcdhffhsgclQRWMdikmecptcrrplppa

MVAWERLGFLLLLWRRRKLGFWVHFVFGLWFGFLVLKPVEGLRPLRErararswgdewlfvrkdenelgpysewnitgtyrgtWKFLDSTNSSSRFRDFRksngnsitelvstptkinGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSGKQGELSQEDDYILSNPYHLLGVFssqvfqesprekiwrrknspiyEMEKHCNIEIAAQISRVSSTQHEGDHDRYHIEGLMESPAVDDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASRPMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTcrrplppa

MVAWErlgfllllwrrrklgfwvhfvfglwfgflvlKPVEGLRPLRERARARSWGDEWLFVRKDENELGPYSEWNITGTYRGTWKFLDSTNSSSRFRDFRKSNGNSITELVSTPTKINGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSGKQGELSQEDDYILSNPYHLLGVFSSQVFQESPREKIWRRKNSPIYEMEKHCNIEIAAQISRVSSTQHEGDHDRYHIEGLMESPAVDDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLfnafataaffkfvvfSIFEMRYLLAIWKASRPMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA

**AWERLGFLLLLWRRRKLGFWVHFVFGLWFGFLVLKPVEGLRPLRERARARSWGDEWLFVRKDENELGPYSEWNITGTYRGTWKFLD******************ITELVSTPTKINGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSG*******EDDYILSNPYHLLGVFSSQVFQESPREKIWRRKNSPIYEMEKHCNIEIAAQIS*************YHIEGLM***AVDDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASRPMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTC*******

*****RLGFLLLLWRRRKLGFWVHFVFGLWFGFLVLKPVE*************************NELGPYSEWNITGTYRGTWKFLDSTNSSSRF*DFRKSNGNSITELVSTPTKINGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSGKQGELSQEDDYILSNPYHLLGVF**********************EMEKHCNIEIAAQISRV****************LMESPAVDDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASRPMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP*

MVAWERLGFLLLLWRRRKLGFWVHFVFGLWFGFLVLKPVEGLRPLRERARARSWGDEWLFVRKDENELGPYSEWNITGTYRGTWKFLDSTNSSSRFRDFRKSNGNSITELVSTPTKINGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVA*********QEDDYILSNPYHLLGVFSSQVFQESPREKIWRRKNSPIYEMEKHCNIEIAAQISR*********HDRYHIEGLMESPAVDDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASRPMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVVRDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA

oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		573	2.2.26 [Sep-21-2011]
P36096		758	Transmembrane E3 ubiquiti	yes	no	0.495	0.374	0.290	2e-37
O43085		695	DSC E3 ubiquitin ligase c	yes	no	0.586	0.483	0.275	6e-31
Q0IJ20		695	RING finger protein 145 O	yes	no	0.082	0.067	0.396	3e-06
Q5BIY5		695	RING finger protein 145 O	N/A	no	0.082	0.067	0.396	3e-06
Q96MT1		663	RING finger protein 145 O	yes	no	0.082	0.070	0.377	6e-06
Q5SWK7		663	RING finger protein 145 O	yes	no	0.082	0.070	0.377	9e-06
Q7ZWF4		685	RING finger protein 145 O	yes	no	0.073	0.061	0.375	6e-05
Q9C919		178	Putative RING-H2 finger p	no	no	0.095	0.308	0.305	0.0001
P87139		372	Uncharacterized RING fing	no	no	0.102	0.158	0.316	0.0002
Q9C1X4		513	Uncharacterized RING fing	no	no	0.083	0.093	0.333	0.0003

>sp\|P36096\|TUL1_YEAST Transmembrane E3 ubiquitin-protein ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUL1 PE=1 SV=1	Back alignment and function desciption

 Score =  157 bits (397), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 163/348 (46%), Gaps = 64/348 (18%)

Query: 289 QVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFF 348
           Q+ LL+ QM H+NT S   K+S        ++D  L  L+  A  +V  L+     +AF 
Sbjct: 410 QIYLLLTQMHHTNTPSMVNKISFYCFSMINLVDGSLATLYFVAASVVPELYLPLVISAFS 469

Query: 349 KFVVFSIFEMRYLLAIWKASRPM-----------NNGEGWETMRRELSV---------LY 388
            F++ SIFE+RYL++I+ +               N G   E   R   +         LY
Sbjct: 470 CFILASIFEIRYLISIYASQVNEQNVGIINLLRGNTGTYDENRPRPAFIPDEGSIGGSLY 529

Query: 389 SRFYGILLGGILVMYEFHNFLRPI--------LLLMYSFWIPQIITNVVR---------- 430
            RF+ +L+    ++    ++ R +        + ++ S+WIPQI  N V+          
Sbjct: 530 GRFFFMLIIFTFLILSSTSWPRQLRMVFEYILIFILNSYWIPQIFRNAVKGIPSRRERAR 589

Query: 431 --------DSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQ 482
                    ++  L   +++G ++ R    +Y+F    N  R   D ++ + L +++  Q
Sbjct: 590 SSIGGNRSQNKMPLLWSFVIGTTIIRSLPVVYVFTYSSNVFRHHKDVHFVVFLSLWLLFQ 649

Query: 483 ASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQ--------GTY-HTTDCVICMTAIDLM 533
            SIL  Q  LGSRWF+P+  +P+ YSY++            GT  HT DC ICM+ + + 
Sbjct: 650 ISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDVPIY 709

Query: 534 QRS---------NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP 572
                       +  MVTPC+H FH+ CL+ WM+ K++CP CR PLPP
Sbjct: 710 IEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPLPP 757

E3 ubiquitin ligase protein that mediates ubiquitination of vacuolar proteins such as CPS1, PPN1, PEP12 and other proteins containing exposed hydrophilic residues within their transmembrane domains (TMDs). Ubiquitination of such proteins mediates their sorting into internal vesicles in late endosomes.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|O43085\|DSC1_SCHPO DSC E3 ubiquitin ligase complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc1 PE=1 SV=2	Back alignment and function description

>sp\|Q0IJ20\|RN145_XENTR RING finger protein 145 OS=Xenopus tropicalis GN=rnf145 PE=2 SV=1	Back alignment and function description

>sp\|Q5BIY5\|RN145_XENLA RING finger protein 145 OS=Xenopus laevis GN=rnf145 PE=2 SV=1	Back alignment and function description

>sp\|Q96MT1\|RN145_HUMAN RING finger protein 145 OS=Homo sapiens GN=RNF145 PE=2 SV=2	Back alignment and function description

>sp\|Q5SWK7\|RN145_MOUSE RING finger protein 145 OS=Mus musculus GN=Rnf145 PE=2 SV=1	Back alignment and function description

>sp\|Q7ZWF4\|RN145_DANRE RING finger protein 145 OS=Danio rerio GN=rnf145 PE=2 SV=1	Back alignment and function description

>sp\|Q9C919\|ATL19_ARATH Putative RING-H2 finger protein ATL19 OS=Arabidopsis thaliana GN=ATL19 PE=3 SV=1	Back alignment and function description

>sp\|P87139\|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1	Back alignment and function description

>sp\|Q9C1X4\|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		573
255553695		570	protein binding protein, putative [Ricin	0.980	0.985	0.893	0.0
225446404		570	PREDICTED: uncharacterized RING finger p	0.972	0.977	0.872	0.0
224092898		565	predicted protein [Populus trichocarpa]	0.973	0.987	0.863	0.0
356549908		570	PREDICTED: uncharacterized RING finger p	0.994	1.0	0.828	0.0
356543843		570	PREDICTED: uncharacterized RING finger p	0.994	1.0	0.820	0.0
449463100		570	PREDICTED: DSC E3 ubiquitin ligase compl	0.937	0.942	0.855	0.0
356542969		575	PREDICTED: uncharacterized RING finger p	0.968	0.965	0.809	0.0
356517498		575	PREDICTED: uncharacterized RING finger p	0.972	0.968	0.803	0.0
343172856		555	RING/U-box domain-containing protein, pa	0.938	0.969	0.817	0.0
343172858		555	RING/U-box domain-containing protein, pa	0.938	0.969	0.817	0.0

>gi\|255553695\|ref\|XP_002517888.1\| protein binding protein, putative [Ricinus communis] gi\|223542870\|gb\|EEF44406.1\| protein binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/564 (89%), Positives = 536/564 (95%), Gaps = 2/564 (0%)

Query: 10  LLLLWRRRKLGFWVHFVFGLWFGFLVLKPVEGLRPLRERARARSWGDEWLFVRKDENELG 69
           L   + RR+LGF    VFGLWFGF+VL+PV G+RPL+ERAR  SWGDEWLFV+KDEN+LG
Sbjct: 9   LFYFYERRRLGFVFKLVFGLWFGFVVLRPVAGVRPLKERAR--SWGDEWLFVKKDENDLG 66

Query: 70  PYSEWNITGTYRGTWKFLDSTNSSSRFRDFRKSNGNSITELVSTPTKINGVHYVQGVIIF 129
           P+S WNITGTYRG+WKFLDSTNSSSRF DFRKSNG+SI ELVSTPTKI GVHYVQG IIF
Sbjct: 67  PFSAWNITGTYRGSWKFLDSTNSSSRFPDFRKSNGDSIIELVSTPTKITGVHYVQGAIIF 126

Query: 130 HDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSGKQGELSQEDDYILSNPYHLLGVFSS 189
           HDVFDN HNVGGAQIRVEGVYIWPFRQLRMVA+SGK+ ELSQE+DYILSNPYHLLGVFSS
Sbjct: 127 HDVFDNAHNVGGAQIRVEGVYIWPFRQLRMVANSGKEAELSQEEDYILSNPYHLLGVFSS 186

Query: 190 QVFQESPREKIWRRKNSPIYEMEKHCNIEIAAQISRVSSTQHEGDHDRYHIEGLMESPAV 249
           QVFQESPR+K+WRRKNSPIYEMEKHCNIEIAAQI+RVSS Q++GD DRYH+EGLM+SPAV
Sbjct: 187 QVFQESPRDKLWRRKNSPIYEMEKHCNIEIAAQITRVSSIQNDGDRDRYHLEGLMQSPAV 246

Query: 250 DDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKV 309
           DDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKV
Sbjct: 247 DDDGDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKV 306

Query: 310 SILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASR 369
           S+LMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASR
Sbjct: 307 SLLMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKASR 366

Query: 370 PMNNGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILLLMYSFWIPQIITNVV 429
           P+N+GEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPIL LMYSFWIPQIITNV+
Sbjct: 367 PINSGEGWETMRRELSVLYSRFYGILLGGILVMYEFHNFLRPILFLMYSFWIPQIITNVI 426

Query: 430 RDSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIEPDKNWCICLCVFIGLQASILLLQ 489
           RDSRK LHPHYILG+++TRLAIPLYIFGCP+NFMRIEPDK+WC+CL VF+GLQASILLLQ
Sbjct: 427 RDSRKPLHPHYILGMTITRLAIPLYIFGCPNNFMRIEPDKSWCMCLSVFMGLQASILLLQ 486

Query: 490 HYLGSRWFIPRQILPEKYSYYRRFDQGTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFH 549
           HYLGSRWFIPRQILPEKYSYYRRFDQ T H TDCVICMTAIDL QRSNDCMVTPCDHFFH
Sbjct: 487 HYLGSRWFIPRQILPEKYSYYRRFDQDTNHATDCVICMTAIDLTQRSNDCMVTPCDHFFH 546

Query: 550 SGCLQRWMDIKMECPTCRRPLPPA 573
           SGCLQRWMDIKMECPTCRR LPPA
Sbjct: 547 SGCLQRWMDIKMECPTCRRSLPPA 570

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225446404\|ref\|XP_002274722.1\| PREDICTED: uncharacterized RING finger protein C947.10 [Vitis vinifera] gi\|302143312\|emb\|CBI21873.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224092898\|ref\|XP_002309743.1\| predicted protein [Populus trichocarpa] gi\|222852646\|gb\|EEE90193.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356549908\|ref\|XP_003543332.1\| PREDICTED: uncharacterized RING finger protein C947.10-like [Glycine max]	Back alignment and taxonomy information

>gi\|356543843\|ref\|XP_003540369.1\| PREDICTED: uncharacterized RING finger protein C947.10-like [Glycine max]	Back alignment and taxonomy information

>gi\|449463100\|ref\|XP_004149272.1\| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356542969\|ref\|XP_003539936.1\| PREDICTED: uncharacterized RING finger protein C947.10-like [Glycine max]	Back alignment and taxonomy information

>gi\|356517498\|ref\|XP_003527424.1\| PREDICTED: uncharacterized RING finger protein C947.10-like [Glycine max]	Back alignment and taxonomy information

>gi\|343172856\|gb\|AEL99131.1\| RING/U-box domain-containing protein, partial [Silene latifolia]	Back alignment and taxonomy information

>gi\|343172858\|gb\|AEL99132.1\| RING/U-box domain-containing protein, partial [Silene latifolia]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00018609001	SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (525 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		573
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	2e-13
COG5540		374	COG5540, COG5540, RING-finger-containing ubiquitin	5e-12
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	3e-10
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	4e-09
smart00184		40	smart00184, RING, Ring finger	2e-07
pfam12678		73	pfam12678, zf-rbx1, RING-H2 zinc finger	1e-06
COG5194		88	COG5194, APC11, Component of SCF ubiquitin ligase	4e-05
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	4e-05
COG5243		491	COG5243, HRD1, HRD ubiquitin ligase complex, ER me	1e-04
smart00744		49	smart00744, RINGv, The RING-variant domain is a C4	3e-04
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	0.002

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

 Score = 64.3 bits (157), Expect = 2e-13
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 522 DCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP 569
           +C IC+   D  +   + +V PC H FH  CL +W+     CP CR P
Sbjct: 2   ECPICL---DEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRAP 46

Length = 46

>gnl\|CDD\|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|221705 pfam12678, zf-rbx1, RING-H2 zinc finger	Back alignment and domain information

>gnl\|CDD\|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		573
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	100.0
PF11145		909	DUF2921: Protein of unknown function (DUF2921); In	99.95
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	99.93
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.32
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	99.27
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	99.18
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	99.16
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	99.1
PHA02929		238	N1R/p28-like protein; Provisional	99.02
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.74
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.73
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.72
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.67
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	98.62
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.61
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	98.6
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.59
PHA02926		242	zinc finger-like protein; Provisional	98.59
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	98.47
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.45
PF14634		44	zf-RING_5: zinc-RING finger domain	98.45
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.39
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.37
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.36
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.35
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.29
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.27
COG5219		1525	Uncharacterized conserved protein, contains RING Z	98.16
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	98.05
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.04
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	98.01
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	98.01
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	97.95
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	97.91
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	97.83
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.83
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.78
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	97.73
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.68
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	97.64
KOG4445		368	consensus Uncharacterized conserved protein, conta	97.43
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	97.23
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	97.23
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	97.22
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	97.09
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	96.99
KOG0825		1134	consensus PHD Zn-finger protein [General function	96.64
KOG1941		518	consensus Acetylcholine receptor-associated protei	96.57
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	96.54
KOG1002		791	consensus Nucleotide excision repair protein RAD16	96.47
KOG0297		391	consensus TNF receptor-associated factor [Signal t	96.44
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	96.36
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	96.07
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	95.99
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	95.95
PHA03096		284	p28-like protein; Provisional	95.67
COG5152		259	Uncharacterized conserved protein, contains RING a	95.66
PHA02825		162	LAP/PHD finger-like protein; Provisional	95.45
PHA02862		156	5L protein; Provisional	94.95
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	94.91
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	94.9
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	94.74
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	94.63
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	94.58
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	94.55
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	94.4
KOG2660		331	consensus Locus-specific chromosome binding protei	93.97
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	93.71
KOG0801		205	consensus Predicted E3 ubiquitin ligase [Posttrans	93.05
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	93.01
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	92.95
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	92.75
COG5222		427	Uncharacterized conserved protein, contains RING Z	92.72
COG5236		493	Uncharacterized conserved protein, contains RING Z	92.23
KOG3039		303	consensus Uncharacterized conserved protein [Funct	91.89
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	91.24
KOG3268		234	consensus Predicted E3 ubiquitin ligase [Posttrans	91.17
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	91.04
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	90.98
KOG1001		674	consensus Helicase-like transcription factor HLTF/	90.6
KOG3002		299	consensus Zn finger protein [General function pred	90.54
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	90.37
COG5175		480	MOT2 Transcriptional repressor [Transcription]	89.71
KOG3053		293	consensus Uncharacterized conserved protein [Funct	89.46
PF04641		260	Rtf2: Rtf2 RING-finger	88.1
KOG1609		323	consensus Protein involved in mRNA turnover and st	88.07
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	87.29
KOG1940		276	consensus Zn-finger protein [General function pred	86.98
COG5183		1175	SSM4 Protein involved in mRNA turnover and stabili	86.28
PF04193		61	PQ-loop: PQ loop repeat	85.86
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	85.61
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	85.5
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	85.18
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	84.62
KOG3899		381	consensus Uncharacterized conserved protein [Funct	83.76
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	82.67
KOG0298		1394	consensus DEAD box-containing helicase-like transc	82.13
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	81.25
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	80.88
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	80.19

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=2.7e-102  Score=813.39  Aligned_cols=523  Identities=50%  Similarity=0.828  Sum_probs=460.2

Q ss_pred             HHHHhhhcccccccccchhhhh---hccccccccccccCCCccCCccccccceEEeeeEE-----ecCC-CCcccccccc
Q 008227           29 LWFGFLVLKPVEGLRPLRERAR---ARSWGDEWLFVRKDENELGPYSEWNITGTYRGTWK-----FLDS-TNSSSRFRDF   99 (573)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~n~t~~~~g~w~-----~~~~-~~~s~~~~~~   99 (573)
                      ...|++-+++.+|.++||+...   +.+|++||+|++...+-.++.+.|||++|++|||+     +.|+ .|+|+.|+|+
T Consensus        55 t~~g~i~l~~~ng~~~lr~t~~~~~~~~~~~ew~s~k~~~nv~~~~s~~nI~~s~~g~~k~n~~~fln~~ln~~s~f~d~  134 (636)
T KOG0828|consen   55 TSDGLIELPVGNGDSHLRHTSVMTGNWNILPEWLSGKVSPNVTWHTSLRNIVMSQSGTWKANLYEFLNGNLNSSSKFLDF  134 (636)
T ss_pred             hcceeEEeecCCCchhhccceeecCCceeccccccccccCCccccccceeEEeeeccchhhhHHHHhccccccchhhhhh
Confidence            5588999999999999999852   45899999999999999999999999999999999     8888 8999999999


Q ss_pred             cccCCceEEEeeecCcCCCCceEEEEEEEEEeeccCCCCccceEEEEEeEEEeccCcceEEEecCCcCCCCCCCcccccC
Q 008227          100 RKSNGNSITELVSTPTKINGVHYVQGVIIFHDVFDNEHNVGGAQIRVEGVYIWPFRQLRMVAHSGKQGELSQEDDYILSN  179 (573)
Q Consensus       100 ~~~~g~~~~~l~~~~~~~s~~~~v~~~~~~~d~~~~~~~~~~~~~~~~Gv~~wp~~q~~~~~~s~~~~~~~~~~~~~~s~  179 (573)
                      +|.+||++.|++-+|+|+.||++|+|...++|.++              +.||-..|     +--++.+  +.|++-..+
T Consensus       135 ~~~n~~SVy~~~~~~~ki~~I~~v~gst~fh~~Fd--------------~~h~~~~~-----~~yk~~~--~~D~~el~~  193 (636)
T KOG0828|consen  135 EKENGNSVYELVFHPTKITGIHYVQGSTDFHPNFD--------------VIHWLLKD-----SPYKDAP--PLDGTELFP  193 (636)
T ss_pred             HhhcCCceEEEEeccccccceEEEeeccccccccc--------------cchhhccc-----ccccccC--Cccchhccc
Confidence            99999999999999999999999999999999773              23666111     1122222  233333344


Q ss_pred             ccc----cccccccccccccchHHHHHhhcCCCcccCCCcceEEEEEEecCCCCCC---CCCCCccceeeEeecCCcCCC
Q 008227          180 PYH----LLGVFSSQVFQESPREKIWRRKNSPIYEMEKHCNIEIAAQISRVSSTQH---EGDHDRYHIEGLMESPAVDDD  252 (573)
Q Consensus       180 ~~~----~~~~~~~q~~~~~~~~~~l~~~~~~~~~~~~~Ce~~i~~Q~~Pl~~~~~---~~e~~~~~i~G~i~SP~~~~s  252 (573)
                      ++|    .+|+||+|.+|+.+++++++.|+....++|++|++...+|++-+++..+   ..+++..+++|++++|++.+|
T Consensus       194 ~~~n~~~~~~i~s~qd~Qes~~~~~fk~e~~~~~eme~~~N~~t~~qi~~~~s~eN~~~~~~~n~~q~~pl~~vsgl~ys  273 (636)
T KOG0828|consen  194 LLQNRSLELGIFSSQDFQESPRDRVFKEEESPCSEMEKHCNIETAAQISTLKSSENEFYNGDKNSYQKEPLMEVSGLVYS  273 (636)
T ss_pred             hhhcccchhcchhhhhhhhCccchhhhcccchHHHHHHhhhhHHHHHHHHhhhhhccccCCCcchhcCCceecccCcccC
Confidence            343    5899999999999999999999999999999999999999999998888   578888999999999999999


Q ss_pred             CCcCcceeeeeeechHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCcccchhHHHHHHHHHHHHHHHHHHHHHHH
Q 008227          253 GDCFSPLLLNATSVNIEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAG  332 (573)
Q Consensus       253 pdC~~~l~~~~~g~~~e~~~~k~~~y~~~~~~v~~lQi~ll~~Qm~~~~TpS~~~riS~~ti~~~~i~D~~~~l~~l~~a  332 (573)
                      ||||+++.++.+....|++++++.||.+++.+..+.|+++|++||.+ +|||.++|+|++||+||+++|+++|+++++++
T Consensus       274 pDC~v~l~l~ntkg~~~vl~n~aVr~tll~~~~~~~~~~~Ll~q~~~-~sps~v~rlSf~~i~mqa~mD~~Lall~lta~  352 (636)
T KOG0828|consen  274 PDCFVPLTLNNTKGNVEVLYNKAVRYTLLYIFIVLSQIFLLLRQMRI-NSPSHVQRLSFLTIAMQAGMDAYLALLFLTAN  352 (636)
T ss_pred             CCcCcceeeeccccchhhhhhhhHHHHHHHHHHHHHHHHHHHHHHhh-cCchhhhhhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            99999999977766799999999999999999999999999999887 45999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh---------hCCCCCCCChHHHHHHH--------HHHHHHHHHHH
Q 008227          333 ILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKA---------SRPMNNGEGWETMRREL--------SVLYSRFYGIL  395 (573)
Q Consensus       333 ~~~~~lfl~f~~~aFl~fil~~~fe~R~L~~Iwka---------~~~~~~~~~~~~~r~~~--------~~ly~rFy~~L  395 (573)
                      ++.|++|++|+++||++|+++++||||||++|||+         .||.+++.+++++|++.        +.+++|||+++
T Consensus       353 ~vve~lylpfvtaAF~~fV~~siFemRYLlsI~k~q~~~~~~~a~Rp~T~~~~~n~~r~~~~~~e~s~~g~l~grf~fm~  432 (636)
T KOG0828|consen  353 AVVESLYLPFVTAAFFKFVVFSIFEMRYLLSIWKVQNSNMPPPATRPSTSNSSNNNTRQSNASNENSPWGILLGRFLFMY  432 (636)
T ss_pred             HHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCCCCCCCCCCCccccCcccccccccCCcchhhHHhHHHHH
Confidence            99999999999999999999999999999999994         46666777778888764        56777777665


Q ss_pred             HHH-HHHHHH------HhhhHHH-HHHHHhhhhHHHhHHHhhh-CCccCCCccchhhhhhhhhcceeeehccCCCccCCC
Q 008227          396 LGG-ILVMYE------FHNFLRP-ILLLMYSFWIPQIITNVVR-DSRKFLHPHYILGISVTRLAIPLYIFGCPHNFMRIE  466 (573)
Q Consensus       396 i~~-~l~~~~------~~~~~~~-~l~ll~SfWvPQIirNi~r-n~R~~L~~~FviG~Si~RL~~plY~~~~p~N~l~~~  466 (573)
                      ++. ++++|+      +++++.+ ++|.+||||||||++|+.| .+|+||+|.||+|+|++|+++|+|+|+|++|+++++
T Consensus       433 lv~~~~~l~s~~wp~q~r~yf~~iLif~~~SfWIPQIv~Nvvrg~SR~Pl~w~yIlG~Tv~Rl~~plyVF~~s~n~~r~~  512 (636)
T KOG0828|consen  433 LVVCIASLYSAFWPVQFRNYFIPILIFMYYSFWIPQIVANVVRGDSRKPLHWYYILGMTVTRLAIPLYVFGCSENFMRVE  512 (636)
T ss_pred             HHHHHHHhhccccHHHHHHHHHHHHHHHHHhhhHHHHHHHHhcCCCCCCcchhhhhhHhHHhhhcceEEEecchhhhccC
Confidence            433 333332      2344444 5667779999999999999 689999999999999999999999999999999999


Q ss_pred             CCchhhHHHHHHHHHHHHHHHHHHHHcCccccccccccccccccccccCC-----Cccccccccccccccccc-------
Q 008227          467 PDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQG-----TYHTTDCVICMTAIDLMQ-------  534 (573)
Q Consensus       467 p~~~~~ivL~l~v~lQilIL~lQ~~~G~Rffipk~~~P~~y~y~~~~~~~-----~~~~~~CaICle~~e~~~-------  534 (573)
                      |++.|++.|++|+++|+.|+++|+++|+|||+||+.+|++|+||+.+.++     .+...+|+|||++++.-.       
T Consensus       513 p~~~f~v~L~lwmlFQv~vLl~Qd~lGsR~FlPkk~lpe~YsY~r~l~~dh~~~~~~~t~dC~ICMt~I~l~~~~s~~~~  592 (636)
T KOG0828|consen  513 PKYFFAVGLVLWMLFQVLVLLVQDYLGSRCFLPKKFLPEKYSYHRRLQQDHLEAFVRRTNDCVICMTPIDLRSTGSDCMV  592 (636)
T ss_pred             CchhhHHHHHHHHHHHHHHHHHHhhcccccccchhhCccccccccccccccccchhhccccceEeccccceeeccCcchh
Confidence            99999999999999999999999999999999999999999999999844     356789999999996532       


Q ss_pred             ----CCCCeEEcCCCCcccHhhHHHHHh-cCCCCCCCCCCCCCC
Q 008227          535 ----RSNDCMVTPCDHFFHSGCLQRWMD-IKMECPTCRRPLPPA  573 (573)
Q Consensus       535 ----~~~~~~vtPC~H~FH~~CL~~Wl~-~k~~CP~CR~~LPPl  573 (573)
                          ..++||.|||+|+||+.||++||+ +|..||+||++|||+
T Consensus       593 ~~~~~~~nYm~tPC~HifH~~CL~~WMd~ykl~CPvCR~pLPpl  636 (636)
T KOG0828|consen  593 ASMMVRRNYMLTPCHHIFHRQCLLQWMDTYKLICPVCRCPLPPL  636 (636)
T ss_pred             hhhhhhccccccchHHHHHHHHHHHHHhhhcccCCccCCCCCCC
Confidence                125799999999999999999999 889999999999996

>PF11145 DUF2921: Protein of unknown function (DUF2921); InterPro: IPR021319 This eukaryotic family of proteins has no known function	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG3053 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification]	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification]	Back alignment and domain information

>PF04193 PQ-loop: PQ loop repeat	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3899 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		573
1x4j_A		75	Solution Structure Of Ring Finger In Ring Finger Pr		4e-05
2ep4_A		74	Solution Structure Of Ring Finger From Human Ring F		2e-04
2kiz_A		69	Solution Structure Of Arkadia Ring-H2 Finger Domain		4e-04

>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75

Back alignment and structure

Iteration: 1
 Score = 46.2 bits (108), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 5/64 (7%)
Query: 512 RFDQGTYHT--TDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP 569
           RF+   + +  T CV+CM   +  Q      V PC+H FH+ C+ +W+     CP CR  
Sbjct: 13  RFNPNNHQSEQTLCVVCMCDFESRQL---LRVLPCNHEFHAKCVDKWLKANRTCPICRAD 69
Query: 570 LPPA 573
             P+
Sbjct: 70  SGPS 73

PyMOL of 1x4j

>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74

Back alignment and structure

>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		573
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	4e-14
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	3e-13
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	8e-13
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	2e-12
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	7e-12
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	1e-11
2ect_A		78	Ring finger protein 126; metal binding protein, st	5e-11
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	1e-10
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	1e-10
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	1e-10
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	2e-10
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	3e-10
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	5e-10
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	8e-10
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	1e-09
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	4e-09
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	8e-09
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	2e-08
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	2e-08
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	4e-08
1z6u_A		150	NP95-like ring finger protein isoform B; structura	1e-07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	1e-07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	2e-07
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	2e-07
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	2e-07
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	8e-07
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	1e-06
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	1e-06
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	1e-06
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	3e-06
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	3e-06
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	4e-06
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	4e-06
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	9e-06
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	9e-06
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	1e-05
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	1e-05
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	2e-05
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	2e-05
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	2e-05
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	3e-05
3nw0_A		238	Non-structural maintenance of chromosomes element	3e-05
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	4e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-05
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	6e-05
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	7e-05
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	9e-05
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	1e-04
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	1e-04
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	3e-04
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	5e-04

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

 Score = 66.5 bits (162), Expect = 4e-14
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 516 GTYHTTDCVICMTAI-DLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPL 570
               T  C ICM    +++Q     + T C H F S CL+  +     CPTCR+ +
Sbjct: 11  RPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKI 66

PyMOL of 2ea6

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		573
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.37
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.36
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.35
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.34
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.33
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.32
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.3
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.29
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.25
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.23
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.21
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.18
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	99.17
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.14
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.11
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.1
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	99.07
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.06
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.06
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.05
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	99.04
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.04
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.02
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.02
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.0
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.98
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.96
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.95
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.95
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.95
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.95
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.93
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.91
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.89
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.88
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.88
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.87
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.85
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.84
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.84
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.82
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.8
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.79
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.78
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.72
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.71
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.7
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.68
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.68
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.64
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.64
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.63
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.59
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.57
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.55
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.54
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.51
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.51
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.45
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	98.44
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.38
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.32
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.31
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.3
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.27
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.25
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.16
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	97.99
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	97.96
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.9
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.48
3nw0_A		238	Non-structural maintenance of chromosomes element	97.44
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	86.33
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	85.77
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	85.57

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

Probab=99.37  E-value=2e-13  Score=111.73  Aligned_cols=54  Identities=35%  Similarity=0.817  Sum_probs=47.6

Q ss_pred             CCcccccccccccccccccCCCCeEEcCCCCcccHhhHHHHHhcCCCCCCCCCCCCC
Q 008227          516 GTYHTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  572 (573)
Q Consensus       516 ~~~~~~~CaICle~~e~~~~~~~~~vtPC~H~FH~~CL~~Wl~~k~~CP~CR~~LPP  572 (573)
                      ...+..+|+||+++++.++   .+..+||+|.||.+||++|++.+.+||+||++++|
T Consensus        19 ~~~~~~~C~IC~~~~~~~~---~~~~l~C~H~fh~~Ci~~w~~~~~~CP~Cr~~~~~   72 (75)
T 1x4j_A           19 HQSEQTLCVVCMCDFESRQ---LLRVLPCNHEFHAKCVDKWLKANRTCPICRADSGP   72 (75)
T ss_dssp             CSSSCCEETTTTEECCBTC---EEEEETTTEEEETTHHHHHHHHCSSCTTTCCCCCC
T ss_pred             ccCCCCCCeECCcccCCCC---eEEEECCCCHhHHHHHHHHHHcCCcCcCcCCcCCC
Confidence            3456789999999987654   67789999999999999999999999999999976

PyMOL of 1x4j

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		573
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	2e-11
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	7e-11
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	1e-10
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	2e-09
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	3e-09
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	1e-08
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	2e-08
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	3e-08
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	8e-08
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	3e-07
d1v87a_		114	g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou	2e-06
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	2e-05
d1wima_		94	g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016	1e-04
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	4e-04

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

 Score = 57.3 bits (138), Expect = 2e-11
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 5/49 (10%)

Query: 523 CVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP 571
           C IC+         N  M  PC H F   C+ RW+     CP C+ P+ 
Sbjct: 8   CPICLEDPS-----NYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVE 51

PyMOL of d1chca_

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		573
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.47
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.3
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	99.29
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.29
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.22
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	99.22
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.15
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	99.03
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.98
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.93
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.93
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.86
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.7
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.64
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.6
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.28
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.11
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	83.57

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.47  E-value=1.1e-14  Score=111.92  Aligned_cols=51  Identities=24%  Similarity=0.744  Sum_probs=43.2

Q ss_pred             cccccccccccccccccCCCCeEE-cCCCCcccHhhHHHHHhcCCCCCCCCCCCC
Q 008227          518 YHTTDCVICMTAIDLMQRSNDCMV-TPCDHFFHSGCLQRWMDIKMECPTCRRPLP  571 (573)
Q Consensus       518 ~~~~~CaICle~~e~~~~~~~~~v-tPC~H~FH~~CL~~Wl~~k~~CP~CR~~LP  571 (573)
                      +++.+|+||+++++.++   .... ++|+|.||.+|+.+|++.+.+||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~---~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGE---EARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTS---CCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCC---EEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            34578999999998765   4444 469999999999999999999999999873

PyMOL of d1iyma_

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure