Citrus Sinensis ID: 008560

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MKAPETDPINLSTQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLIKSGVLQDGVVSSGSKREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESLGRGKIWGVFARP
ccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHcccccccccccc
cccccccHHHHHHHHHHHHHHHcHcHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHEEEccccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHEEcccccccHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHccccHHHcccc
mkapetdpinlstQHLSSlldqiplvkhfkgkWVIVKTKLNDLETQlkdfsdfpaaasntlcldHVHSVSHTLIEAASVAQKcqgvsltegklktqsDIDSVLAKLDRhvrdgdvliksgvlqdgdvlIKSGvlqdgvvssgskREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMdssslemkEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEIcqagtpgsqAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKemgecgcigplikmldgkaVEEKESAAKALSTLMLYAGNRKilrkdergIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESlgrgkiwgvfarp
mkapetdpinlstQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSltegklktqsdIDSVLAKLDRHVRDGDVliksgvlqdgdvliksgvlqdgvvssgskreavraesrnlitrlqigsaeskNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRkilrkdergIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKlleslgrgkiwgvfarp
MKAPETDPINLSTQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLIKSGVLQDGVVSSGSKREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNvviavaqgvvpvlvKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGkaveekesaakaLSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESLGRGKIWGVFARP
***************LSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLIKSGVLQDGV***********************************LLGLLQEDDKNVVIAVAQGVVPVLVKLMDS*******KTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVE****AAKALSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESLGRGKIWGVF***
***********STQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKD**************DHVHSVSHTLIEAAS*************KLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLI********************AESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARK*MGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGIVTVVQLLDP*****DKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEM******KLLESLGRGKIWGVFAR*
********INLSTQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLIKSGVLQD**************ESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESLGRGKIWGVFARP
****ETDPINLSTQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLI**************KREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESLGRGKIWGVF***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAPETDPINLSTQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASNTLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKSGVLQDGDVLIKSGVLQDGVVSSGSKREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDIEGANKLLESLGRGKIWGVFARP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query561 2.2.26 [Sep-21-2011]
Q8GUG9612 U-box domain-containing p no no 0.342 0.313 0.257 1e-12
O22193826 U-box domain-containing p no no 0.374 0.254 0.294 7e-12
Q9C9A6628 U-box domain-containing p no no 0.374 0.334 0.258 7e-10
Q9SNC6660 U-box domain-containing p no no 0.345 0.293 0.281 6e-09
Q5VRH9611 U-box domain-containing p no no 0.370 0.340 0.246 8e-09
Q681N2660 U-box domain-containing p no no 0.290 0.246 0.283 4e-08
Q9ZV31654 U-box domain-containing p no no 0.304 0.261 0.291 5e-07
Q5XEZ8707 U-box domain-containing p no no 0.342 0.271 0.292 2e-06
P39968 578 Vacuolar protein 8 OS=Sac yes no 0.600 0.583 0.231 4e-06
Q9FL17550 U-box domain-containing p no no 0.344 0.350 0.258 5e-06
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 97/194 (50%), Gaps = 2/194 (1%)

Query: 137 GVVSSGSKREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPV 196
           G ++  +K     +  R L+ RL   S E + +A+  +  L +    N ++    G +PV
Sbjct: 318 GYINGRTKNSGDMSVIRALVQRLSSRSTEDRRNAVSEIRSLSKRSTDNRILIAEAGAIPV 377

Query: 197 LVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLESGSGFAKERAC 256
           LV L+ S  +  +E  +  +  +S+ +++K +++  G +    +++VL +G+  A+E A 
Sbjct: 378 LVNLLTSEDVATQENAITCVLNLSIYENNKELIMFAGAV--TSIVQVLRAGTMEARENAA 435

Query: 257 VALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFSEIKENFIEE 316
             L +LS + EN   IG  G I +L+++ + GTP  +  AA  L NL  +   K   +  
Sbjct: 436 ATLFSLSLADENKIIIGGSGAIPALVDLLENGTPRGKKDAATALFNLCIYHGNKGRAVRA 495

Query: 317 NAVMVLLGLVASGT 330
             V  L+ +++  T
Sbjct: 496 GIVTALVKMLSDST 509
Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q681N2|PUB15_ARATH U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 Back     alignment and function description
>sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
224122136552 predicted protein [Populus trichocarpa] 0.978 0.994 0.716 0.0
224136286552 predicted protein [Populus trichocarpa] 0.978 0.994 0.700 0.0
225456447580 PREDICTED: vacuolar protein 8-like [Viti 0.969 0.937 0.704 0.0
449455447551 PREDICTED: U-box domain-containing prote 0.973 0.990 0.680 0.0
297795889555 armadillo/beta-catenin repeat family pro 0.980 0.990 0.669 0.0
15241309555 armadillo/beta-catenin-like repeat-conta 0.980 0.990 0.660 0.0
14532770555 unknown protein [Arabidopsis thaliana] 0.980 0.990 0.660 0.0
356516505563 PREDICTED: uncharacterized protein LOC10 0.973 0.969 0.644 0.0
225425156584 PREDICTED: uncharacterized protein LOC10 0.973 0.934 0.607 0.0
357464955554 hypothetical protein MTR_3g098730 [Medic 0.966 0.978 0.615 0.0
>gi|224122136|ref|XP_002318761.1| predicted protein [Populus trichocarpa] gi|222859434|gb|EEE96981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/564 (71%), Positives = 470/564 (83%), Gaps = 15/564 (2%)

Query: 1   MKAPETDPINLSTQHLSSLLDQ-IPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASN 59
           MK PE DPI LS   L SLL+  IPL++ FKGKW ++K+KL DL+TQL DFS+F  + +N
Sbjct: 1   MKIPENDPITLSNDLLHSLLNHHIPLIQSFKGKWGLIKSKLADLQTQLTDFSEFQTSLTN 60

Query: 60  TLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKS 119
            L LD +HS+S TL +A   A+KCQ  +LTEGKLKTQSDIDS+LAKL+++V+D ++LIKS
Sbjct: 61  PLSLDLLHSISQTLTDAILSAEKCQDTNLTEGKLKTQSDIDSILAKLNQNVKDCEILIKS 120

Query: 120 GVLQDGDVLIKSGVLQDGVVS-SGSKREAVRAESRNLITRLQIGSAESKNSAMDSLLGLL 178
           GVLQ            DG+VS SGSKRE VRAESRNL TRLQIGS ESKN AMDS+L L+
Sbjct: 121 GVLQ------------DGIVSGSGSKRELVRAESRNLTTRLQIGSPESKNLAMDSVLSLI 168

Query: 179 QEDDKNVVIAVAQGVVPVLVKLMDSSS-LEMKEKTVASIARVSMVDSSKHVLIAEGLLLL 237
           QEDDKNV+IAVAQG+VPVLV+L+D +S L++KEKTVA+I+ +SMVDSSKHVLIAEGLLLL
Sbjct: 169 QEDDKNVMIAVAQGIVPVLVRLLDCNSCLDIKEKTVAAISIISMVDSSKHVLIAEGLLLL 228

Query: 238 NHLIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAA 297
           N LIR+LESGSGFAKE+AC+ALQ LSFS+ENARAIGSRGGI SLLEICQAGTP SQ  A+
Sbjct: 229 NQLIRILESGSGFAKEKACIALQTLSFSRENARAIGSRGGICSLLEICQAGTPSSQGLAS 288

Query: 298 GVLRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVR 357
           GVLRNLA F E +ENFIEENAV VL+GL ASGTALAQEN  GCLCNLV DDE+LKLLIV+
Sbjct: 289 GVLRNLAVFEETRENFIEENAVFVLIGLAASGTALAQENAIGCLCNLVKDDENLKLLIVK 348

Query: 358 EGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSV 417
           EG I  L++YWDS   ++S EVAVELL +LAS   IAE LVSDGF+VRLV VLN GV  V
Sbjct: 349 EGVIECLRNYWDSCPPMRSPEVAVELLRELASSQAIAEGLVSDGFIVRLVAVLNLGVSGV 408

Query: 418 RIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRK 477
           RIAAARAVS L  N+K RKEMGE GCIGPLIKMLDGKAVEEKE+AAKALS L+LYAGNR+
Sbjct: 409 RIAAARAVSELSCNTKTRKEMGELGCIGPLIKMLDGKAVEEKEAAAKALSLLVLYAGNRR 468

Query: 478 ILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEM 537
           I RK E GIV+ VQLLD  IQNLDKKYPV+ILA+LVH +KCRKQM+AAGA +HL+KLV+M
Sbjct: 469 IFRKSEGGIVSTVQLLDTSIQNLDKKYPVSILASLVHSKKCRKQMIAAGASVHLKKLVDM 528

Query: 538 DIEGANKLLESLGRGKIWGVFARP 561
           ++EG+ KLL+ LGRGKIWGVFARP
Sbjct: 529 NVEGSKKLLDGLGRGKIWGVFARP 552

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136286|ref|XP_002322291.1| predicted protein [Populus trichocarpa] gi|222869287|gb|EEF06418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225456447|ref|XP_002280728.1| PREDICTED: vacuolar protein 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455447|ref|XP_004145464.1| PREDICTED: U-box domain-containing protein 10-like [Cucumis sativus] gi|449529132|ref|XP_004171555.1| PREDICTED: U-box domain-containing protein 10-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297795889|ref|XP_002865829.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297311664|gb|EFH42088.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15241309|ref|NP_199903.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|9758237|dbj|BAB08736.1| unnamed protein product [Arabidopsis thaliana] gi|58652072|gb|AAW80861.1| At5g50900 [Arabidopsis thaliana] gi|190576485|gb|ACE79043.1| At5g50900 [Arabidopsis thaliana] gi|332008624|gb|AED96007.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14532770|gb|AAK64166.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356516505|ref|XP_003526934.1| PREDICTED: uncharacterized protein LOC100807228 [Glycine max] Back     alignment and taxonomy information
>gi|225425156|ref|XP_002263582.1| PREDICTED: uncharacterized protein LOC100247251 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357464955|ref|XP_003602759.1| hypothetical protein MTR_3g098730 [Medicago truncatula] gi|355491807|gb|AES73010.1| hypothetical protein MTR_3g098730 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
TAIR|locus:2157358555 AT5G50900 [Arabidopsis thalian 0.987 0.998 0.626 9.6e-176
TAIR|locus:2198235574 AT1G01830 "AT1G01830" [Arabido 0.942 0.921 0.348 2.1e-75
TAIR|locus:2043709553 AT2G45720 "AT2G45720" [Arabido 0.768 0.779 0.331 7.3e-59
TAIR|locus:2056529580 AT2G05810 "AT2G05810" [Arabido 0.976 0.944 0.294 9.3e-59
TAIR|locus:2197654573 AT1G61350 [Arabidopsis thalian 0.959 0.938 0.285 2.6e-54
TAIR|locus:2130699472 AT4G16490 "AT4G16490" [Arabido 0.491 0.584 0.302 2e-15
TAIR|locus:2178818357 AT5G58680 "AT5G58680" [Arabido 0.493 0.775 0.262 5e-14
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.504 0.341 0.262 4.6e-13
TAIR|locus:2017719612 AT1G23030 [Arabidopsis thalian 0.522 0.478 0.211 1.6e-12
TAIR|locus:2013990628 AT1G71020 [Arabidopsis thalian 0.522 0.466 0.242 1.6e-10
TAIR|locus:2157358 AT5G50900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1707 (606.0 bits), Expect = 9.6e-176, P = 9.6e-176
 Identities = 352/562 (62%), Positives = 427/562 (75%)

Query:     1 MKAPETDPINLS-TQHLSSLLDQIPLVKHFKGKWVIVKTKLNDLETQLKDFSDFPAAASN 59
             M  P +D  + S T+ ++SL+D IP +  FK KW  ++ KL DL+TQL DFSDF  ++SN
Sbjct:     1 MTVPNSDDGDRSLTEVITSLIDSIPNLLSFKCKWSSIRAKLADLKTQLSDFSDFAGSSSN 60

Query:    60 TLCLDHVHSVSHTLIEAASVAQKCQGVSLTEGKLKTQSDIDSVLAKLDRHVRDGDVLIKS 119
              L +D + SV  TL +A +VA +C+G  L EGKLKTQS++DSV+A+LDRHV+D +VLIKS
Sbjct:    61 KLAVDLLVSVRETLNDAVAVAARCEGPDLAEGKLKTQSEVDSVMARLDRHVKDAEVLIKS 120

Query:   120 GVLQDGDVLIKSGVLQDGVVSSGSKREAVRAESRNLITRLQIGSAESKNSAMDSLLGLLQ 179
             G+L D  +++ SG       S  SK+EAVR E+RNL+ RLQIG  ESKNSA+DSL+ LLQ
Sbjct:   121 GLLIDNGIVV-SGF------SISSKKEAVRLEARNLVIRLQIGGVESKNSAIDSLIELLQ 173

Query:   180 EDDKNXXXXXXXXXXXXXXKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNH 239
             EDDKN              +L+DS SL MKEKTVA I+R+SMV+SSKHVLIAEGL LLNH
Sbjct:   174 EDDKNVMICVAQGVVPVLVRLLDSCSLVMKEKTVAVISRISMVESSKHVLIAEGLSLLNH 233

Query:   240 LIRVLESGSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGV 299
             L+RVLESGSGFAKE+ACVALQALS SKENARAIG RGGISSLLEICQ G+PGSQAFAAGV
Sbjct:   234 LLRVLESGSGFAKEKACVALQALSLSKENARAIGCRGGISSLLEICQGGSPGSQAFAAGV 293

Query:   300 LRNLAGFSEIKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREG 359
             LRNLA F E KENF+EENA+ VL+ +V+SGT+LAQEN  GCL NL S DE L + +VREG
Sbjct:   294 LRNLALFGETKENFVEENAIFVLISMVSSGTSLAQENAVGCLANLTSGDEDLMISVVREG 353

Query:   360 GIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRI 419
             GI  LKS+WDSVS+VKSLEV V LL  LA C  + EV++S+GF+ RLV VL+CGVL VRI
Sbjct:   354 GIQCLKSFWDSVSSVKSLEVGVVLLKNLALCPIVREVVISEGFIPRLVPVLSCGVLGVRI 413

Query:   420 AAARAVSMLGINSKARKEMGECGCIGPLIKMLDGXXXXXXXXXXXXLSTLMLYAGNRKIL 479
             AAA AVS LG +SK+RKEMGE GCI PLI MLDG            LSTL++   NRKI 
Sbjct:   414 AAAEAVSSLGFSSKSRKEMGESGCIVPLIDMLDGKAIEEKEAASKALSTLLVCTSNRKIF 473

Query:   480 RKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEMDI 539
             +K ++G+V++VQLLDP I+ LDK+Y V+ L  LV  +KCRKQ+VAAGACLHL+KLV+MD 
Sbjct:   474 KKSDKGVVSLVQLLDPKIKKLDKRYTVSALELLVTSKKCRKQVVAAGACLHLQKLVDMDT 533

Query:   540 EGANKLLESLGRGKIWGVFARP 561
             EGA KL E+L R KIWGVF RP
Sbjct:   534 EGAKKLAENLSRSKIWGVFTRP 555
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2198235 AT1G01830 "AT1G01830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043709 AT2G45720 "AT2G45720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056529 AT2G05810 "AT2G05810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197654 AT1G61350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130699 AT4G16490 "AT4G16490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178818 AT5G58680 "AT5G58680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 6e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 6e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 6e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 0.002
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.004
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information 
 Score = 45.0 bits (107), Expect = 6e-06
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 2/115 (1%)

Query: 276 GGISSLLEICQAGTPGSQAFAAGVLRNLA-GFSEIKENFIEENAVMVLLGLVASGTALAQ 334
           GG+ +L+ +  +     Q  AA  L NL+ G ++  +  +E   +  L+ L+ S      
Sbjct: 7   GGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVV 66

Query: 335 ENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLAS 389
           +     L NL +  E  KL+++  GG+  L +  DS S     + A   LS LAS
Sbjct: 67  KAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDS-SNEDIQKNATGALSNLAS 120

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 561
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.96
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.94
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
KOG1048717 consensus Neural adherens junction protein Plakoph 99.85
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.8
KOG1048717 consensus Neural adherens junction protein Plakoph 99.79
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.74
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.73
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.7
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.65
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.64
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.6
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.59
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.56
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.54
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.53
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.46
PRK09687280 putative lyase; Provisional 99.42
PRK09687280 putative lyase; Provisional 99.39
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.28
KOG1293 678 consensus Proteins containing armadillo/beta-caten 99.22
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.21
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.2
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.18
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.17
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.16
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.09
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.08
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.08
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.04
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.99
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.97
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.94
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.93
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.91
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.9
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.89
PF05536543 Neurochondrin: Neurochondrin 98.89
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.85
PTZ00429 746 beta-adaptin; Provisional 98.84
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.74
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.73
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.71
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.68
PTZ00429 746 beta-adaptin; Provisional 98.68
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.63
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.54
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.4
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.39
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.34
TIGR02270410 conserved hypothetical protein. Members are found 98.28
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.28
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.25
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.23
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.22
KOG4646173 consensus Uncharacterized conserved protein, conta 98.22
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.18
TIGR02270410 conserved hypothetical protein. Members are found 98.16
KOG4646173 consensus Uncharacterized conserved protein, conta 98.15
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.11
KOG0212 675 consensus Uncharacterized conserved protein [Funct 98.05
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.05
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.98
KOG1242569 consensus Protein containing adaptin N-terminal re 97.94
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.9
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.88
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.85
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.82
PF05536 543 Neurochondrin: Neurochondrin 97.78
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.75
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 97.74
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 97.73
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.73
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.72
KOG1242 569 consensus Protein containing adaptin N-terminal re 97.71
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.68
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.66
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.61
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.6
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 97.59
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 97.54
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 97.52
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.51
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 97.44
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.44
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.41
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.36
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.34
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.33
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.33
COG5369743 Uncharacterized conserved protein [Function unknow 97.18
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.11
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.11
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 97.1
KOG18241233 consensus TATA-binding protein-interacting protein 97.08
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.04
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.03
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.97
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 96.97
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 96.97
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 96.93
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.9
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.83
COG5369743 Uncharacterized conserved protein [Function unknow 96.81
KOG1824 1233 consensus TATA-binding protein-interacting protein 96.8
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 96.76
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.74
KOG3036293 consensus Protein involved in cell differentiation 96.63
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 96.59
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.51
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 96.48
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.41
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 96.37
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.31
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.3
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.25
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.22
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.21
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.18
PF05004309 IFRD: Interferon-related developmental regulator ( 96.11
KOG3036293 consensus Protein involved in cell differentiation 96.09
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 96.07
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.06
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.01
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.97
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.96
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 95.89
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 95.87
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 95.52
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 95.47
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.46
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.45
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 95.25
PF05004309 IFRD: Interferon-related developmental regulator ( 95.21
KOG4535728 consensus HEAT and armadillo repeat-containing pro 95.16
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 95.08
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.06
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 94.95
KOG0567289 consensus HEAT repeat-containing protein [General 94.88
COG5096 757 Vesicle coat complex, various subunits [Intracellu 94.76
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 94.76
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 94.75
PRK14707 2710 hypothetical protein; Provisional 94.67
PRK14707 2710 hypothetical protein; Provisional 94.62
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 94.53
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 94.39
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 94.31
PF07814361 WAPL: Wings apart-like protein regulation of heter 94.3
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 94.23
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 94.12
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.03
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 94.02
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 94.01
KOG0567289 consensus HEAT repeat-containing protein [General 93.96
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 93.93
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.92
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 93.91
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 93.91
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 93.89
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 93.87
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 93.85
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 93.7
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.65
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 93.57
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 93.43
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.34
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 93.34
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 93.14
PF11701157 UNC45-central: Myosin-binding striated muscle asse 93.1
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.07
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 92.95
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 92.94
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 92.53
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 92.3
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 92.24
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 91.73
PF11701157 UNC45-central: Myosin-binding striated muscle asse 91.72
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 91.6
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 91.29
KOG2062 929 consensus 26S proteasome regulatory complex, subun 91.15
KOG4464 532 consensus Signaling protein RIC-8/synembryn (regul 91.13
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 91.04
KOG4653982 consensus Uncharacterized conserved protein [Funct 90.96
COG5209315 RCD1 Uncharacterized protein involved in cell diff 90.89
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 90.74
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 90.7
KOG2025 892 consensus Chromosome condensation complex Condensi 90.39
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 90.33
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 90.22
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 89.55
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 89.5
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 89.43
KOG4535728 consensus HEAT and armadillo repeat-containing pro 89.12
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 89.09
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 88.72
KOG04141251 consensus Chromosome condensation complex Condensi 88.36
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 87.74
KOG4653982 consensus Uncharacterized conserved protein [Funct 87.62
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 86.81
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 86.48
COG5209315 RCD1 Uncharacterized protein involved in cell diff 86.11
KOG22741005 consensus Predicted importin 9 [Intracellular traf 85.67
PF08167165 RIX1: rRNA processing/ribosome biogenesis 85.3
KOG2956516 consensus CLIP-associating protein [General functi 84.35
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 83.4
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 82.71
KOG4464 532 consensus Signaling protein RIC-8/synembryn (regul 82.21
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 81.9
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 80.31
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 80.3
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.4e-37  Score=355.28  Aligned_cols=394  Identities=22%  Similarity=0.253  Sum_probs=339.0

Q ss_pred             HHHHhHHHHHHHhcCC--CHHHHHHHHHHHHHhhccCchhhHHHHh-cCChHHHHHhhcCCCHHHHHHHHHHHHHHhcCC
Q 008560          147 AVRAESRNLITRLQIG--SAESKNSAMDSLLGLLQEDDKNVVIAVA-QGVVPVLVKLMDSSSLEMKEKTVASIARVSMVD  223 (561)
Q Consensus       147 ~~~~~v~~Lv~~L~~~--~~~~~~~Al~~L~~l~~~~~~~~~~i~~-~g~v~~Lv~lL~~~~~~~~e~a~~~L~~La~~~  223 (561)
                      .....+..+++.|+++  +++.|..|+..|+.+++++++||+.+.+ .|+||.|+.+|.++++.+++.|+.+|.+++.++
T Consensus        10 ~~~~~v~~Lve~L~s~~ss~~~~~~Al~~Lr~Lak~~~enR~~Ia~~aGaIP~LV~lL~sg~~~vk~nAaaaL~nLS~~e   89 (2102)
T PLN03200         10 GTLASVAQCIEQLRAKSSSPQEKELTTARLLELAKTREEARKAIGSHSQAMPLLVSLLRSGTLGAKVNAAAVLGVLCKEE   89 (2102)
T ss_pred             chHHHHHHHHHHHHcccCCHHHHHHHHHHHHHHHhcChHHHHHHHHccCcHHHHHHHHcCCCHHHHHHHHHHHHHHhcCH
Confidence            4467889999999977  7899999999999999999999999986 799999999999999999999999999999999


Q ss_pred             cchHHHHHhchhhHHHHHHHHhcCCHHHHHHHHHHHHHhcCCC--c-hHHH-HHhcCCHHHHHHHHhcCCh---HHHHHH
Q 008560          224 SSKHVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSK--E-NARA-IGSRGGISSLLEICQAGTP---GSQAFA  296 (561)
Q Consensus       224 ~~~~~i~~~g~~~i~~Lv~lL~~~~~~~~~~aa~~L~~Ls~~~--~-~~~~-i~~~g~i~~Lv~ll~~~~~---~~~~~A  296 (561)
                      +++..|+..|  ++++|+++|++|+.+.|+.|+++|++|+.++  + ++.. +...|+++.|+.++++++.   ..+..+
T Consensus        90 ~nk~~Iv~~G--aIppLV~LL~sGs~eaKe~AA~AL~sLS~~~~~D~~~~~I~v~~GaVp~Lv~lL~~gsk~d~~L~~~A  167 (2102)
T PLN03200         90 DLRVKVLLGG--CIPPLLSLLKSGSAEAQKAAAEAIYAVSSGGLSDHVGSKIFSTEGVVPSLWDQLQPGNKQDKVVEGLL  167 (2102)
T ss_pred             HHHHHHHHcC--ChHHHHHHHHCCCHHHHHHHHHHHHHHHcCcchhhhhhhhhhhcCChHHHHHHHhCCchhhHHHHHHH
Confidence            9999999999  9999999999999999999999999999874  3 4434 4569999999999998752   345778


Q ss_pred             HHHHHHhhCCchhhH-HHHhhhhHHHHHHHhhcCCHHHHHHHHHHHHHhcCCChHHHHHHHHhCcHHHHHHhhhcCCCHH
Q 008560          297 AGVLRNLAGFSEIKE-NFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVK  375 (561)
Q Consensus       297 ~~aL~nLs~~~~~r~-~i~~~g~v~~Lv~lL~~~~~~~~~~a~~~L~~L~~~~~~~r~~~~~~g~i~~Lv~lL~~~~~~~  375 (561)
                      +.+|+||+...+++. .+++.|+|+.|++++.++++..+.+|+.+|.+++.+.++.+..+++.|+|+.|++++.+++++.
T Consensus       168 v~AL~nLs~~~en~~~~IIeaGaVp~LV~LLsS~d~~lQ~eAa~aLa~Lass~ee~~~aVIeaGaVP~LV~LL~sg~~~~  247 (2102)
T PLN03200        168 TGALRNLCGSTDGFWSATLEAGGVDILVKLLSSGNSDAQANAASLLARLMMAFESSISKVLDAGAVKQLLKLLGQGNEVS  247 (2102)
T ss_pred             HHHHHHHhcCccchHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHcCChHHHHHHHHCCCHHHHHHHHccCCChH
Confidence            899999999998774 5679999999999999999999999999999999887778999999999999999998877778


Q ss_pred             HHHHHHHHHHHhhc-ChhhHHHHHhcchHHHHHHHhcCCC---------HHHHHHHHHHHHHHcCC-HH-----------
Q 008560          376 SLEVAVELLSQLAS-CLPIAEVLVSDGFVVRLVNVLNCGV---------LSVRIAAARAVSMLGIN-SK-----------  433 (561)
Q Consensus       376 ~~e~a~~aL~~L~~-~~~~~~~l~~~~~i~~Lv~lL~~~~---------~~~~~~A~~aL~~L~~~-~~-----------  433 (561)
                      +++.|+++|.+||. +++.+..+++.|+++.|++++...+         ...+++|+++|.|+|.. ..           
T Consensus       248 VRE~AA~AL~nLAs~s~e~r~~Iv~aGgIp~LI~lL~sp~~e~~~~~~~~~Lqe~AvwALsNIcgg~~~ll~~L~~ll~s  327 (2102)
T PLN03200        248 VRAEAAGALEALSSQSKEAKQAIADAGGIPALINATVAPSKEFMQGEFAQALQENAMGALANICGGMSALILYLGELSES  327 (2102)
T ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHCCCHHHHHHHHhCcchhhhccccchHHHHHHHHHHHHHhCCchhhHHHHHHhhcc
Confidence            99999999999998 7889999999999999999997544         34689999999998862 00           


Q ss_pred             H--------------------------------------------------------------------HHHHHhCCChH
Q 008560          434 A--------------------------------------------------------------------RKEMGECGCIG  445 (561)
Q Consensus       434 ~--------------------------------------------------------------------~~~i~~~g~i~  445 (561)
                      .                                                                    ++.+.+.|+++
T Consensus       328 ~rd~~~~ada~gALayll~l~d~~~~~~~~i~~~~v~~~LV~Llr~k~p~~vqe~V~eALasl~gN~~l~~~L~~~daik  407 (2102)
T PLN03200        328 PRSPAPIADTLGALAYALMVFDSSAESTRAFDPTVIEQILVKLLKPRDTKLVQERIIEALASLYGNAYLSRKLNHAEAKK  407 (2102)
T ss_pred             cchHHHHHHHHhhHHHHHHhcCCchhhhhhccccccHHHHHHHhCCCCCchhHHHHHHHHHHhcCChHHHHHHHhccchh
Confidence            0                                                                    01122335566


Q ss_pred             HHHHhccCCCHHHHHHHHHHHHHhhccccchhhHhhcCCCHHHHHHhccCCccchhhHHHHHHHHHhc-CCchHHHHHHH
Q 008560          446 PLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALV-HCRKCRKQMVA  524 (561)
Q Consensus       446 ~Lv~ll~~~~~~v~~~A~~aL~~L~~~~~~~~~~~~~~~~i~~Lv~lL~~~~~~~~k~~a~~~L~~La-~~~~~r~~i~~  524 (561)
                      .|+.|+...+.++|..++.+|++|+.+..+....+.+.++++.|+++|.++.. ..++.++.+|.+++ ++++.+..|++
T Consensus       408 ~LV~LL~~~~~evQ~~Av~aL~~L~~~~~e~~~aIi~~ggIp~LV~LL~s~s~-~iQ~~A~~~L~nLa~~ndenr~aIie  486 (2102)
T PLN03200        408 VLVGLITMATADVQEELIRALSSLCCGKGGLWEALGGREGVQLLISLLGLSSE-QQQEYAVALLAILTDEVDESKWAITA  486 (2102)
T ss_pred             hhhhhhccCCHHHHHHHHHHHHHHhCCCHHHHHHHHHcCcHHHHHHHHcCCCH-HHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            66777776777899999999999997755555555677999999999987543 45778999999998 67788999999


Q ss_pred             cCchHHHHHhhccCccchH
Q 008560          525 AGACLHLRKLVEMDIEGAN  543 (561)
Q Consensus       525 ~g~i~~L~~Ll~~~~~~ak  543 (561)
                      +|++++|++|+.++++..+
T Consensus       487 aGaIP~LV~LL~s~~~~iq  505 (2102)
T PLN03200        487 AGGIPPLVQLLETGSQKAK  505 (2102)
T ss_pred             CCCHHHHHHHHcCCCHHHH
Confidence            9999999999998877665

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-44
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-42
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-38
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-32
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 9e-42
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-39
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-36
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-31
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-41
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-38
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-32
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-19
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-09
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 6e-28
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-16
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-15
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 8e-12
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-27
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-25
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-22
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-12
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-26
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-26
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-25
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-21
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 8e-24
3nmz_A458 APC variant protein; protein-protein complex, arma 8e-22
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-21
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-19
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-17
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-14
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 7e-20
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-19
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-15
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-11
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-11
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-10
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-09
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-17
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-14
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-14
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 5e-08
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-15
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-11
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-06
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-06
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-10
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-08
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-06
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 1e-04
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 6e-04
3grl_A 651 General vesicular transport factor P115; vesicle t 3e-04
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
 Score =  165 bits (420), Expect = 2e-44
 Identities = 68/363 (18%), Positives = 135/363 (37%), Gaps = 11/363 (3%)

Query: 181 DDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHL 240
           + ++    +A   +P L KL++     +  K    + ++S  ++S+H ++    ++ + +
Sbjct: 4   NYQDDAE-LATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMV-SAI 61

Query: 241 IRVLESGSGFAKERACV-ALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGV 299
           +R +++ +     R     L  LS  +E   AI   GGI +L+++  +       +A   
Sbjct: 62  VRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITT 121

Query: 300 LRNLAGFSE-IKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVRE 358
           L NL    E  K        +  ++ L+             CL  L   ++  KL+I+  
Sbjct: 122 LHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILAS 181

Query: 359 GGIGSLKSYWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVR 418
           GG  +L +   + +  K L     +L  L+ C      +V  G +  L   L      + 
Sbjct: 182 GGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLV 241

Query: 419 IAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKI 478
                 +    ++  A K+ G  G +G L+++L    +     AA  LS L       K+
Sbjct: 242 QNCLWTLR--NLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKM 299

Query: 479 LRKDERGIVTVVQLLDPLIQNLDKKYPVA-ILAALVHC----RKCRKQMVAAGACLHLRK 533
           +     GI  +V+ +       D   P    L  L          +  +        + K
Sbjct: 300 MVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVK 359

Query: 534 LVE 536
           L+ 
Sbjct: 360 LLH 362
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.98
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.93
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.93
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.91
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.85
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.84
3grl_A 651 General vesicular transport factor P115; vesicle t 99.73
3grl_A651 General vesicular transport factor P115; vesicle t 99.67
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.5
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.43
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.42
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.41
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.41
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.38
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.35
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.27
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.26
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.24
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.22
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.2
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.19
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.15
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.05
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.99
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.97
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.96
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.95
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.92
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.88
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.87
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.85
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.82
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.81
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 98.78
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.77
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.76
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.71
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.69
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.57
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.55
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.47
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.36
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.29
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.24
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.21
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.19
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.17
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.11
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.07
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.06
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.05
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.05
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.04
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.01
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.98
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.91
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.9
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.85
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.82
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.82
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.58
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.5
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.18
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.13
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 96.97
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.54
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.18
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.07
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 95.88
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 95.82
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.82
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.79
1z6u_A150 NP95-like ring finger protein isoform B; structura 95.19
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.08
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.81
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.35
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 94.3
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 94.29
2x1g_F971 Cadmus; transport protein, developmental protein, 94.17
2x19_B963 Importin-13; nuclear transport, protein transport; 94.13
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 94.1
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 93.85
2ecw_A85 Tripartite motif-containing protein 30; metal bind 93.6
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 93.52
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 93.35
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 93.16
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 93.1
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 92.71
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 92.49
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 92.25
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 92.13
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 92.13
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 92.03
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 91.43
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 91.32
2x1g_F 971 Cadmus; transport protein, developmental protein, 91.25
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 91.21
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 90.86
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 89.88
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 89.28
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 88.95
2x19_B 963 Importin-13; nuclear transport, protein transport; 88.94
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 87.62
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 87.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 86.65
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 86.58
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 85.86
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 85.52
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 85.49
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 85.29
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 83.2
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 82.76
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 82.23
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 81.39
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 81.15
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 80.9
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 80.52
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
Probab=100.00  E-value=4.6e-37  Score=330.46  Aligned_cols=375  Identities=19%  Similarity=0.157  Sum_probs=317.7

Q ss_pred             HhHHHHHHHhcCCCHHHHHHHHHHHHHhhccCchhhHHHHhcCChHHHHHhhcCCCHHHHHHHHHHHHHHhcC--CcchH
Q 008560          150 AESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMV--DSSKH  227 (561)
Q Consensus       150 ~~v~~Lv~~L~~~~~~~~~~Al~~L~~l~~~~~~~~~~i~~~g~v~~Lv~lL~~~~~~~~e~a~~~L~~La~~--~~~~~  227 (561)
                      ..++.++..|++++++.|..|+..|.+++.++++++..|++.|+||+|+.+|+++++++|+.|+.+|.+|+..  ++++.
T Consensus        48 ~~i~~LV~~L~s~~~~~q~~Aa~~L~~La~~~~~~k~~V~~~G~Ip~LV~LL~s~~~~vq~~Aa~AL~nLa~~~~~~nk~  127 (584)
T 3l6x_A           48 PELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKI  127 (584)
T ss_dssp             CCHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHHHHHTSSSCHHHHH
T ss_pred             ccHHHHHHHHCCCCHHHHHHHHHHHHHHHcCChHHHHHHHHcCCcHHHHHHHCCCCHHHHHHHHHHHHHHHccCCHHHHH
Confidence            4689999999999999999999999999999999999999999999999999999999999999999999984  78999


Q ss_pred             HHHHhchhhHHHHHHHHhc-CCHHHHHHHHHHHHHhcCCCchHHHHHhcCCHHHHHHHHh------------------cC
Q 008560          228 VLIAEGLLLLNHLIRVLES-GSGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQ------------------AG  288 (561)
Q Consensus       228 ~i~~~g~~~i~~Lv~lL~~-~~~~~~~~aa~~L~~Ls~~~~~~~~i~~~g~i~~Lv~ll~------------------~~  288 (561)
                      .|++.|  ++++|+++|.+ ++.++++.++.+|++|+.+++++..|++ ++++.|++++.                  ..
T Consensus       128 ~I~~~G--aIp~LV~LL~s~~~~~~~e~aa~aL~nLS~~~~~k~~I~~-~alp~Lv~LL~~p~sg~~~~~~~~~k~~~~~  204 (584)
T 3l6x_A          128 AIKNCD--GVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVD-HALHALTDEVIIPHSGWEREPNEDCKPRHIE  204 (584)
T ss_dssp             HHHHTT--HHHHHHHHHHHCCSHHHHHHHHHHHHHHTTSGGGHHHHHH-HTHHHHHHHTHHHHHCCC----------CCC
T ss_pred             HHHHcC--CHHHHHHHHcCCCCHHHHHHHHHHHHHHhCCchhhHHHHh-ccHHHHHHHHhcccccccccccccccccccc
Confidence            999999  99999999998 5889999999999999999999999985 57999999872                  12


Q ss_pred             ChHHHHHHHHHHHHhhCCc-hhhHHHHhh-hhHHHHHHHhhc------CCHHHHHHHHHHHHHhcCCChH-------HH-
Q 008560          289 TPGSQAFAAGVLRNLAGFS-EIKENFIEE-NAVMVLLGLVAS------GTALAQENVFGCLCNLVSDDES-------LK-  352 (561)
Q Consensus       289 ~~~~~~~A~~aL~nLs~~~-~~r~~i~~~-g~v~~Lv~lL~~------~~~~~~~~a~~~L~~L~~~~~~-------~r-  352 (561)
                      ++.+++.|+++|+||+... ++|..+++. |+++.|+.++.+      .+...+++|+.+|.||+...+.       +. 
T Consensus       205 d~~V~~nAa~~L~NLs~~~~~~R~~i~~~~Gli~~LV~~L~~~~~~~~~~~~~~enav~aL~NLs~~~~~e~~~~~~~~~  284 (584)
T 3l6x_A          205 WESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQE  284 (584)
T ss_dssp             CHHHHHHHHHHHHHHTSSCHHHHHHHHHSTTHHHHHHHHHHHHHHTTCCSCHHHHHHHHHHHHHHTTHHHHSTTCCC---
T ss_pred             cHHHHHHHHHHHHHHhcCCHHHHHHHHHcCCcHHHHHHHHHHhhcccCccHHHHHHHHHHHHHhhccccccccchhhhhh
Confidence            4688899999999999987 569999874 677899999975      3457899999999999975210       00 


Q ss_pred             -----------------HHHHHhCcHHHHHHhhhcCCCHHHHHHHHHHHHHhhcCh-----hhHHHHHhcchHHHHHHHh
Q 008560          353 -----------------LLIVREGGIGSLKSYWDSVSAVKSLEVAVELLSQLASCL-----PIAEVLVSDGFVVRLVNVL  410 (561)
Q Consensus       353 -----------------~~~~~~g~i~~Lv~lL~~~~~~~~~e~a~~aL~~L~~~~-----~~~~~l~~~~~i~~Lv~lL  410 (561)
                                       ..+.+.++++.|+.++..+..+.+++.|+++|.|||.+.     ..+..+.+.++++.|+++|
T Consensus       285 ~~~~~~~~~~~~~~~Gve~L~~~~~v~~Ll~LL~~s~~~~v~E~Aa~AL~nL~ag~~~~~~~~~~~v~~~~glp~Lv~LL  364 (584)
T 3l6x_A          285 AAPNVANNTGTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLL  364 (584)
T ss_dssp             -----------CCCCGGGGGGSHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSSCSHHHHHHHHHHTSHHHHHHHHHGG
T ss_pred             hcccccccccccCchhHHHHhcccHHHHHHHHHccCCCHHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCcHHHHHHHH
Confidence                             111223456788999987667899999999999998642     2233444568999999999


Q ss_pred             cCCCHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHHhccCC--------CHHHHHHHHHHHHHhhc-cccchhhHhh
Q 008560          411 NCGVLSVRIAAARAVSMLGINSKARKEMGECGCIGPLIKMLDGK--------AVEEKESAAKALSTLML-YAGNRKILRK  481 (561)
Q Consensus       411 ~~~~~~~~~~A~~aL~~L~~~~~~~~~i~~~g~i~~Lv~ll~~~--------~~~v~~~A~~aL~~L~~-~~~~~~~~~~  481 (561)
                      .+++..+++.|+++|.+|+.++.++..| ..|+++.|+.+|...        +.+++..|+.+|.||+. +..+++.+ .
T Consensus       365 ~s~~~~v~~~A~~aL~nLs~~~~~~~~I-~~g~ip~LV~LL~~~~~~~~~~~s~~v~~~a~~tL~NL~a~~~~~~~~I-~  442 (584)
T 3l6x_A          365 TNEHERVVKAASGALRNLAVDARNKELI-GKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKL-R  442 (584)
T ss_dssp             GCSCHHHHHHHHHHHHHHHTTCSCHHHH-HHHHHHHHHHTSSSSSCSGGGTCCHHHHHHHHHHHHHHHTTCHHHHHHH-H
T ss_pred             cCCCHHHHHHHHHHHHHHhCChhHHHHH-HhCCHHHHHHHhcCCcccccccchHHHHHHHHHHHHHHhcCCHHHHHHH-H
Confidence            9999999999999999999987777766 679999999999865        46788999999999975 56666666 5


Q ss_pred             cCCCHHHHHHhccCC-ccchhhHHHHHHHHHhcCCchHHHHHHHcCchH
Q 008560          482 DERGIVTVVQLLDPL-IQNLDKKYPVAILAALVHCRKCRKQMVAAGACL  529 (561)
Q Consensus       482 ~~~~i~~Lv~lL~~~-~~~~~k~~a~~~L~~La~~~~~r~~i~~~g~i~  529 (561)
                      +.++|+.|+++|..+ .....++.|..+|.+|..+++.|+.+-++|.-+
T Consensus       443 ~~g~I~~Lv~LL~s~~~~~~v~k~Aa~vL~nl~~~~elr~~~kk~G~~~  491 (584)
T 3l6x_A          443 ETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKK  491 (584)
T ss_dssp             HTTHHHHHHHHHTCSSSCHHHHHHHHHHHHHHHTSHHHHHHHHTTTCCG
T ss_pred             HCCChHHHHHHHhCCCCChHHHHHHHHHHHHHHcCHHHHHHHHHcCCCH
Confidence            679999999999774 344567889999999999999999999987654
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 561
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 7e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-12
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-08
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-06
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-05
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 9e-12
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-11
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-09
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 7e-09
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-07
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-11
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 4e-09
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 0.001
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 0.001
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.8 bits (166), Expect = 7e-13
 Identities = 68/344 (19%), Positives = 128/344 (37%), Gaps = 5/344 (1%)

Query: 189 VAQGVVPVLVKLMDSSSLEMKEKTVASIARVSMVDSSKHVLIAEGLLLLNHLIRVLE-SG 247
           +A   +P L KL++     +  K    + ++S  ++S+H ++     +++ ++R ++ + 
Sbjct: 14  LATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSP-QMVSAIVRTMQNTN 72

Query: 248 SGFAKERACVALQALSFSKENARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAGFS 307
                      L  LS  +E   AI   GGI +L+++  +       +A   L NL    
Sbjct: 73  DVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQ 132

Query: 308 E-IKENFIEENAVMVLLGLVASGTALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKS 366
           E  K        +  ++ L+             CL  L   ++  KL+I+  GG  +L +
Sbjct: 133 EGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVN 192

Query: 367 YWDSVSAVKSLEVAVELLSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVS 426
              + +  K L     +L  L+ C      +V  G +  L   L      +       + 
Sbjct: 193 IMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLR 252

Query: 427 MLGINSKARKEMGECGCIGPLIKMLDGKAVEEKESAAKALSTLMLYAGNRKILRKDERGI 486
            L  +  A K+ G  G +G L+++L    +     AA  LS L       K++     GI
Sbjct: 253 NL--SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGI 310

Query: 487 VTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLH 530
             +V+ +       D   P       +  R    +M      LH
Sbjct: 311 EALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLH 354
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.98
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.97
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.96
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.94
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.8
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.77
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.26
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.2
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.17
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.99
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.94
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.94
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.74
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.66
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.63
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.62
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.61
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.52
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.48
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.39
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.39
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.28
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.91
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.79
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.79
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.52
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.42
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.14
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 95.85
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 95.5
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 95.04
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 94.75
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 94.5
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 94.33
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 93.84
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 89.83
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 89.05
d2bnxa1 343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 87.53
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 86.21
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.3e-32  Score=290.76  Aligned_cols=386  Identities=20%  Similarity=0.166  Sum_probs=330.8

Q ss_pred             HHhHHHHHHHhcCCCHHHHHHHHHHHHHhhccCchhhHHHHh-cCChHHHHHhhcC-CCHHHHHHHHHHHHHHhcCCcch
Q 008560          149 RAESRNLITRLQIGSAESKNSAMDSLLGLLQEDDKNVVIAVA-QGVVPVLVKLMDS-SSLEMKEKTVASIARVSMVDSSK  226 (561)
Q Consensus       149 ~~~v~~Lv~~L~~~~~~~~~~Al~~L~~l~~~~~~~~~~i~~-~g~v~~Lv~lL~~-~~~~~~e~a~~~L~~La~~~~~~  226 (561)
                      ...|+.|++.|++++.+.+..|+..+..++..+. .+..++. .|+|+.|+.+|.. .++++++.|+.+|.+++.+++.+
T Consensus        16 ~~aip~L~~lL~~~~~~v~~~A~~~l~~l~~~~~-~~~~~~~~~~~v~~l~~~L~~~~~~~~~~~a~~~L~~l~~~~~~~   94 (529)
T d1jdha_          16 TRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEA-SRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGL   94 (529)
T ss_dssp             -CHHHHHHHHHTCSCHHHHHHHHHHHHHHHTSHH-HHHHHHTCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHTTSHHHH
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhccH-HHHHHHHhhhHHHHHHHHHcCCCCHHHHHHHHHHHHHHhCCchhH
Confidence            4568999999999999999999999999986544 4444444 5889999999965 56899999999999999999999


Q ss_pred             HHHHHhchhhHHHHHHHHhcCCHHHHHHHHHHHHHhcCCCc-hHHHHHhcCCHHHHHHHHhcCChHHHHHHHHHHHHhhC
Q 008560          227 HVLIAEGLLLLNHLIRVLESGSGFAKERACVALQALSFSKE-NARAIGSRGGISSLLEICQAGTPGSQAFAAGVLRNLAG  305 (561)
Q Consensus       227 ~~i~~~g~~~i~~Lv~lL~~~~~~~~~~aa~~L~~Ls~~~~-~~~~i~~~g~i~~Lv~ll~~~~~~~~~~A~~aL~nLs~  305 (561)
                      ..+++.|  ++++|+.+|++++.+++..|+++|.+|+.+.+ .+..+...|+++.|+.++.++++..+..++.+|.+++.
T Consensus        95 ~~i~~~g--~i~~Li~lL~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~~~~~~a~~~L~~l~~  172 (529)
T d1jdha_          95 LAIFKSG--GIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAY  172 (529)
T ss_dssp             HHHHHTT--HHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCTTHHHHHHHHTHHHHHHHGGGCCCHHHHHHHHHHHHHHHT
T ss_pred             HHHHHCC--CHHHHHHHhCCCCHHHHHHHHHHHHHhhcccchhhhHHHhcCCchHHHHHHHccChHHHHHHHHHHHHHhh
Confidence            9999999  99999999999999999999999999998654 66778889999999999999999999999999999997


Q ss_pred             Cc-hhhHHHHhhhhHHHHHHHhhcCC-HHHHHHHHHHHHHhcCCChHHHHHHHHhCcHHHHHHhhhcCCCHHHHHHHHHH
Q 008560          306 FS-EIKENFIEENAVMVLLGLVASGT-ALAQENVFGCLCNLVSDDESLKLLIVREGGIGSLKSYWDSVSAVKSLEVAVEL  383 (561)
Q Consensus       306 ~~-~~r~~i~~~g~v~~Lv~lL~~~~-~~~~~~a~~~L~~L~~~~~~~r~~~~~~g~i~~Lv~lL~~~~~~~~~e~a~~a  383 (561)
                      .+ +.+..+.+.|+++.|+.++...+ ..++..++.++.+++... .++..+++.|+++.|++++.+++ .+++..++.+
T Consensus       173 ~~~~~~~~~~~~~~~~~L~~ll~~~~~~~~~~~~~~~l~~ls~~~-~~~~~~~~~g~~~~L~~ll~~~~-~~~~~~a~~~  250 (529)
T d1jdha_         173 GNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCS-SNKPAIVEAGGMQALGLHLTDPS-QRLVQNCLWT  250 (529)
T ss_dssp             TCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHTTST-THHHHHHHTTHHHHHHTTTTSSC-HHHHHHHHHH
T ss_pred             hhhHHHHHHHhcccchHHHHHHHhhhhHHHHHHHHHHHhhhhccc-cccchhhhhhhhhhHHHHhcccc-hhhhhhhhhH
Confidence            66 67788889999999999997554 578999999999998755 47889999999999999998765 4899999999


Q ss_pred             HHHhhcChhhHHHHHhcchHHHHHHHhcCCCHHHHHHHHHHHHHHcC-CHHHHHHHHhCCChHHHHHhcc--CCCHHHHH
Q 008560          384 LSQLASCLPIAEVLVSDGFVVRLVNVLNCGVLSVRIAAARAVSMLGI-NSKARKEMGECGCIGPLIKMLD--GKAVEEKE  460 (561)
Q Consensus       384 L~~L~~~~~~~~~l~~~~~i~~Lv~lL~~~~~~~~~~A~~aL~~L~~-~~~~~~~i~~~g~i~~Lv~ll~--~~~~~v~~  460 (561)
                      |.+++.....  .....|+++.|++++.+++..+++.|+.+|++++. +++++..+.+.|+++.|+.++.  ...+.+++
T Consensus       251 l~~ls~~~~~--~~~~~~~i~~Lv~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~Li~~l~~~~~~~~~~~  328 (529)
T d1jdha_         251 LRNLSDAATK--QEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITE  328 (529)
T ss_dssp             HHHHHTTCTT--CSCCHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTTTCHHHHHHHHHTTHHHHHHHHHHHHTTCHHHHH
T ss_pred             HHhccccccc--hhhhhhcchhhhhhcccccHHHHHHHHHHHHhhccchhHHHHHHHHhhhHHHHHHHHHhhhcchhHHH
Confidence            9999863322  11224789999999999999999999999999997 6788999999999999999885  56788999


Q ss_pred             HHHHHHHHhhccccch---hhHhhcCCCHHHHHHhccCCccchhhHHHHHHHHHhcCCchHHHHHHHcCchHHHHHhhcc
Q 008560          461 SAAKALSTLMLYAGNR---KILRKDERGIVTVVQLLDPLIQNLDKKYPVAILAALVHCRKCRKQMVAAGACLHLRKLVEM  537 (561)
Q Consensus       461 ~A~~aL~~L~~~~~~~---~~~~~~~~~i~~Lv~lL~~~~~~~~k~~a~~~L~~La~~~~~r~~i~~~g~i~~L~~Ll~~  537 (561)
                      .|..+|.+|+......   .......++++.|+.+|.+.......+.+++++.+++.+++.+..+.++|+++.|.+++..
T Consensus       329 ~a~~aL~~l~~~~~~~~~~~~~i~~~~~l~~L~~ll~~~~~~~~~~~~~~~l~~l~~~~~~~~~l~~~g~i~~L~~lL~~  408 (529)
T d1jdha_         329 PAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVR  408 (529)
T ss_dssp             HHHHHHHHHTSSSTTHHHHHHHHHHTTCHHHHHHTTSTTCCHHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHH
T ss_pred             HHHHHhhcccchhhcchhhhhhHHhcccchhHHHHHhccchHHHHHHHHHHHhhcchhhhhhhhhhhcccHHHHHHHHhc
Confidence            9999999999655432   2223456899999999987654445667889999999999999999999999999999976


Q ss_pred             Cccc
Q 008560          538 DIEG  541 (561)
Q Consensus       538 ~~~~  541 (561)
                      ..++
T Consensus       409 ~~~~  412 (529)
T d1jdha_         409 AHQD  412 (529)
T ss_dssp             HHHH
T ss_pred             CCHH
Confidence            5443
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure