Citrus Sinensis ID: 008265


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570--
MRVVFGSSSSSSSAIVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
cccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccc
cEEEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHc
mrvvfgsssssssAIVATQTRlynhrnkpnkhpvtklfplasssslssiptvhsSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLnelgvaplelfdgsgfkLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLcvnkpdvnLAIRYAcivpradiLFCNFVREFGKKRDLVSALRAYDaskkhlsspnmyICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKhleakgvlkldvFTYSTIVKVFADAKWWQMALKVKEDMlsagvtpntITWSSLINACANAGLVEQAMHLFEEMLqagcepnsqCCNILLQACVEACQFDRAFRLFRSWTLSKTQValgedydgntdrisnmehkdkqsitntpnfvpnshyssfdkrfsfkpttttYNILMKACCTDYYRVKALMNEMrtvglspnhiSWTILIDacggsgnvegalqcrf
mrvvfgsssssssaiVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDAskkhlsspnmyiCRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSwtlsktqvalgedydgntDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
MRVVFGsssssssAIVATQTRLYNHRNKPNKHPVTKLFPLAsssslssiptvhssQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIvesvvvseGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
************************************************************************YYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDY*****************************YSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNV********
*R*****************************HPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
**************IVATQTRLYNHRNKPNKHPVTKLFPLAS****************LLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
MRVVFGSSSSSSSAIVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVVFGSSSSSSSAIVATQTRLYNHRNKPNKHPVTKLFPLASSSSLSSIPTVHSSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQCRF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query572 2.2.26 [Sep-21-2011]
Q8GYL7 852 Pentatricopeptide repeat- yes no 0.982 0.659 0.536 1e-174
Q9FIX3 747 Pentatricopeptide repeat- no no 0.576 0.441 0.232 2e-19
Q9S7Q2 862 Pentatricopeptide repeat- no no 0.5 0.331 0.230 9e-19
Q0WLC6 1089 Pentatricopeptide repeat- no no 0.437 0.229 0.231 3e-18
Q5G1S8 1440 Pentatricopeptide repeat- no no 0.433 0.172 0.230 7e-18
P0C894 761 Putative pentatricopeptid no no 0.526 0.395 0.256 7e-18
Q9M907871 Pentatricopeptide repeat- no no 0.519 0.340 0.230 8e-18
Q9CA58 763 Putative pentatricopeptid no no 0.498 0.373 0.236 2e-17
Q9M9X9 987 Pentatricopeptide repeat- no no 0.512 0.296 0.253 2e-17
Q6NQ83619 Pentatricopeptide repeat- no no 0.493 0.455 0.239 6e-17
>sp|Q8GYL7|PP361_ARATH Pentatricopeptide repeat-containing protein At5g02830, chloroplastic OS=Arabidopsis thaliana GN=At5g02830 PE=2 SV=3 Back     alignment and function desciption
 Score =  610 bits (1573), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 311/580 (53%), Positives = 405/580 (69%), Gaps = 18/580 (3%)

Query: 3   VVFGSSSSSSSAIVATQTRLY------NHRNKPNKHPVTKLFP---LASSSSLSSIPTVH 53
           +VFGSSS+ ++       R Y      N + K N    TKL P      S S +S+   H
Sbjct: 6   IVFGSSSAITNP-HHHHRRCYATAPESNRKTKSNS-SFTKLLPSLPQQHSPSPASVSATH 63

Query: 54  SSQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEG-NVSKFASMLS 112
           S  +   + VR       +YYAD ASKLA+DGR+E+ A+I E++    G NV++FASM+ 
Sbjct: 64  SLSSHFSNVVRWIPDGSLEYYADFASKLAEDGRIEDVALIAETLAAESGANVARFASMVD 123

Query: 113 LEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVE 172
            ++++ GI  ++R+G+I+ VV  LK++ ++G+APL+L D S  KL++ + + + +S +VE
Sbjct: 124 YDLLSKGISSNLRQGKIESVVYTLKRIEKVGIAPLDLVDDSSVKLMRKQFRAMANSVQVE 183

Query: 173 MFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFG 232
             + LME+L      +KEL + F +V+ CV   +  LAIRYAC++P  ++L C  +  FG
Sbjct: 184 KAIDLMEILAGLGFKIKELVDPFDVVKSCVEISNPQLAIRYACLLPHTELLLCRIIHGFG 243

Query: 233 KKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIY 292
           KK D+VS + AY+A K+ L +PNMYICRT+IDVCG+CGDY+KSR IYEDL  +N+  NIY
Sbjct: 244 KKGDMVSVMTAYEACKQILDTPNMYICRTMIDVCGLCGDYVKSRYIYEDLLKENIKPNIY 303

Query: 293 VFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKH 352
           V NSLMNVN+HDL +TL+VYKNMQ L V ADM SYNILLK CCLAG   LAQ+IY E K 
Sbjct: 304 VINSLMNVNSHDLGYTLKVYKNMQILDVTADMTSYNILLKTCCLAGRVDLAQDIYKEAKR 363

Query: 353 LEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAG 412
           +E+ G+LKLD FTY TI+KVFADAK W+ ALKVK+DM S GVTPNT TWSSLI+ACANAG
Sbjct: 364 MESSGLLKLDAFTYCTIIKVFADAKMWKWALKVKDDMKSVGVTPNTHTWSSLISACANAG 423

Query: 413 LVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGED- 471
           LVEQA HLFEEML +GCEPNSQC NILL ACVEACQ+DRAFRLF+SW  S    +L  D 
Sbjct: 424 LVEQANHLFEEMLASGCEPNSQCFNILLHACVEACQYDRAFRLFQSWKGSSVNESLYADD 483

Query: 472 --YDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDY 529
               G T   + +++    S+ N  +   NS Y    KRF FKPTT TYNIL+KAC TDY
Sbjct: 484 IVSKGRTSSPNILKNNGPGSLVNRNS---NSPYIQASKRFCFKPTTATYNILLKACGTDY 540

Query: 530 YRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQ 569
           YR K LM+EM+++GLSPN I+W+ LID CGGSG+VEGA++
Sbjct: 541 YRGKELMDEMKSLGLSPNQITWSTLIDMCGGSGDVEGAVR 580





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q0WLC6|PP349_ARATH Pentatricopeptide repeat-containing protein At4g34830, chloroplastic OS=Arabidopsis thaliana GN=At4g34830/At4g34820 PE=2 SV=2 Back     alignment and function description
>sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 Back     alignment and function description
>sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 Back     alignment and function description
>sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 Back     alignment and function description
>sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query572
225439759 842 PREDICTED: pentatricopeptide repeat-cont 0.905 0.615 0.601 1e-179
224068636 828 predicted protein [Populus trichocarpa] 0.903 0.624 0.600 1e-178
39104565 852 unknown protein [Arabidopsis thaliana] 0.982 0.659 0.536 1e-172
30679784 852 pentatricopeptide repeat-containing prot 0.982 0.659 0.536 1e-172
449521499 855 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.982 0.657 0.564 1e-171
449448705 849 PREDICTED: pentatricopeptide repeat-cont 0.979 0.659 0.566 1e-170
7413558 798 putative protein [Arabidopsis thaliana] 0.958 0.686 0.525 1e-164
255568444 786 pentatricopeptide repeat-containing prot 0.790 0.575 0.586 1e-158
356572391 811 PREDICTED: pentatricopeptide repeat-cont 0.923 0.651 0.514 1e-150
357510555 829 Pentatricopeptide repeat-containing prot 0.844 0.582 0.543 1e-148
>gi|225439759|ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  636 bits (1640), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 320/532 (60%), Positives = 405/532 (76%), Gaps = 14/532 (2%)

Query: 40  LASSSSLSSIPTVHS--SQTALLSTVRRDLSSRNDYYADMASKLAKDGRLEEFAMIVESV 97
           L +S+S    P + S  S+  LLS VR DL++    Y+D+A+KL +DGR ++F+ + E++
Sbjct: 36  LLTSTSARLSPPISSLRSRHPLLSDVRWDLNN----YSDLATKLVQDGRFDDFSTMAETL 91

Query: 98  VVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKL 157
           ++S   +S+      +E+V++GI   +REGR+ CVV VL+K+++LG+ PLELFDGS  +L
Sbjct: 92  ILSGVELSQL-----VELVSAGISGLLREGRVYCVVEVLRKVDKLGICPLELFDGSTLEL 146

Query: 158 LKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYACIV 217
           L  EC+R+L+ G+VE  V L+E+L+ F  PVK+L E    +++CVNK + NLA+RYACI+
Sbjct: 147 LSKECRRILNCGQVEEVVELIEILDGFHFPVKKLLEPLDFIKICVNKRNPNLAVRYACIL 206

Query: 218 PRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRA 277
           P A ILFC  + EFGKKRDL SAL A++ASK+ L  PNMY  RT+IDVCG+C  Y KSR 
Sbjct: 207 PHAQILFCTIIHEFGKKRDLGSALTAFEASKQKLIGPNMYCYRTMIDVCGLCSHYQKSRY 266

Query: 278 IYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLA 337
           IYE+L +Q +T NIYVFNSLMNVN HDL +T  VYKNMQ LGV ADMASYNILLKACC+A
Sbjct: 267 IYEELLAQKITPNIYVFNSLMNVNVHDLSYTFNVYKNMQNLGVTADMASYNILLKACCVA 326

Query: 338 GNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPN 397
           G   LAQEIY EV++LE+ G+LKLDVFTYSTI+KVFADAK WQMALK+KEDMLSAGV PN
Sbjct: 327 GRVDLAQEIYREVQNLESNGMLKLDVFTYSTIIKVFADAKLWQMALKIKEDMLSAGVIPN 386

Query: 398 TITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFR 457
           T+TWS+LI++CANAG+ EQA+ LF+EML AGCEPNSQC NILL ACVEACQ+DRAFRLF+
Sbjct: 387 TVTWSALISSCANAGITEQAIQLFKEMLLAGCEPNSQCYNILLHACVEACQYDRAFRLFQ 446

Query: 458 SWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFKPTTTT 517
           SW  S+ Q                +E K +  IT+ PN + NSH+ SF K F F PTTTT
Sbjct: 447 SWKDSRFQEI---SGGTGNGNTVGVELKHQNCITSMPNCLSNSHHLSFSKSFPFTPTTTT 503

Query: 518 YNILMKACCTDYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQ 569
           YNILMKAC TDYYR KALM+EM+T GLSPNHISW+ILID CGG+GN+ GA++
Sbjct: 504 YNILMKACGTDYYRAKALMDEMKTAGLSPNHISWSILIDICGGTGNIVGAVR 555




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224068636|ref|XP_002326162.1| predicted protein [Populus trichocarpa] gi|222833355|gb|EEE71832.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|39104565|dbj|BAC42187.2| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30679784|ref|NP_195903.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332278227|sp|Q8GYL7.3|PP361_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g02830, chloroplastic; Flags: Precursor gi|332003140|gb|AED90523.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449521499|ref|XP_004167767.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448705|ref|XP_004142106.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|7413558|emb|CAB86037.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255568444|ref|XP_002525196.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535493|gb|EEF37162.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356572391|ref|XP_003554352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357510555|ref|XP_003625566.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500581|gb|AES81784.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query572
TAIR|locus:2151236 852 AT5G02830 [Arabidopsis thalian 0.865 0.580 0.573 1.3e-153
TAIR|locus:2139732566 AT4G11690 [Arabidopsis thalian 0.377 0.381 0.255 9.1e-15
TAIR|locus:2077637871 AT3G06920 "AT3G06920" [Arabido 0.402 0.264 0.252 8.3e-18
TAIR|locus:2027166 862 PTAC2 "plastid transcriptional 0.400 0.265 0.25 4.2e-17
TAIR|locus:2016427 904 AT1G19290 [Arabidopsis thalian 0.402 0.254 0.252 1.8e-16
TAIR|locus:2019085 763 AT1G74580 "AT1G74580" [Arabido 0.506 0.380 0.230 4.6e-16
TAIR|locus:2044430 822 AT2G18940 [Arabidopsis thalian 0.5 0.347 0.250 9.6e-16
TAIR|locus:2116915 1089 MRL1 "MATURATION OF RBCL 1" [A 0.704 0.370 0.230 2.8e-15
TAIR|locus:2163041527 AT5G41170 [Arabidopsis thalian 0.400 0.434 0.217 3.4e-15
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.489 0.452 0.240 3.9e-15
TAIR|locus:2151236 AT5G02830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1498 (532.4 bits), Expect = 1.3e-153, P = 1.3e-153
 Identities = 288/502 (57%), Positives = 371/502 (73%)

Query:    72 DYYADMASKLAKDGRLEEFAMIXXXXXXXXG-NVSKFASMLSLEMVASGIVKSIREGRID 130
             +YYAD ASKLA+DGR+E+ A+I        G NV++FASM+  ++++ GI  ++R+G+I+
Sbjct:    82 EYYADFASKLAEDGRIEDVALIAETLAAESGANVARFASMVDYDLLSKGISSNLRQGKIE 141

Query:   131 CVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKE 190
              VV  LK++ ++G+APL+L D S  KL++ + + + +S +VE  + LME+L      +KE
Sbjct:   142 SVVYTLKRIEKVGIAPLDLVDDSSVKLMRKQFRAMANSVQVEKAIDLMEILAGLGFKIKE 201

Query:   191 LDEEFRIVQLCVNKPDVNLAIRYACIVPRADILFCNFVREFGKKRDLVSALRAYDASKKH 250
             L + F +V+ CV   +  LAIRYAC++P  ++L C  +  FGKK D+VS + AY+A K+ 
Sbjct:   202 LVDPFDVVKSCVEISNPQLAIRYACLLPHTELLLCRIIHGFGKKGDMVSVMTAYEACKQI 261

Query:   251 LSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNAHDLKFTLE 310
             L +PNMYICRT+IDVCG+CGDY+KSR IYEDL  +N+  NIYV NSLMNVN+HDL +TL+
Sbjct:   262 LDTPNMYICRTMIDVCGLCGDYVKSRYIYEDLLKENIKPNIYVINSLMNVNSHDLGYTLK 321

Query:   311 VYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIV 370
             VYKNMQ L V ADM SYNILLK CCLAG   LAQ+IY E K +E+ G+LKLD FTY TI+
Sbjct:   322 VYKNMQILDVTADMTSYNILLKTCCLAGRVDLAQDIYKEAKRMESSGLLKLDAFTYCTII 381

Query:   371 KVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCE 430
             KVFADAK W+ ALKVK+DM S GVTPNT TWSSLI+ACANAGLVEQA HLFEEML +GCE
Sbjct:   382 KVFADAKMWKWALKVKDDMKSVGVTPNTHTWSSLISACANAGLVEQANHLFEEMLASGCE 441

Query:   431 PNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGED---YDGNTDRISNMEHKDK 487
             PNSQC NILL ACVEACQ+DRAFRLF+SW  S    +L  D     G T   + +++   
Sbjct:   442 PNSQCFNILLHACVEACQYDRAFRLFQSWKGSSVNESLYADDIVSKGRTSSPNILKNNGP 501

Query:   488 QSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKALMNEMRTVGLSPN 547
              S+ N  +   NS Y    KRF FKPTT TYNIL+KAC TDYYR K LM+EM+++GLSPN
Sbjct:   502 GSLVNRNS---NSPYIQASKRFCFKPTTATYNILLKACGTDYYRGKELMDEMKSLGLSPN 558

Query:   548 HISWTILIDACGGSGNVEGALQ 569
              I+W+ LID CGGSG+VEGA++
Sbjct:   559 QITWSTLIDMCGGSGDVEGAVR 580


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077637 AT3G06920 "AT3G06920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027166 PTAC2 "plastid transcriptionally active 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016427 AT1G19290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044430 AT2G18940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116915 MRL1 "MATURATION OF RBCL 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163041 AT5G41170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GYL7PP361_ARATHNo assigned EC number0.53620.98250.6596yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query572
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-22
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-19
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-07
pfam0153531 pfam01535, PPR, PPR repeat 6e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-06
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-04
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  101 bits (252), Expect = 3e-22
 Identities = 76/323 (23%), Positives = 134/323 (41%), Gaps = 61/323 (18%)

Query: 254 PNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMN----VNAHDLKFTL 309
            N++    +ID C   G   K+   Y  +RS+NV  +  VFN+L++      A D  F  
Sbjct: 505 ANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAF-- 562

Query: 310 EVYKNM--QKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYS 367
           +V   M  +   +  D  +   L+KAC  AG    A+E+Y  +     KG  ++    Y+
Sbjct: 563 DVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEV----YT 618

Query: 368 TIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQA 427
             V   +    W  AL + +DM   GV P+ + +S+L++   +AG +++A  + ++  + 
Sbjct: 619 IAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQ 678

Query: 428 GCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDK 487
           G +  +   + L+ AC  A  + +A  L+      K                        
Sbjct: 679 GIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIK------------------------ 714

Query: 488 QSITNTPNFVPNSHYSSFDKRFSFKPTTTTYNILMKACCTDYYRVKAL--MNEMRTVGLS 545
                                   +PT +T N L+ A C      KAL  ++EM+ +GL 
Sbjct: 715 -----------------------LRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLC 751

Query: 546 PNHISWTILIDACGGSGNVEGAL 568
           PN I+++IL+ A     + +  L
Sbjct: 752 PNTITYSILLVASERKDDADVGL 774


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 572
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.84
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.81
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.8
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.77
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.76
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.74
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.74
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.73
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.73
PRK14574 822 hmsH outer membrane protein; Provisional 99.67
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.64
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.6
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.56
PRK14574 822 hmsH outer membrane protein; Provisional 99.56
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.54
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.52
KOG2076 895 consensus RNA polymerase III transcription factor 99.5
KOG2003 840 consensus TPR repeat-containing protein [General f 99.49
KOG2003840 consensus TPR repeat-containing protein [General f 99.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.49
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.45
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.45
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.44
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.4
KOG1126638 consensus DNA-binding cell division cycle control 99.38
KOG1126638 consensus DNA-binding cell division cycle control 99.38
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.38
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.37
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.37
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.36
PF1304150 PPR_2: PPR repeat family 99.33
PF1304150 PPR_2: PPR repeat family 99.32
KOG2076 895 consensus RNA polymerase III transcription factor 99.31
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.27
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.25
KOG0547606 consensus Translocase of outer mitochondrial membr 99.24
KOG0547606 consensus Translocase of outer mitochondrial membr 99.2
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.15
PRK12370553 invasion protein regulator; Provisional 99.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.11
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.09
PRK12370553 invasion protein regulator; Provisional 99.09
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.09
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.09
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.09
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.06
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.04
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.03
KOG1915677 consensus Cell cycle control protein (crooked neck 99.0
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.97
KOG1129478 consensus TPR repeat-containing protein [General f 98.96
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.95
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.92
KOG1129478 consensus TPR repeat-containing protein [General f 98.88
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.85
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.78
PRK11189296 lipoprotein NlpI; Provisional 98.76
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.74
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.73
PRK11189296 lipoprotein NlpI; Provisional 98.73
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.73
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.71
PF1285434 PPR_1: PPR repeat 98.71
PF1285434 PPR_1: PPR repeat 98.71
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.7
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.67
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.64
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.62
PRK04841903 transcriptional regulator MalT; Provisional 98.62
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.6
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.58
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.57
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.57
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.56
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.56
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.54
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.53
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.52
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.52
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.51
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.5
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.41
KOG1128777 consensus Uncharacterized conserved protein, conta 98.41
PRK04841903 transcriptional regulator MalT; Provisional 98.36
KOG1128777 consensus Uncharacterized conserved protein, conta 98.34
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.3
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.27
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
PRK10370198 formate-dependent nitrite reductase complex subuni 98.26
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.25
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.24
KOG1125579 consensus TPR repeat-containing protein [General f 98.23
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.16
PLN02789320 farnesyltranstransferase 98.16
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.15
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.14
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.13
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.11
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.09
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.09
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.09
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.09
PLN02789320 farnesyltranstransferase 98.06
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.05
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.03
KOG1125579 consensus TPR repeat-containing protein [General f 98.02
PRK15359144 type III secretion system chaperone protein SscB; 98.02
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.01
PRK15359144 type III secretion system chaperone protein SscB; 97.99
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.98
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.98
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.91
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.91
PRK10370198 formate-dependent nitrite reductase complex subuni 97.9
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.9
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.86
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.86
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.86
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.86
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.85
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.81
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.77
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.76
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.72
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.67
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.6
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.51
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.5
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.48
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.45
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.44
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.43
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.36
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.34
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.34
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.32
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.3
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.29
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.25
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.23
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.21
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.11
KOG20411189 consensus WD40 repeat protein [General function pr 97.04
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.03
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.0
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.98
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.98
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.96
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.91
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.89
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.81
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.79
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.75
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.75
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.75
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.74
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.7
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.61
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.52
PF12688120 TPR_5: Tetratrico peptide repeat 96.4
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.4
KOG0553304 consensus TPR repeat-containing protein [General f 96.33
PRK10803263 tol-pal system protein YbgF; Provisional 96.33
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.29
PF12688120 TPR_5: Tetratrico peptide repeat 96.28
PRK10803263 tol-pal system protein YbgF; Provisional 96.28
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.27
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.25
KOG0553304 consensus TPR repeat-containing protein [General f 96.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.23
COG4700251 Uncharacterized protein conserved in bacteria cont 96.23
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.13
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.07
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.91
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.86
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.81
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.81
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.75
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.71
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.7
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.64
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.57
PF1337173 TPR_9: Tetratricopeptide repeat 95.56
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.53
KOG3941 406 consensus Intermediate in Toll signal transduction 95.48
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.46
KOG3941406 consensus Intermediate in Toll signal transduction 95.45
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.35
PF1337173 TPR_9: Tetratricopeptide repeat 95.31
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.3
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.17
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.15
PRK15331165 chaperone protein SicA; Provisional 95.03
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.97
COG3898531 Uncharacterized membrane-bound protein [Function u 94.96
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.78
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.77
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.74
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 94.72
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.44
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.3
KOG1585308 consensus Protein required for fusion of vesicles 94.22
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.1
COG3898531 Uncharacterized membrane-bound protein [Function u 93.97
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.97
smart00299140 CLH Clathrin heavy chain repeat homology. 93.9
PF13512142 TPR_18: Tetratricopeptide repeat 93.89
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.88
PRK15331165 chaperone protein SicA; Provisional 93.69
PF13512142 TPR_18: Tetratricopeptide repeat 93.64
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.33
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.27
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.1
COG3629280 DnrI DNA-binding transcriptional activator of the 92.93
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.8
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.72
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.62
smart00299140 CLH Clathrin heavy chain repeat homology. 92.5
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 92.45
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.95
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.87
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.79
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.67
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.64
COG4700251 Uncharacterized protein conserved in bacteria cont 91.56
COG3629280 DnrI DNA-binding transcriptional activator of the 91.31
KOG20411189 consensus WD40 repeat protein [General function pr 91.27
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.03
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.98
KOG4570418 consensus Uncharacterized conserved protein [Funct 90.87
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 90.76
KOG4555175 consensus TPR repeat-containing protein [Function 90.68
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.56
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.55
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.4
KOG4555175 consensus TPR repeat-containing protein [Function 90.26
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.14
COG3118304 Thioredoxin domain-containing protein [Posttransla 89.42
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.37
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.0
PF1342844 TPR_14: Tetratricopeptide repeat 88.9
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 88.78
PF1342844 TPR_14: Tetratricopeptide repeat 88.74
COG1747 711 Uncharacterized N-terminal domain of the transcrip 88.71
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.57
PRK11906458 transcriptional regulator; Provisional 88.28
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 87.71
KOG1585308 consensus Protein required for fusion of vesicles 87.48
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.2
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.01
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.01
KOG1941518 consensus Acetylcholine receptor-associated protei 85.79
PF1343134 TPR_17: Tetratricopeptide repeat 85.67
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.29
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.84
PF1343134 TPR_17: Tetratricopeptide repeat 84.56
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 84.01
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 84.0
KOG4570 418 consensus Uncharacterized conserved protein [Funct 83.57
PRK11906458 transcriptional regulator; Provisional 83.54
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.37
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.36
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 82.71
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 82.69
KOG1550552 consensus Extracellular protein SEL-1 and related 82.64
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.55
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 82.42
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.58
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 81.44
KOG1586288 consensus Protein required for fusion of vesicles 81.42
PF13929292 mRNA_stabil: mRNA stabilisation 81.11
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 80.41
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 80.05
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.9e-60  Score=501.91  Aligned_cols=487  Identities=19%  Similarity=0.246  Sum_probs=416.5

Q ss_pred             hhhhHHHHHHHhHhhcCChhHHHHHHHHHHhhcCC-hhHHHhH------------------------HHHHHHhhhhHhh
Q 008265           69 SRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGN-VSKFASM------------------------LSLEMVASGIVKS  123 (572)
Q Consensus        69 ~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~-p~~~~~~------------------------~~~~~~~~~~~~~  123 (572)
                      ++...|..++..+++.|++++|.++|++|...|+. ++.....                        .+..+++.++.+|
T Consensus       368 ~~~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a~  447 (1060)
T PLN03218        368 RKSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSVC  447 (1060)
T ss_pred             CCchHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHHH
Confidence            34788999999999999999999999999998864 3322111                        1235678889999


Q ss_pred             hhhCChhHHHHHHHHhhhcCCCCcchhhhhhhHHHHHHHHHHhhhhhHHHHHHHHHHHHhCCCCCcccchHHHHHHHHhc
Q 008265          124 IREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQLCVN  203 (572)
Q Consensus       124 ~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~~~~~l~~~~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~  203 (572)
                      ++.|++++|.++|++|.+.|+.||..    +|+.++.+|+.   .|++++|.++|++|.+.|+.| +..+|+.+|.+|++
T Consensus       448 ~k~g~~e~A~~lf~~M~~~Gl~pD~~----tynsLI~~y~k---~G~vd~A~~vf~eM~~~Gv~P-dvvTynaLI~gy~k  519 (1060)
T PLN03218        448 ASSQDIDGALRVLRLVQEAGLKADCK----LYTTLISTCAK---SGKVDAMFEVFHEMVNAGVEA-NVHTFGALIDGCAR  519 (1060)
T ss_pred             HhCcCHHHHHHHHHHHHHcCCCCCHH----HHHHHHHHHHh---CcCHHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHHH
Confidence            99999999999999999999999887    77777776655   899999999999999999876 46899999999999


Q ss_pred             CCChHHHHHhhhcC-----CCchhHHHHHHHHHHhcCCHHHHHHHHHHHHh--cCCCCcHHHHHHHHHHHHhcCCHHHHH
Q 008265          204 KPDVNLAIRYACIV-----PRADILFCNFVREFGKKRDLVSALRAYDASKK--HLSSPNMYICRTIIDVCGICGDYMKSR  276 (572)
Q Consensus       204 ~g~~~~a~~~~~~~-----~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~--~~~~~~~~~~~~ll~~~~~~g~~~~a~  276 (572)
                      .|++++|.++|+.|     .++..+|+.||.+|++.|++++|.++|++|..  .|+.||..+|+.+|.+|++.|++++|.
T Consensus       520 ~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~  599 (1060)
T PLN03218        520 AGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAK  599 (1060)
T ss_pred             CcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHH
Confidence            99999999999887     45669999999999999999999999999976  578999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCHHHHHHHHHHhc--CChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHHH
Q 008265          277 AIYEDLRSQNVTLNIYVFNSLMNVNA--HDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKHLE  354 (572)
Q Consensus       277 ~~~~~m~~~g~~p~~~~~~~ll~~~~--~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~  354 (572)
                      ++|++|.+.|+.|+..+|+.+|.+|+  |++++|+++|++|.+.|+.||..+|+.++.+|++.|++++|.++|++|.+  
T Consensus       600 elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k--  677 (1060)
T PLN03218        600 EVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARK--  677 (1060)
T ss_pred             HHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHH--
Confidence            99999999999999999999999987  78999999999999999999999999999999999999999999999986  


Q ss_pred             HhCCCCCCHHHHHHHHHHHHccccHHHHHHHHHHHHHCCCCCchhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHH
Q 008265          355 AKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPNSQ  434 (572)
Q Consensus       355 ~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~  434 (572)
                       .| +.||..+|++||.+|++.|++++|.++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.+.|+.||..
T Consensus       678 -~G-~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~  755 (1060)
T PLN03218        678 -QG-IKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTI  755 (1060)
T ss_pred             -cC-CCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHH
Confidence             45 7999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCHhHHHHHHHHhhhcccccccccccCCchHHHHhhhhhcccc----ccCCCCc--------ccCCcc
Q 008265          435 CCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQS----ITNTPNF--------VPNSHY  502 (572)
Q Consensus       435 ~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~--------~~~~~~  502 (572)
                      ||+.++.+|++.|++++|.++|++|.+.|..++... ++...+.......++...    .....+.        ...-.+
T Consensus       756 Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd~~t-ynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~l  834 (1060)
T PLN03218        756 TYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVM-CRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMV  834 (1060)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHH-HHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHH
Confidence            999999999999999999999999999988765321 222222211111111100    0000000        011345


Q ss_pred             chhhhhcCCCCCHHHHHHHHHHHhh--cHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCCccccccc
Q 008265          503 SSFDKRFSFKPTTTTYNILMKACCT--DYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNVEGALQC  570 (572)
Q Consensus       503 ~~~~~~~~~~p~~~~~~~ll~a~~~--~~~~a~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~~~~a~~~  570 (572)
                      ++.|.+.|+.||..||+.+|.++++  ..+.+..++++|...+..|+..+|++|+++|.+.  .++|+.+
T Consensus       835 f~eM~~~Gi~Pd~~T~~~vL~cl~~~~~~~~~~~m~~~m~~~~~~~~~~~y~~Li~g~~~~--~~~A~~l  902 (1060)
T PLN03218        835 YRETISAGTLPTMEVLSQVLGCLQLPHDATLRNRLIENLGISADSQKQSNLSTLVDGFGEY--DPRAFSL  902 (1060)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHhcccccHHHHHHHHHHhccCCCCcchhhhHHHHHhhccC--hHHHHHH
Confidence            7789999999999999999976665  4578889999998889999999999999998542  2456543



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query572
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 67.6 bits (164), Expect = 6e-12
 Identities = 80/514 (15%), Positives = 169/514 (32%), Gaps = 116/514 (22%)

Query: 16  VATQTRLYNHRNKPNKHPVTKLFPL----ASSSSLSSIP--TVH----SSQTALLSTVRR 65
           +  + RLYN      K+ V++L P      +   L       +     S +T +   V  
Sbjct: 113 IEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCL 172

Query: 66  DLS--SRND---YYADMASKLAKDGRLE---EFAMIVESVVVSEGNVSKFASMLSLEMVA 117
                 + D   ++ ++ +  + +  LE   +    ++    S  + S     L +  + 
Sbjct: 173 SYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSS-NIKLRIHSIQ 231

Query: 118 SGIVKSIREGR-IDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLL---DSGEVEM 173
           + + + ++     +C++ VL  +          F+ S        C+ LL        + 
Sbjct: 232 AELRRLLKSKPYENCLL-VLLNVQNAKA--WNAFNLS--------CKILLTTRFKQVTDF 280

Query: 174 FVGLME---VLEEFRLPVKELDEEFRIVQLCVNKPDVNLAIRYAC-IVPRADILFCNFVR 229
                     L+   + +   DE   ++   ++    +L  R      PR   +    +R
Sbjct: 281 LSAATTTHISLDHHSMTLTP-DEVKSLLLKYLDCRPQDLP-REVLTTNPRRLSIIAESIR 338

Query: 230 EFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKSRAIYEDL----RSQ 285
           +     D     +  +  K            TII+      +  + R +++ L     S 
Sbjct: 339 DGLATWD---NWKHVNCDKLT----------TIIESSLNVLEPAEYRKMFDRLSVFPPSA 385

Query: 286 NV---TLNIY-----------VFNSLMN---VNAHDLKFTLEVY----KNMQKLGVMADM 324
           ++    L++            V N L     V     + T+ +     +   KL     +
Sbjct: 386 HIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYAL 445

Query: 325 -----ASYNILLKACCLAGNTVLAQE----IYGEVK-HL-EAKGVLKLDVFTYSTIVKVF 373
                  YNI         + ++        Y  +  HL   +   ++ +F       VF
Sbjct: 446 HRSIVDHYNIPKTFDS---DDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFR-----MVF 497

Query: 374 ADAKWWQMALKVKEDMLS---AGVTPNTIT----WSSLINACANAGLVEQAMHLFEEMLQ 426
            D ++  +  K++ D  +   +G   NT+     +   I  C N    E+ ++   + L 
Sbjct: 498 LDFRF--LEQKIRHDSTAWNASGSILNTLQQLKFYKPYI--CDNDPKYERLVNAILDFLP 553

Query: 427 AGCEPN---SQCCNIL---LQACVEACQFDRAFR 454
              E N   S+  ++L   L A  EA  F+ A +
Sbjct: 554 -KIEENLICSKYTDLLRIALMAEDEAI-FEEAHK 585


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query572
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.98
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.85
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.83
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.78
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.77
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.72
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.71
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.69
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.67
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.66
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.66
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.65
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.6
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.59
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.58
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.56
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.55
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.53
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.53
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.51
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.43
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.42
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.41
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.4
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.4
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.38
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.37
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.36
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.35
3u4t_A272 TPR repeat-containing protein; structural genomics 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.34
3u4t_A272 TPR repeat-containing protein; structural genomics 99.34
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.33
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.32
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.31
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.3
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.29
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.26
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.25
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.22
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.22
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.21
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.2
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.2
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.19
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.18
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.17
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.13
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.11
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.03
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.02
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.0
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.93
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.93
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.9
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.82
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.69
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.68
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.68
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.59
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.57
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.57
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.55
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.55
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.54
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.54
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.53
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.51
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.51
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.5
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.49
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.48
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.46
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.43
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.42
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.41
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.41
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.39
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.36
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.36
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.36
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.35
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.34
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.31
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.3
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.29
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.28
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.28
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.28
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.25
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.25
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.24
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.23
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.22
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.21
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.2
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.19
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.16
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.06
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.99
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.99
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.99
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.99
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.98
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.96
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.96
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.96
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.95
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.95
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.94
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.93
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.92
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.92
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.91
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.91
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.82
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.81
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.79
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.78
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.75
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.73
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.7
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.68
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.67
3k9i_A117 BH0479 protein; putative protein binding protein, 97.66
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.61
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.6
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.58
3k9i_A117 BH0479 protein; putative protein binding protein, 97.57
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.43
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.42
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.41
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.33
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.22
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.15
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.99
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.95
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.94
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.94
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.91
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.89
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.73
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.68
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.68
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.67
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.54
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.29
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.23
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.22
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.16
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.14
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.91
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.54
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.06
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.94
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.74
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.6
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.39
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.86
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.61
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.55
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.27
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 93.16
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.93
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.86
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.95
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 91.92
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.0
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.72
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.95
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 88.72
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.05
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.29
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.59
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 81.97
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.7e-34  Score=299.90  Aligned_cols=431  Identities=11%  Similarity=-0.035  Sum_probs=355.5

Q ss_pred             CchhhhHHHHHHHhHhhcCChhHHHHHHHHHHhhcCChhHHHhHHHHHHHhhhhHhhhhhCChhHHHHHHHHhhhcCCCC
Q 008265           67 LSSRNDYYADMASKLAKDGRLEEFAMIVESVVVSEGNVSKFASMLSLEMVASGIVKSIREGRIDCVVGVLKKLNELGVAP  146 (572)
Q Consensus        67 p~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~m~~~~~~p  146 (572)
                      |.++...|+.++..+.+.|++++|+.+|++|....+++         ..+..+...|.+.|++++|+.+|+++...  .+
T Consensus        80 ~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~---------~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~  148 (597)
T 2xpi_A           80 SLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNP---------NDAFWLAQVYCCTGDYARAKCLLTKEDLY--NR  148 (597)
T ss_dssp             --CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCH---------HHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GT
T ss_pred             hHHHHHHHHHHHHHHHHccCchHHHHHHHHHHhhCCCc---------hHHHHHHHHHHHcCcHHHHHHHHHHHhcc--cc
Confidence            44567889999999999999999999999999764432         23455788899999999999999998654  33


Q ss_pred             cchhhhhhhHHHHHHHHHHhhhhhHHHHHHHHHHHHhCC--------------CCCcccchHHHHHHHHhcCCChHHHHH
Q 008265          147 LELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFR--------------LPVKELDEEFRIVQLCVNKPDVNLAIR  212 (572)
Q Consensus       147 ~~~~~~~~~~~l~~~~~~~~~~g~~~~a~~~~~~~~~~~--------------~~~~~~~~~~~ll~~~~~~g~~~~a~~  212 (572)
                      +..    .+..+..++   .+.|++++|+.+|+++....              -.+.+..+|+.++.+|.+.|++++|++
T Consensus       149 ~~~----~~~~l~~~~---~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~  221 (597)
T 2xpi_A          149 SSA----CRYLAAFCL---VKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKE  221 (597)
T ss_dssp             CHH----HHHHHHHHH---HHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             chh----HHHHHHHHH---HHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHH
Confidence            333    455555544   44899999999998532211              012346789999999999999999999


Q ss_pred             hhhcC----CCchhHH--------------------------------------HHHHHHHHhcCCHHHHHHHHHHHHhc
Q 008265          213 YACIV----PRADILF--------------------------------------CNFVREFGKKRDLVSALRAYDASKKH  250 (572)
Q Consensus       213 ~~~~~----~~~~~~~--------------------------------------~~li~~~~~~g~~~~a~~~~~~m~~~  250 (572)
                      +|+.+    |.....+                                      +.++..|.+.|++++|.++|+.+.+.
T Consensus       222 ~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~  301 (597)
T 2xpi_A          222 CYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL  301 (597)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG
T ss_pred             HHHHHHHhCchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC
Confidence            99886    3332332                                      22356677889999999999998875


Q ss_pred             CCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHhc--CChHHHHHHHHHHHHcCCCCCHHHHH
Q 008265          251 LSSPNMYICRTIIDVCGICGDYMKSRAIYEDLRSQNVTLNIYVFNSLMNVNA--HDLKFTLEVYKNMQKLGVMADMASYN  328 (572)
Q Consensus       251 ~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~--~~~~~a~~~~~~m~~~~~~~~~~~~~  328 (572)
                        .++..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+++.++.++.  |++++|..+++++.+.. +.+..+++
T Consensus       302 --~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~  377 (597)
T 2xpi_A          302 --EKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWL  377 (597)
T ss_dssp             --GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHH
T ss_pred             --CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHH
Confidence              4789999999999999999999999999999765 236677888877755  89999999999998654 34788999


Q ss_pred             HHHHHHHHcCChHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccccHHHHHHHHHHHHHCCCCCchhhHHHHHHHH
Q 008265          329 ILLKACCLAGNTVLAQEIYGEVKHLEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINAC  408 (572)
Q Consensus       329 ~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~  408 (572)
                      .++.+|.+.|++++|.++|+++.+.     .+.+..+|+.++.+|.+.|++++|+++|+++.+.+. .+..+|+.++.+|
T Consensus       378 ~l~~~~~~~g~~~~A~~~~~~~~~~-----~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~  451 (597)
T 2xpi_A          378 AVGIYYLCVNKISEARRYFSKSSTM-----DPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQ-GTHLPYLFLGMQH  451 (597)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHH-----CTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTT-TCSHHHHHHHHHH
T ss_pred             HHHHHHHHhccHHHHHHHHHHHHHh-----CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-cchHHHHHHHHHH
Confidence            9999999999999999999999874     245688999999999999999999999999998743 3788999999999


Q ss_pred             HHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHhCCHhHHHHHHHHhhhcccccccccccCCchHHHHhhhhhccc
Q 008265          409 ANAGLVEQAMHLFEEMLQAGCEPNSQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQ  488 (572)
Q Consensus       409 ~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  488 (572)
                      .+.|++++|.++|+++.+.. +.+..+|+.++..|.+.|++++|.++|+++.+..                         
T Consensus       452 ~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-------------------------  505 (597)
T 2xpi_A          452 MQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLV-------------------------  505 (597)
T ss_dssp             HHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH-------------------------
T ss_pred             HHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhh-------------------------
Confidence            99999999999999999864 5578999999999999999999999999987532                         


Q ss_pred             cccCCCCcccCCccchhhhhcCCCCC--HHHHHHHHHHHhh--cHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCCc
Q 008265          489 SITNTPNFVPNSHYSSFDKRFSFKPT--TTTYNILMKACCT--DYYRVKALMNEMRTVGLSPNHISWTILIDACGGSGNV  564 (572)
Q Consensus       489 ~~~~~~~~~~~~~~~~~~~~~~~~p~--~~~~~~ll~a~~~--~~~~a~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~~  564 (572)
                                        ...+..|+  ..+|..+..+|.+  +.++|.++++++.+.+ +.+..+|..+..+|.+.|++
T Consensus       506 ------------------~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~  566 (597)
T 2xpi_A          506 ------------------KKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIP  566 (597)
T ss_dssp             ------------------HHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCH
T ss_pred             ------------------hccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCH
Confidence                              12245677  7899999999987  6789999999998854 34788999999999999999


Q ss_pred             cccccc
Q 008265          565 EGALQC  570 (572)
Q Consensus       565 ~~a~~~  570 (572)
                      ++|.++
T Consensus       567 ~~A~~~  572 (597)
T 2xpi_A          567 GLAITH  572 (597)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            999764



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query572
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.81
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.8
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.42
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.98
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.82
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.81
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.8
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.65
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.64
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.56
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.31
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.2
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.15
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.14
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.06
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.99
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.93
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.89
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.86
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.78
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.74
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.68
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.66
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.6
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.56
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.54
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.45
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.44
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.34
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.32
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.15
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.1
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.09
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.86
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.69
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.65
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.25
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.67
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.91
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.89
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.01
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.99
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 89.7
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 88.56
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 86.77
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 83.07
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 82.89
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=7.9e-16  Score=148.52  Aligned_cols=372  Identities=13%  Similarity=0.072  Sum_probs=283.9

Q ss_pred             hHhhhhhCChhHHHHHHHHhhhcCCCCcchhhhhhhHHHHHHHHHHhhhhhHHHHHHHHHHHHhCCCCCcccchHHHHHH
Q 008265          120 IVKSIREGRIDCVVGVLKKLNELGVAPLELFDGSGFKLLKNECQRLLDSGEVEMFVGLMEVLEEFRLPVKELDEEFRIVQ  199 (572)
Q Consensus       120 ~~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~~~~~l~~~~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~ll~  199 (572)
                      ...+.+.|++++|+..|+++.+.  .|+..   ..+..+..+   +.+.|++++|+..|++..+.  .|....+|..+..
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~--~p~~~---~~~~~la~~---~~~~~~~~~A~~~~~~al~~--~p~~~~a~~~l~~   75 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQ--EPDNT---GVLLLLSSI---HFQCRRLDRSAHFSTLAIKQ--NPLLAEAYSNLGN   75 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHH--CTTCH---HHHHHHHHH---HHHTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHh--CCCCH---HHHHHHHHH---HHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHH
Confidence            34567889999999999999886  45422   233333333   34479999999999998875  4677788999999


Q ss_pred             HHhcCCChHHHHHhhhcC----CCchhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHH
Q 008265          200 LCVNKPDVNLAIRYACIV----PRADILFCNFVREFGKKRDLVSALRAYDASKKHLSSPNMYICRTIIDVCGICGDYMKS  275 (572)
Q Consensus       200 ~~~~~g~~~~a~~~~~~~----~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~a  275 (572)
                      .+.+.|++++|+..+...    +................+....+............ ................+....+
T Consensus        76 ~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~  154 (388)
T d1w3ba_          76 VYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNP-DLYCVRSDLGNLLKALGRLEEA  154 (388)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCT-TCTHHHHHHHHHHHTTSCHHHH
T ss_pred             Hhhhhcccccccccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccchhhhh
Confidence            999999999999887764    33344555555556666666666666655554433 3344555666667788888888


Q ss_pred             HHHHHHHHhCCCCCC-HHHHHHHHHH--hcCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHH
Q 008265          276 RAIYEDLRSQNVTLN-IYVFNSLMNV--NAHDLKFTLEVYKNMQKLGVMADMASYNILLKACCLAGNTVLAQEIYGEVKH  352 (572)
Q Consensus       276 ~~~~~~m~~~g~~p~-~~~~~~ll~~--~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~  352 (572)
                      ...+.......  |+ ...+..+...  ..++.++|...+.+..+.... +...+..+...+...|++++|...+.....
T Consensus       155 ~~~~~~~~~~~--~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~  231 (388)
T d1w3ba_         155 KACYLKAIETQ--PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN-FLDAYINLGNVLKEARIFDRAVAAYLRALS  231 (388)
T ss_dssp             HHHHHHHHHHC--TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHTTTCTTHHHHHHHHHHH
T ss_pred             HHHHHHhhccC--cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc-cHHHHHHHhhhhhccccHHHHHHHHHHhHH
Confidence            88888877652  33 3344443333  448899999999998876533 577888899999999999999999999887


Q ss_pred             HHHhCCCCCCHHHHHHHHHHHHccccHHHHHHHHHHHHHCCCCCchhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCC
Q 008265          353 LEAKGVLKLDVFTYSTIVKVFADAKWWQMALKVKEDMLSAGVTPNTITWSSLINACANAGLVEQAMHLFEEMLQAGCEPN  432 (572)
Q Consensus       353 ~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~  432 (572)
                      .     .+.+...+..+...+.+.|++++|+..|++..+.... +...|..+...+...|++++|.+.++...... +.+
T Consensus       232 ~-----~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~  304 (388)
T d1w3ba_         232 L-----SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH-FPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTH  304 (388)
T ss_dssp             H-----CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSS-CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTC
T ss_pred             H-----hhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-Ccc
Confidence            4     2456778888999999999999999999999886432 56788899999999999999999999988764 667


Q ss_pred             HHHHHHHHHHHHHhCCHhHHHHHHHHhhhcccccccccccCCchHHHHhhhhhccccccCCCCcccCCccchhhhhcCCC
Q 008265          433 SQCCNILLQACVEACQFDRAFRLFRSWTLSKTQVALGEDYDGNTDRISNMEHKDKQSITNTPNFVPNSHYSSFDKRFSFK  512 (572)
Q Consensus       433 ~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  512 (572)
                      ...+..+...+.+.|++++|.+.|++..+.                                                 .
T Consensus       305 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-------------------------------------------------~  335 (388)
T d1w3ba_         305 ADSLNNLANIKREQGNIEEAVRLYRKALEV-------------------------------------------------F  335 (388)
T ss_dssp             HHHHHHHHHHHHTTTCHHHHHHHHHHHTTS-------------------------------------------------C
T ss_pred             chhhhHHHHHHHHCCCHHHHHHHHHHHHHh-------------------------------------------------C
Confidence            888999999999999999999999987642                                                 3


Q ss_pred             C-CHHHHHHHHHHHhh--cHHHHHHHHHHHHhCCCCCC-HHHHHHHHHHHHccCC
Q 008265          513 P-TTTTYNILMKACCT--DYYRVKALMNEMRTVGLSPN-HISWTILIDACGGSGN  563 (572)
Q Consensus       513 p-~~~~~~~ll~a~~~--~~~~a~~~~~~m~~~g~~p~-~~~~~~l~~~~~~~g~  563 (572)
                      | +..+|..+-..|.+  +.++|...|++..+  +.|+ ...|..|..+|.+.||
T Consensus       336 p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         336 PEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTCC
T ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            4 46677777777765  56899999999887  5675 6689999999988775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure