Citrus Sinensis ID: 008573

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MKPEADLESDRKAMPEIEAAVDGDGDSNRSFNESNSTTQKAETTNKKQNDDAEGEEEKEQKMKPEPDVENDPVQNRTESGPDREDRDWSSNGKLNENGNGTGNVKEETDEDNDKTASEGKVESVKNKTSAVGGLSESNELWDESKREGKQSSDVQSSASLSRNKRRRSGEEPYDEEVSPATKKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDMLRKQQPIAVTKPKPKPKPEHHRQQPQPPPASLSKPNRGSTMVVCGKRSSIKAISKNAYGKKGDRKDREVEEKPKVNEKKVDSSFVGIEDKGIKKKRSQERSVSLRRNSRSSSRSGDVKHQFGGNELSSHDTLEAKTENKKENAVKKKKLGAASFLKRMKQNSPSEVMEDDDEEEDENDNDNDDDDSGDDSKDSKVEEEKKRRSVTRRDVNRVTRSSRGRGVREENRRRGVGRPPKRSASGAMSPPEKTSGKRGRDNGESEVGGGGRSRKRTRR
ccccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccHHHHHHHHHHHHccccccccccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHccHHHHHHHHHccccccccccccHHHHccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHccccccccccccHHHccHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEcccccHHHcccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mkpeadlesdrkampeieaavdgdgdsnrsfnesnsttqkaettnkkqnddaegeeekeqkmkpepdvendpvqnrtesgpdredrdwssngklnengngtgnvkeetdedndktasegkvesvknktsavgglsesnelwdeskregkqssdvqssaslsrnkrrrsgeepydeevspATKKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQsrldrglysnCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDMLRKqqpiavtkpkpkpkpehhrqqpqpppaslskpnrgstmvvcgkrssikaisknaygkkgdrkdreveekpkvnekkvdssfvgiedkgikkkrsQERSVslrrnsrsssrsgdvkhqfggnelsshdtleakTENKKENAVKKKKLGAASFLKRmkqnspsevmedddeeedendndnddddsgddskdskveeekkrrsvtrrdvnrvtrssrgrgvreenrrrgvgrppkrsasgamsppektsgkrgrdngesevggggrsrkrtrr
mkpeadlesdrkampeieaavdgdgdsnrsfnesnsttqkaettnkkqnddaegeeekeqkmkpepdvendpvqnrtesgpdredrdwssngklnengngtgnvkeetdedndktasegkvesvknktsavgglsesnelwdeskregkqssdvqssaslsrnkrrrsgeepydeevspatkkvlavkseplVRFLGmirshrlsshferrlrsqeserykklvrqhidlrtiqsrldrgLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDMLRKQQPIAVTKPKPKPkpehhrqqpqpppaslskpnrGSTMVvcgkrssikaisknaygkkgdrkdreveekpkvnekkvdssfvgiedkgikkkrsqersvslrrnsrsssrsgdvkhqfggnelsshdtleaktenkkenavkkkklgaasflkrmkqnspsevmedddeeedendndnddddsgddskdskveeekkrrsvtrrdvnrvtrssrgrgvreenrrrgvgrppkrsasgamsppektsgkrgrdngesevggggrsrkrtrr
MKPEADLESDRKAMPEIEAAVDGDGDSNRSFNESNSTTQKAETTNKKQNDDAegeeekeqkmkpePDVENDPVQNRTESGPDREDRDWSSNGKLNENGNGTGNVKEETDEDNDKTASEGKVESVKNKTSAVGGLSESNELWDESKREGKQssdvqssaslsRNKRRRSGEEPYDEEVSPATKKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKffrdllllfnnfviffRKSSQEYAAAQELRTLVIKEMTDMLRKQQPIAVTkpkpkpkpehhrqqpqpppASLSKPNRGSTMVVCGKRSSIKAISKNAYGKKGDRKDReveekpkvnekkvDSSFVGIEDKGIKKKRSQErsvslrrnsrsssrsGDVKHQFGGNELSSHDtleaktenkkenavkkkklGAASFLKRMKQNSPSEVMedddeeedendndnddddsgddskdskveeekKRRSVTRRDvnrvtrssrgrgvreenrrrgvgrPPKRSASGAMSPPEKTSGKRgrdngesevggggrsrkrtrr
****************************************************************************************************************************************************************************************LAVKSEPLVRFLGMIRSH*****************YKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEM************************************************************************************************************************************************************************************************************************************************************************************
**********************************************************************************************************************************************************************************************PLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEM************************************************************************************************************************************************************************************************************************************************************************************
***********KAMPEIEAAVDGDGD**************************************************************SSNGKLNENGNGTGN*****************************************************************************TKKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDMLRKQQPIAV**********************************CGKRSSIKAISK*********************EKKVDSSFVGIEDKG***************************HQFGGNELSSHDTLEAKTENKKENAVKKKKLGAASFLKR********************************************************************************************************************
*************************************************************************************************************************************************************************************KKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDMLRKQ***********************************TM****KR**********************************************************************************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPEADLESDRKAMPEIEAAVDGDGDSNRSFNESNSTTQKAETTNKKQNDDAEGEEEKEQKMKPEPDVENDPVQNRTESGPDREDRDWSSNGKLNENGNGTGNVKEETDEDNDKTASEGKVESVKNKTSAVGGLSESNELWDESKREGKQSSDVQSSASLSRNKRRRSGEEPYDEEVSPATKKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDMLRKQQPIAVTKPKPKPKPEHHRQQPQPPPASLSKPNRGSTMVVCGKRSSIKAISKNAYGKKGDRKDREVEEKPKVNEKKVDSSFVGIEDKGIKKKRSQERSVSLRRNSRSSSRSGDVKHQFGGNELSSHDTLEAKTENKKENAVKKKKLGAASFLKRMKQNSPSEVMEDDDEEEDENDNDNDDDDSGDDSKDSKVEEEKKRRSVTRRDVNRVTRSSRGRGVREENRRRGVGRPPKRSASGAMSPPEKTSGKRGRDNGESEVGGGGRSRKRTRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query561 2.2.26 [Sep-21-2011]
Q9H0E91235 Bromodomain-containing pr yes no 0.165 0.075 0.319 1e-07
Q8R3B7951 Bromodomain-containing pr no no 0.160 0.094 0.263 0.0002
A8DZJ11441 Tyrosine-protein kinase B N/A no 0.212 0.082 0.268 0.0005
>sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 192  LVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFR 251
            L+    MI SHR SS F + +  +++  YK +V++ +DL +++  L +G      Q F R
Sbjct: 1112 LLPVWKMIASHRFSSPFLKPVSERQAPGYKDVVKRPMDLTSLKRNLSKGRIRTMAQ-FLR 1170

Query: 252  DLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEM 285
            DL+L+F N V++       Y  A E+R  V++++
Sbjct: 1171 DLMLMFQNAVMYNDSDHHVYHMAVEMRQEVLEQI 1204
May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Homo sapiens (taxid: 9606)
>sp|Q8R3B7|BRD8_MOUSE Bromodomain-containing protein 8 OS=Mus musculus GN=Brd8 PE=1 SV=2 Back     alignment and function description
>sp|A8DZJ1|BAZ1B_XENLA Tyrosine-protein kinase BAZ1B OS=Xenopus laevis GN=baz1b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
255544738 674 DNA binding protein, putative [Ricinus c 0.907 0.755 0.515 1e-117
224073218385 bromodomain protein [Populus trichocarpa 0.573 0.836 0.531 1e-84
449448952 673 PREDICTED: uncharacterized protein LOC10 0.723 0.603 0.432 6e-70
224053014251 hypothetical protein POPTRDRAFT_547688 [ 0.392 0.876 0.567 7e-64
225450325 686 PREDICTED: uncharacterized protein LOC10 0.777 0.635 0.386 6e-54
297741222583 unnamed protein product [Vitis vinifera] 0.575 0.554 0.410 4e-47
449436657 703 PREDICTED: uncharacterized protein LOC10 0.693 0.553 0.365 1e-38
449519334 688 PREDICTED: uncharacterized protein LOC10 0.666 0.543 0.367 4e-38
356555278 746 PREDICTED: uncharacterized protein LOC10 0.684 0.514 0.342 2e-33
297820594629 predicted protein [Arabidopsis lyrata su 0.550 0.491 0.359 5e-33
>gi|255544738|ref|XP_002513430.1| DNA binding protein, putative [Ricinus communis] gi|223547338|gb|EEF48833.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 309/600 (51%), Positives = 394/600 (65%), Gaps = 91/600 (15%)

Query: 1   MKPEADLESDRKAMPEIEAAVDGDGDS-----NRSFNESNST-TQKAETTN-KKQNDDAE 53
            K EADL S+RK      +   GD DS     +RSFNESNST  QKAETT  ++QNDD +
Sbjct: 127 FKEEADLISERKFSIAGNSTAGGD-DSVDERDSRSFNESNSTGQQKAETTMVRQQNDDVD 185

Query: 54  GEEEKEQKMKPEP-DVENDPVQNRTESGPDREDRDWSSNGKLNENGNG---TGNVKEETD 109
               ++QK+K +P D EN   Q+   SG D         G  ++NGN       VK+E++
Sbjct: 186 ----RQQKIKVKPNDSENKNEQDPVPSGSD--------PGGSHKNGNDKKPLAMVKKESE 233

Query: 110 EDNDKTASEGKVESVKNKTSAVGGLSESNELWD---ESKRE-------GKQSSDVQSSAS 159
               +T            T   GG  ESNE+ +   ESKRE        + +SDVQSS S
Sbjct: 234 IKTSQT------------TGGFGG--ESNEVGESVGESKREERDKEKEKQNNSDVQSSIS 279

Query: 160 LSRNKRRR-------------SGEEPYD-EEVSPATKKVLAVKSEPLVRFLGMIRSHRLS 205
           LS+NK++R             SGEEP   +EVSPA      VKSEPLV+ LG+IRSHRL 
Sbjct: 280 LSQNKKKRRGSSGGGDRVGSSSGEEPEGGDEVSPA------VKSEPLVKLLGIIRSHRLG 333

Query: 206 SHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFR 265
           S FERRLRSQESERYK L+RQHIDL+TIQSRLD+G+YS+C QKFFRDLLLLFNN +IFFR
Sbjct: 334 STFERRLRSQESERYKNLIRQHIDLQTIQSRLDKGVYSSCIQKFFRDLLLLFNNAIIFFR 393

Query: 266 KSSQEYAAAQELRTLVIKEMTDMLRKQQPIAVTKPKPKPKPEHHRQQPQPPPASLSKPNR 325
           K+S E  AA ELR +V KEMT+ LRK +   VT      KPE     P+    S SKPN+
Sbjct: 394 KNSPENLAACELRAVVQKEMTEKLRKLKTEPVT-----AKPE-----PKQTAVSFSKPNK 443

Query: 326 -GSTMVVCGKRSSIKAISKNAYGKKGDRKDREVEEKPKVNEKKVDSSFVGIEDKGIKKKR 384
             ST+VVCGK +S KAI +N   KKGD+K+REVEEK K+NE+++D SFV IE+K I+KKR
Sbjct: 444 SSSTIVVCGKGNSKKAIPENDI-KKGDKKEREVEEKIKLNERQID-SFVKIEEKSIRKKR 501

Query: 385 SQERSVSLRRNSRSSSRSGDVKHQFGGNELSSHDTLEAKTENKKENAVKKKKLGAASFLK 444
           +++RS+S  R+S +S+++G+VKHQ+GGNELSSHD LE K E K + +  +KK GAASFLK
Sbjct: 502 TKDRSISNHRSSNTSNKNGEVKHQYGGNELSSHDALEMKVERKGKGSTARKKQGAASFLK 561

Query: 445 RMKQNSPSEVMEDDDEEEDENDNDNDDDDSGDDSKDSKVEEEKKRR--SVTRRDVNRVTR 502
           RMKQNSPSEV E+DDE+ D++++++  ++   + KDSK +EEK RR   +      RVTR
Sbjct: 562 RMKQNSPSEVPENDDEDYDDDNDNDSSEED--EKKDSKGKEEKGRRRGKIIDGMTERVTR 619

Query: 503 SSRGRGVREENR-RRGVGRPPKRSASGAMSPPEKTSGKRGRDNGESEVGGGGRSRKRTRR 561
           SSRGRG RE  R +RGVGRPP++ A    S     +GKRGR+NG SEV   GR+RKR++R
Sbjct: 620 SSRGRGARENGRGKRGVGRPPRKQAERGESGG--GTGKRGRENGGSEV---GRTRKRSKR 674

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224073218|ref|XP_002304028.1| bromodomain protein [Populus trichocarpa] gi|222841460|gb|EEE79007.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449448952|ref|XP_004142229.1| PREDICTED: uncharacterized protein LOC101213195 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224053014|ref|XP_002297664.1| hypothetical protein POPTRDRAFT_547688 [Populus trichocarpa] gi|222844922|gb|EEE82469.1| hypothetical protein POPTRDRAFT_547688 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225450325|ref|XP_002268328.1| PREDICTED: uncharacterized protein LOC100263099 [Vitis vinifera] gi|147768907|emb|CAN75881.1| hypothetical protein VITISV_024454 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741222|emb|CBI32173.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436657|ref|XP_004136109.1| PREDICTED: uncharacterized protein LOC101208443 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449519334|ref|XP_004166690.1| PREDICTED: uncharacterized protein LOC101228284 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356555278|ref|XP_003545961.1| PREDICTED: uncharacterized protein LOC100779988 [Glycine max] Back     alignment and taxonomy information
>gi|297820594|ref|XP_002878180.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324018|gb|EFH54439.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
TAIR|locus:2101477641 AT3G60110 [Arabidopsis thalian 0.376 0.329 0.318 3.6e-18
TAIR|locus:2050574646 AT2G44430 [Arabidopsis thalian 0.484 0.421 0.296 6e-18
TAIR|locus:2095878632 AT3G57980 [Arabidopsis thalian 0.566 0.503 0.244 4.2e-17
TAIR|locus:2060040631 AT2G42150 [Arabidopsis thalian 0.472 0.419 0.255 1.3e-15
TAIR|locus:1006230673475 BRD4 "AT1G61215" [Arabidopsis 0.192 0.227 0.327 6.6e-06
TAIR|locus:2101477 AT3G60110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 231 (86.4 bits), Expect = 3.6e-18, Sum P(3) = 3.6e-18
 Identities = 73/229 (31%), Positives = 108/229 (47%)

Query:    66 PDVEND---PVQ-NRTESGPDREDRDWSSNGKLNENGNGTGNVKEETDEDN---DKTASE 118
             PD++ND   PV+ NR  +  DR+D     N  +NE+ N T +V +  D D    DK    
Sbjct:   177 PDLKNDETKPVRVNRETTESDRDD-----NRSMNES-NSTASVDKIADHDRLDGDKMVKA 230

Query:   119 GKVESVKNKTSAVGGLSESNELWDE--SKREGKQXXXXXXXXXXXRNKRRRSGEEPYDEE 176
                E+ +N        +E+ E  +   SKR                   +R G++ Y   
Sbjct:   231 N--ENSRNPDPDPVNKAETPEEEERTVSKRSEMSNSGELDESGTSNCLGKRKGQK-YRSG 287

Query:   177 VSPATKKVLAVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSR 236
                   K    KS+PL+  + +IRSH   S FE RLRSQ+++ YK+L+RQH+D++TI+ +
Sbjct:   288 GGGGGVKSAGDKSQPLIDIIKLIRSHPRGSVFESRLRSQDTKDYKRLIRQHLDMKTIEKK 347

Query:   237 LDRGLYSNCFQKXXXXXXXXXXXXXXXXRKSSQEYAAAQELRTLVIKEM 285
             +++G Y +                      SS E  AAQELRTLV  EM
Sbjct:   348 MEKGSYVSSSLSFYRDLKLLFTNAIVFFPTSSSESIAAQELRTLVSNEM 396
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2050574 AT2G44430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095878 AT3G57980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060040 AT2G42150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230673 BRD4 "AT1G61215" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
smart00297107 smart00297, BROMO, bromo domain 5e-17
cd0436999 cd04369, Bromodomain, Bromodomain 4e-15
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-12
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 4e-09
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 4e-08
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 9e-07
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 7e-06
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-05
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 1e-04
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 2e-04
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 3e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 8e-04
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 0.001
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 0.002
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 0.002
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 0.003
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.004
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information 
 Score = 76.5 bits (189), Expect = 5e-17
 Identities = 28/100 (28%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 189 SEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQK 248
            E L   L  + SH LS  F + +  +E+  Y  ++++ +DL+TI+ +L+ G YS+  ++
Sbjct: 9   QELLKAVLDKLDSHPLSWPFLKPVSRKEAPDYYDIIKKPMDLKTIKKKLENGKYSS-VEE 67

Query: 249 FFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDM 288
           F  D  L+F+N   +    S+ Y  A++L     K++ ++
Sbjct: 68  FVADFNLMFSNARTYNGPDSEVYKDAKKLEKFFEKKLREL 107

Length = 107
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 561
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.94
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.94
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.94
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.93
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.93
KOG1474640 consensus Transcription initiation factor TFIID, s 99.93
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.93
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.92
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.92
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.92
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.92
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.91
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.91
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.91
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.91
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.91
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.91
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.91
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.91
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.91
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.91
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.91
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.89
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.89
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.89
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.89
smart00297107 BROMO bromo domain. 99.88
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.88
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.88
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.88
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.88
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.86
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.86
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.85
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.84
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.82
COG5076371 Transcription factor involved in chromatin remodel 99.71
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.71
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.71
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.54
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.25
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 99.04
KOG00081563 consensus Transcription initiation factor TFIID, s 99.02
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.92
KOG00081563 consensus Transcription initiation factor TFIID, s 98.88
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.84
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.8
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.67
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 98.63
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.36
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.07
COG5076371 Transcription factor involved in chromatin remodel 97.54
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 96.57
KOG06441113 consensus Uncharacterized conserved protein, conta 89.37
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 88.04
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information 
Probab=99.94  E-value=1.2e-26  Score=204.29  Aligned_cols=103  Identities=23%  Similarity=0.424  Sum_probs=98.0

Q ss_pred             cccchHHHHHHHHHHhC-cCCccccCCCCcc--cCCccccccCCCCCHHHHHHHHhCCCCCCcHHHHHHHHHHHHHHHhh
Q 008573          186 AVKSEPLVRFLGMIRSH-RLSSHFERRLRSQ--ESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVI  262 (561)
Q Consensus       186 ~~~sepLlkILe~L~sh-k~S~pF~ePVd~q--e~PDYydIIK~PMDLsTIKkKLe~G~YsS~~~EF~rDLrLIFsNA~~  262 (561)
                      ....+.|+.||+.|..+ +.+|+|..||++.  ++|+||+||++||||+||++||.+|.|.++. +|+.||+|||.||+.
T Consensus         2 ~~l~~~~~~il~~l~~~~~~s~~F~~PV~~~~~~~pdY~~iIk~PmDL~tI~~kL~~~~Y~s~~-ef~~D~~li~~Na~~   80 (108)
T cd05495           2 EELRQALMPTLEKLYKQDPESLPFRQPVDPKLLGIPDYFDIVKNPMDLSTIRRKLDTGQYQDPW-QYVDDVWLMFDNAWL   80 (108)
T ss_pred             HHHHHHHHHHHHHHHHcCcccchhcCCCCccccCCCcHHHHhCCCCCHHHHHHHHhcCCCCCHH-HHHHHHHHHHHHHHH
Confidence            34567899999999999 9999999999986  7999999999999999999999999999999 999999999999999


Q ss_pred             cCCCCCHHHHHHHHHHHHHHHHHHHHh
Q 008573          263 FFRKSSQEYAAAQELRTLVIKEMTDML  289 (561)
Q Consensus       263 YN~~gS~VykaA~~Lr~lfek~mkk~l  289 (561)
                      ||+++|.+|.+|..|+.+|+++|..++
T Consensus        81 yN~~~s~i~~~a~~l~~~F~~~~~~~~  107 (108)
T cd05495          81 YNRKTSRVYKYCTKLAEVFEQEIDPVM  107 (108)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHh
Confidence            999999999999999999999998876

Cbp (CREB binding protein or CREBBP) is an acetyltransferase acting on histone, which gives a specific tag for transcriptional activation and also acetylates non-histone proteins. CREBBP binds specifically to phosphorylated CREB protein and augments the activity of phosphorylated CREB to activate transcription of cAMP-responsive genes. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 7e-11
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-10
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-10
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-09
4alg_A154 Bromodomain-containing protein 2; signaling protei 1e-09
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-09
3rcw_A135 Bromodomain-containing protein 1; transcription, s 3e-09
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 3e-09
2r0y_A311 Chromatin structure-remodeling complex protein RSC 4e-09
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2dat_A123 Possible global transcription activator SNF2L2; br 1e-08
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-08
2grc_A129 Probable global transcription activator SNF2L4; br 2e-08
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-08
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-08
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-06
3d7c_A112 General control of amino acid synthesis protein 5; 1e-07
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 3e-07
2d9e_A121 Peregrin; four-helix bundle, transcription activat 3e-07
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-07
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 4e-07
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 1e-06
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 1e-06
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 3e-06
3nxb_A116 CAT eye syndrome critical region protein 2; struct 1e-06
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-06
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-06
3p1f_A119 CREB-binding protein; structural genomics consorti 5e-06
3uv4_A158 Second bromodomain of human transcription initiat 6e-06
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 9e-06
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 1e-05
3fkm_X166 Signaling protein; bromodomain, malaria, structura 2e-05
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 3e-05
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 3e-05
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 1e-04
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
 Score = 58.9 bits (143), Expect = 7e-11
 Identities = 17/94 (18%), Positives = 36/94 (38%), Gaps = 1/94 (1%)

Query: 202 HRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFV 261
             L++        +++  Y + +   +DL TI+ ++  G Y    + F  D+L +F N  
Sbjct: 30  QALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKT-VEAFDADMLKVFRNAE 88

Query: 262 IFFRKSSQEYAAAQELRTLVIKEMTDMLRKQQPI 295
            ++ + S        LR        +   +   I
Sbjct: 89  KYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEI 122
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.94
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.94
3d7c_A112 General control of amino acid synthesis protein 5; 99.94
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.94
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.94
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.94
2dat_A123 Possible global transcription activator SNF2L2; br 99.94
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.94
3p1f_A119 CREB-binding protein; structural genomics consorti 99.93
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.93
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.93
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.93
2grc_A129 Probable global transcription activator SNF2L4; br 99.93
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.93
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.93
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.93
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.93
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.93
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.93
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.92
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.92
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.92
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.91
3uv4_A158 Second bromodomain of human transcription initiat 99.91
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.91
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.91
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.9
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.89
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.88
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.88
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.87
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.86
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.86
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.86
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.86
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.8
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.79
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.71
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.55
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
Probab=99.94  E-value=3.1e-27  Score=207.25  Aligned_cols=104  Identities=24%  Similarity=0.323  Sum_probs=99.8

Q ss_pred             cccchHHHHHHHHHHhCcCCccccCCCCcccCCccccccCCCCCHHHHHHHHhCCCCCCcHHHHHHHHHHHHHHHhhcCC
Q 008573          186 AVKSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFR  265 (561)
Q Consensus       186 ~~~sepLlkILe~L~shk~S~pF~ePVd~qe~PDYydIIK~PMDLsTIKkKLe~G~YsS~~~EF~rDLrLIFsNA~~YN~  265 (561)
                      ......|..||..|..|+.+|+|..||+...+|+||++|++||||+||+.||..+.|.++. +|..||+|||.||+.||+
T Consensus        12 ~~~~~~c~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~-~f~~D~~li~~Na~~yN~   90 (117)
T 3g0l_A           12 SKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLE-TFALDVRLVFDNCETFNE   90 (117)
T ss_dssp             TTHHHHHHHHHHHHHTSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHH-HHHHHHHHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHHHhCCCchhhcCcCChhhcCChHHHcCCCCCHHHHHHHHhCCCCCCHH-HHHHHHHHHHHHHHHHCC
Confidence            3456789999999999999999999999999999999999999999999999999999999 999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHhh
Q 008573          266 KSSQEYAAAQELRTLVIKEMTDMLR  290 (561)
Q Consensus       266 ~gS~VykaA~~Lr~lfek~mkk~lp  290 (561)
                      ++|.+|.+|..|+.+|+++|..++.
T Consensus        91 ~~s~~~~~A~~L~~~f~~~~~~~~~  115 (117)
T 3g0l_A           91 DDSDIGRAGHNMRKYFEKKWTDTFK  115 (117)
T ss_dssp             SSSHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHc
Confidence            9999999999999999999999874
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 561
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 7e-11
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 6e-10
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 2e-09
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 7e-08
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 57.3 bits (138), Expect = 7e-11
 Identities = 19/97 (19%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 192 LVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFR 251
           +   L  +++H  +  F + +  +E   Y   +++ +DL T++ +L+   Y      F  
Sbjct: 8   IQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMED-FIY 66

Query: 252 DLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDM 288
           D  L+FNN  ++  +++  Y  A  L      ++ ++
Sbjct: 67  DARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEI 103
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.93
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.93
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.93
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.93
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.92
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=4.4e-27  Score=200.56  Aligned_cols=98  Identities=23%  Similarity=0.321  Sum_probs=94.4

Q ss_pred             chHHHHHHHHHHhCcCCccccCCCCcccCCccccccCCCCCHHHHHHHHhCCCCCCcHHHHHHHHHHHHHHHhhcCCCCC
Q 008573          189 SEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSS  268 (561)
Q Consensus       189 sepLlkILe~L~shk~S~pF~ePVd~qe~PDYydIIK~PMDLsTIKkKLe~G~YsS~~~EF~rDLrLIFsNA~~YN~~gS  268 (561)
                      .+.|..||..|..|+.++||+.||+..++|+||++|++||||+||+.||.++.|.++. +|.+||+|||.||+.||+++|
T Consensus         4 ~~~l~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~-~f~~D~~li~~Na~~yN~~~s   82 (102)
T d3d7ca1           4 YTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRK-LFVADLQRVIANCREYNPPDS   82 (102)
T ss_dssp             HHHHHHHHHHHHHSGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHH-HHHHHHHHHHHHHHHHSCTTS
T ss_pred             HHHHHHHHHHHHhCCCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHH-HHHHHHHHHHHHHHHHCCCCC
Confidence            3568899999999999999999999999999999999999999999999999999999 999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 008573          269 QEYAAAQELRTLVIKEMTD  287 (561)
Q Consensus       269 ~VykaA~~Lr~lfek~mkk  287 (561)
                      .+|.+|..|+++|+++|++
T Consensus        83 ~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          83 EYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            9999999999999998874
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure