Citrus Sinensis ID: 008630

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56

MNQIQLQKQQAVEENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEELTKKTEEVEEGRKLQEQLLQQIDFKSSEITKNKQEFEKEKQLLLDKVRGLEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVEEESDSLTHRRNPIPFPDKHSDASAAYCEINKVKKEVGLSDNLDNEKKAKSVQTSSFHSSSSGFIVTEKCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDTPFENIRGNLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPVRKKVERENLKGVECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRYKYIPPLTPEGFWNIGFESEM

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHcHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccc

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHcccccHHHHHHHHHHcccccccccccccccccccHcccccccccEEcccccccccccEccccccc

MNQIQLQKQQAVEENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEELTKKTEEVEEGRKLQEQLLQQIDFKSSEITKNKQEFEKEKQLLLDKVRGLEEKANELKKNFCeksskqgwgmdsnDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKfglttdkmtsehkveeesdslthrrnpipfpdkhsdasaAYCEINKVKkevglsdnldnekkaksvqtssfhssssgfivtekcpsnvksapiagtkrpasswretrsrqyeggpdphddfldtpfenIRGNLNKVmkedvhdrpdpaakdmnldssddetqdmnidtgrqrqqnpvptagkqgfkyvePVRKKVerenlkgveckqckkfydavlpsdggkesdgskktlrcehhegvsrhrykyippltpegfwnigfesem

mnqiqlqkqqaveenktlkfdkAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEEltkkteeveegrkLQEQLLQQIdfksseitknkqefekEKQLLLDKVRGLEEKANElkknfceksskqgwgmdsndKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFglttdkmtseHKVEeesdslthrrnpIPFPDKHSDASAAYCEINKVKKevglsdnldnekkaksvqtssfhssssgfivtekcpsnvksapiagtkrpasswretrsrqyeggpdphddflDTPFENIRGNLNKVMKEDVHDRPDPAakdmnldssddeTQDMNidtgrqrqqnpvptagkqgfkyvepvrkkverenlkgveckqckkfydavlpsdggkesdgskktlrcehhegvsrhrykyippltpegfwNIGFESEM

MNQIQLQKQQAVEENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQeeltkkteeveeGRKLQEQLLQQIDFKSSEITKNKQEFEKEKQLLLDKVRGLEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVEEESDSLTHRRNPIPFPDKHSDASAAYCEINKVKKEVGLSDNLDNEKKAKsvqtssfhssssGFIVTEKCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDTPFENIRGNLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPVRKKVERENLKGVECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRYKYIPPLTPEGFWNIGFESEM

***********************************************************************I*************************************************************LFKKIEKLSLDISHY*****************F*V************************************************************************************************************DVIDAYKRLKSQYNYICAKFGLTT************************************C************************************************************************************************************************************************YV**********NLKGVECKQCKKFYDAVL**********************VSRHRYKYIPPLTPEGFWNIGF****

***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************KGVECKQCKKFYDAVLP*********************VSRHRYKYIPPLTPEGFWNIGFES**

************EENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEEN******************RKLQEQLLQQIDFKSSEITKNKQEFEKEKQLLLDKVRGLEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDK***************HRRNPIPFPDKHSDASAAYCEINKVKKEVGLSDNLDN******************FIVTEKCPSNVKSA**********************GPDPHDDFLDTPFENIRGNLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPVRKKVERENLKGVECKQCKKFYDAVLPS************LRCEHHEGVSRHRYKYIPPLTPEGFWNIGFESEM

MNQIQLQKQQAVEENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEELTKKTEEVEEGRKLQEQLLQQIDFKSSEITKNKQEFEKEKQLLLDKVRGLEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVEEESDSLTHRRNPIPFPDKHSDASAAYCEINKVKKE*********************************************************************DFLDTPFENIRGNLN***********************************************KQGFKYVEPVRKKVERENLKGVECKQCKKFYDAVLPS*********************SRHRYKYIPPLTPEGFWNIGFE***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNQIQLQxxxxxxxxxxxxxxxxxxxxxQEEKTGQLLVKxxxxxxxxxxxxxxxxxxxxxxxxxxxxQKGLIQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTENLFKKxxxxxxxxxxxxxxxxxxxxxKKCFLTKxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEQLLQQIDFKSSEITKNxxxxxxxxxxxxxxxxxxxxxxxxxxxxFCEKSSKQGWGMDSxxxxxxxxxxxxxxxxxxxxxRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVEEESDSLTHRRNPIPFPDKHSDASAAYCEINKVKKEVGLSDNLDNEKKAKSVQTSSFHSSSSGFIVTEKCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDTPFENIRGNLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPVRKKVERENLKGVECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRYKYIPPLTPEGFWNIGFESEM

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		559	2.2.26 [Sep-21-2011]
Q9ZRT1		588	Protein gamma response 1	yes	no	0.887	0.843	0.394	2e-84
F1R983		651	DNA endonuclease RBBP8 OS	yes	no	0.121	0.104	0.5	4e-12
Q80YR6		893	DNA endonuclease RBBP8 OS	yes	no	0.121	0.076	0.462	2e-11
Q99708		897	DNA endonuclease RBBP8 OS	yes	no	0.121	0.075	0.45	3e-11
F6SNN2		867	DNA endonuclease RBBP8 OS	no	no	0.118	0.076	0.461	7e-11
Q6GNV6		856	DNA endonuclease RBBP8 OS	N/A	no	0.118	0.077	0.448	1e-10
B1WC58		893	DNA endonuclease RBBP8 OS	yes	no	0.121	0.076	0.45	3e-10

>sp\|Q9ZRT1\|GR1_ARATH Protein gamma response 1 OS=Arabidopsis thaliana GN=GR1 PE=1 SV=2	Back alignment and function desciption

 Score =  313 bits (803), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 218/553 (39%), Positives = 316/553 (57%), Gaps = 57/553 (10%)

Query: 14  ENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQ 73
           EN+ +K DK KL +E   KT  + ++L S +  I+ LK++++ +SK V   +++   L++
Sbjct: 86  ENQQIKSDKEKLAEELG-KTASMPLRLTSLQGYIDHLKKKMKSRSKMVGDARDLYYRLVE 144

Query: 74  LAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEEVAREKELTEN 133
           L Q K  +        E  E+    +++E+ S K   + LQ +L  KT        +TEN
Sbjct: 145 LLQVKGLD--------ELSEDGINMIVSEVKSLKMKTEFLQEELSKKTL-------VTEN 189

Query: 134 LFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEELTKKTEEVEEGRKL 193
           L KK+E LS + +  ++ L+  ++EK+   T+ +VFEENV RL+E L +KT+EVEEG+  
Sbjct: 190 LLKKLEYLSTEAADGERKLSSVEEEKQRLKTRLQVFEENVGRLEEILRQKTDEVEEGKTA 249

Query: 194 QEQLLQQIDFKSSEITKNKQEF---EKEKQLLLDKVRGLEEKANELKKNFCEKSSKQGWG 250
            E L  ++     E+   KQ+    EKEK +++ K +              +   + G  
Sbjct: 250 LEVLQGKLKLTEREMLNCKQKIADHEKEKTVVMGKAKD-------------DMQGRHGSY 296

Query: 251 MDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVE 310
           +   + L  + E+K+ EL  E KK +++    K+ KSQ+ ++C +F  T D +  +  +E
Sbjct: 297 LADLEALRCQSEEKSFELAMEIKKNKELSRTCKKWKSQHTFLCKRFNFTPDSVLHQSSLE 356

Query: 311 EESDSLT-HRRNPIP--FPDKHSDASAAYCEINKVKKEVGLS-DNLDNEKKAKSVQTSSF 366
           +E+  +  H ++ I      KHS+ +      +KV+   G S +N + E   K+VQT   
Sbjct: 357 DENKEIGQHEKSAISSYLERKHSETAEG---ADKVRIGTGSSGNNYEKESIIKTVQTPI- 412

Query: 367 HSSSSGFIVTEKCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDTPFENIRG 426
             +S   IV  + P   K   ++G KRPAS WR+TRSRQ  GG DPHDDFLDTP EN++ 
Sbjct: 413 --TSISPIV--RSPGAAKPPQLSGLKRPASIWRDTRSRQSPGGHDPHDDFLDTPIENVK- 467

Query: 427 NLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPV 486
              +V  E+ H   D A KD     SDDETQDMN      RQ+  +    K+ FK+VE V
Sbjct: 468 ---RVAGEEKHVH-DVAKKD----DSDDETQDMNPKPSPSRQRIQIAETSKKSFKHVESV 519

Query: 487 RKKVERENLKGVECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRYKYIPPLT 546
           RKK ERENLKG+ECKQCKKFYDAV P + G       K+LRCEHHEGVSRHRY+Y PP+T
Sbjct: 520 RKKAERENLKGIECKQCKKFYDAVHPENEG----NGNKSLRCEHHEGVSRHRYRYAPPMT 575

Query: 547 PEGFWNIGFESEM 559
           PEGFWNIGFESEM
Sbjct: 576 PEGFWNIGFESEM 588

Seems to mediate cell cycle arrest before mitosis in response to DNA damage. Is probably also involved in the transition from mitosis to endoreduplication.
Arabidopsis thaliana (taxid: 3702)

>sp\|F1R983\|COM1_DANRE DNA endonuclease RBBP8 OS=Danio rerio GN=rbbp8 PE=2 SV=1	Back alignment and function description

>sp\|Q80YR6\|COM1_MOUSE DNA endonuclease RBBP8 OS=Mus musculus GN=Rbbp8 PE=1 SV=1	Back alignment and function description

>sp\|Q99708\|COM1_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens GN=RBBP8 PE=1 SV=2	Back alignment and function description

>sp\|F6SNN2\|COM1_XENTR DNA endonuclease RBBP8 OS=Xenopus tropicalis GN=rbbp8 PE=3 SV=1	Back alignment and function description

>sp\|Q6GNV6\|COM1_XENLA DNA endonuclease RBBP8 OS=Xenopus laevis GN=rbbp8 PE=1 SV=1	Back alignment and function description

>sp\|B1WC58\|COM1_RAT DNA endonuclease RBBP8 OS=Rattus norvegicus GN=Rbbp8 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		559
359487354		640	PREDICTED: protein gamma response 1-like	0.982	0.857	0.542	1e-158
255544236		632	retinoblastoma binding protein, putative	0.955	0.844	0.499	1e-140
449489189		660	PREDICTED: protein gamma response 1-like	0.980	0.830	0.485	1e-137
449436667		661	PREDICTED: protein gamma response 1-like	0.980	0.829	0.488	1e-136
224055251		629	predicted protein [Populus trichocarpa]	0.966	0.858	0.501	1e-136
297736223		645	unnamed protein product [Vitis vinifera]	0.735	0.637	0.527	1e-121
297816486		1114	hypothetical protein ARALYDRAFT_323761 [	0.915	0.459	0.401	1e-83
30693587		588	protein gamma response 1 [Arabidopsis th	0.887	0.843	0.394	1e-82
4049403		589	gamma response I protein [Arabidopsis th	0.889	0.843	0.392	2e-82
4678941		1110	gamma response I protein [Arabidopsis th	0.887	0.446	0.392	1e-81

>gi\|359487354\|ref\|XP_003633574.1\| PREDICTED: protein gamma response 1-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 304/560 (54%), Positives = 400/560 (71%), Gaps = 11/560 (1%)

Query: 4   IQLQKQQAVEENKTLKFDKAKLLQEQEEKTGQLLVKLESQRCEINELKQELEFKSKEVEG 63
           ++L+KQQA+ EN++LK +KA LL+E+EEKT  LL KL+S   E+  LK+EL  KSKEV+ 
Sbjct: 88  LKLEKQQALGENQSLKLEKATLLEEKEEKTNPLLTKLQSLEKEVGVLKRELLQKSKEVDE 147

Query: 64  VKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAKTEE 123
             E+Q  LIQL + K+  I  K  QL+E EEK   ++A+L S +K VDELQ++L  KTEE
Sbjct: 148 GMELQNKLIQLIEKKSSAILTKGKQLKEQEEKKSEVVAKLQSLEKKVDELQQKLKEKTEE 207

Query: 124 VAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEELTKK 183
           + + KEL ENLFKKIE     +   + LL D +KE K  + + +  ++N   LQ EL K+
Sbjct: 208 IVKGKELQENLFKKIESQDSKMMSNQFLLNDHEKEMKLLIDQIKHLKKNADELQTELQKR 267

Query: 184 TEEVEEGRKLQEQLLQQIDFKSSEITKNK---QEFEKEKQLLLDKVRGLEEKANELKKNF 240
            EEV EGRKLQE LL+QID     + KN+   +E EK++++LL K++GLEE+ NEL+   
Sbjct: 268 NEEVVEGRKLQEHLLKQIDLNGLNMLKNERQLEEHEKKEKMLLTKIKGLEERVNELQVEI 327

Query: 241 CEKSSKQGWGMDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTT 300
             KS++   G + +   LQ+IE K++EL++EKKKRRDV+ AYK+LKSQYN++ +K GLTT
Sbjct: 328 NGKSNEVTDGGEWHQNFLQQIELKSSELLSEKKKRRDVVAAYKKLKSQYNFLSSKLGLTT 387

Query: 301 DKMTSEHKVEEESDSLTHRRNPIPFPDKHSDASAAYCEINKVKKEVGLSDNLDNEKKAKS 360
           + + +  K+EEE+DSL H  N IP      + SAA CE NK K  V   +NLD+ K+   
Sbjct: 388 ENVLTPVKIEEENDSLMHH-NTIP------ETSAAACEANKQKNVVSFPENLDSVKRVGL 440

Query: 361 VQTSSFHSSSSGFIVTE-KCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDT 419
           +Q+SS  S SS       KC +N+ S+ +AGTKRP+SSWR+TRSRQ +GG DPHDDFLDT
Sbjct: 441 IQSSSCQSPSSSGSAGASKCTTNLNSSSLAGTKRPSSSWRDTRSRQCQGGADPHDDFLDT 500

Query: 420 PFENIRGNLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQG 479
           P ENI+GNLNK  KE+ HD P    KDMN DSSDDETQD+N++  +Q+Q  P P  G + 
Sbjct: 501 PLENIKGNLNKAKKEEYHDLPVAIPKDMNFDSSDDETQDVNVEPSQQKQPMPAPKPGTRV 560

Query: 480 FKYVEPVRKKVERENLKGVECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRY 539
           FKYVEPVR K ERENL+G+ECKQCKKFYDAVLP DG K++DG+K+  RCEHHEGVSRHRY
Sbjct: 561 FKYVEPVRTKAERENLQGIECKQCKKFYDAVLPKDGNKDTDGNKRNFRCEHHEGVSRHRY 620

Query: 540 KYIPPLTPEGFWNIGFESEM 559
           +Y+PP+TPEGFWNIGF+SEM
Sbjct: 621 RYVPPMTPEGFWNIGFDSEM 640

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255544236\|ref\|XP_002513180.1\| retinoblastoma binding protein, putative [Ricinus communis] gi\|223547678\|gb\|EEF49171.1\| retinoblastoma binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449489189\|ref\|XP_004158241.1\| PREDICTED: protein gamma response 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449436667\|ref\|XP_004136114.1\| PREDICTED: protein gamma response 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224055251\|ref\|XP_002298444.1\| predicted protein [Populus trichocarpa] gi\|222845702\|gb\|EEE83249.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297736223\|emb\|CBI24861.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297816486\|ref\|XP_002876126.1\| hypothetical protein ARALYDRAFT_323761 [Arabidopsis lyrata subsp. lyrata] gi\|297321964\|gb\|EFH52385.1\| hypothetical protein ARALYDRAFT_323761 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|30693587\|ref\|NP_850683.1\| protein gamma response 1 [Arabidopsis thaliana] gi\|259016242\|sp\|Q9ZRT1.2\|GR1_ARATH RecName: Full=Protein gamma response 1; AltName: Full=COM1/SAE2-like protein; AltName: Full=Protein gamma response I gi\|115345801\|gb\|ABI95360.1\| COM1/SAE2-like protein [Arabidopsis thaliana] gi\|332645374\|gb\|AEE78895.1\| protein gamma response 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|4049403\|emb\|CAA10484.1\| gamma response I protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|4678941\|emb\|CAB41332.1\| gamma response I protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		559
TAIR\|locus:1005716561		588	GR1 "gamma response gene 1" [A	0.903	0.858	0.360	7.2e-68
ZFIN\|ZDB-GENE-050220-14		651	rbbp8 "retinoblastoma binding	0.262	0.225	0.319	3e-14
DICTYBASE\|DDB_G0271058		1528	vilC "villin-like protein C" [	0.584	0.214	0.290	8.1e-13
UNIPROTKB\|F6SNN2		867	rbbp8 "DNA endonuclease RBBP8"	0.137	0.088	0.426	2.7e-11
GENEDB_PFALCIPARUM\|PF11_0486		2055	PF11_0486 "MAEBL, putative" [P	0.572	0.155	0.277	1.8e-10
UNIPROTKB\|Q8IHP3		2055	PF11_0486 "MAEBL, putative" [P	0.572	0.155	0.277	1.8e-10
MGI\|MGI:2442995		893	Rbbp8 "retinoblastoma binding	0.237	0.148	0.333	5.3e-11
UNIPROTKB\|E1BUP9		2803	CENPF "Uncharacterized protein	0.538	0.107	0.248	1.5e-10
UNIPROTKB\|E1C703		2810	CENPF "Uncharacterized protein	0.538	0.107	0.248	1.5e-10
UNIPROTKB\|E1C2F1		908	RBBP8 "Uncharacterized protein	0.118	0.072	0.448	2.8e-10

TAIR\|locus:1005716561 GR1 "gamma response gene 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 689 (247.6 bits), Expect = 7.2e-68, P = 7.2e-68
 Identities = 196/544 (36%), Positives = 278/544 (51%)

Query:    30 EEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQL 89
             +++   LL ++E  + E  ++K + E  ++E+     M   L  L Q     +KKK    
Sbjct:    70 KDREKSLLDQIEELKVENQQIKSDKEKLAEELGKTASMPLRLTSL-QGYIDHLKKKMKSR 128

Query:    90 EEHEEKTKTL---IAELNSHKKIVDELQRQ-LGAKTEEVAREKELTENLFKKIEKLSLDI 145
              +     + L   + EL   K + DEL    +     EV   K  TE L +++ K +L  
Sbjct:   129 SKMVGDARDLYYRLVELLQVKGL-DELSEDGINMIVSEVKSLKMKTEFLQEELSKKTLVT 187

Query:   146 SHYKQLLADEKKEKKCFLTKFEVFEENVSRLQXXXXXXXXXXXXGRKLQEQLLQQIDF-- 203
              +  + L     E      K    EE   RL+            GR L+E L Q+ D   
Sbjct:   188 ENLLKKLEYLSTEAADGERKLSSVEEEKQRLKTRLQVFEENV--GR-LEEILRQKTDEVE 244

Query:   204 --KSS-EITKNKQEF-EKEKQLLLDKVRGLE-EKANELKKNFCEKSSKQGWGMDSNDKLL 258
               K++ E+ + K +  E+E      K+   E EK   + K   +   + G  +   + L 
Sbjct:   245 EGKTALEVLQGKLKLTEREMLNCKQKIADHEKEKTVVMGKAKDDMQGRHGSYLADLEALR 304

Query:   259 QEIEQKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVEEESDSL-T 317
              + E+K+ EL  E KK +++    K+ KSQ+ ++C +F  T D +  +  +E+E+  +  
Sbjct:   305 CQSEEKSFELAMEIKKNKELSRTCKKWKSQHTFLCKRFNFTPDSVLHQSSLEDENKEIGQ 364

Query:   318 HRRNPIP--FPDKHSDASAAYCEINKVKKEVGLSDNLDNEKKAKXXXXXXXXXXXXGFIV 375
             H ++ I      KHS+ +      +KV+   G S N  N +K                IV
Sbjct:   365 HEKSAISSYLERKHSETAEG---ADKVRIGTGSSGN--NYEKESIIKTVQTPITSISPIV 419

Query:   376 TEKCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDTPFENIRGNLNKVMKED 435
               + P   K   ++G KRPAS WR+TRSRQ  GG DPHDDFLDTP EN++    +V  E+
Sbjct:   420 --RSPGAAKPPQLSGLKRPASIWRDTRSRQSPGGHDPHDDFLDTPIENVK----RVAGEE 473

Query:   436 VHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPVRKKVERENL 495
              H   D A KD     SDDETQDMN      RQ+  +    K+ FK+VE VRKK ERENL
Sbjct:   474 KHVH-DVAKKD----DSDDETQDMNPKPSPSRQRIQIAETSKKSFKHVESVRKKAERENL 528

Query:   496 KGVECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRYKYIPPLTPEGFWNIGF 555
             KG+ECKQCKKFYDAV P +   E +G+K +LRCEHHEGVSRHRY+Y PP+TPEGFWNIGF
Sbjct:   529 KGIECKQCKKFYDAVHPEN---EGNGNK-SLRCEHHEGVSRHRYRYAPPMTPEGFWNIGF 584

Query:   556 ESEM 559
             ESEM
Sbjct:   585 ESEM 588

GO:0005634 "nucleus" evidence=ISM

GO:0006974 "response to DNA damage stimulus" evidence=IEP

GO:0010212 "response to ionizing radiation" evidence=IEP

GO:0000706 "meiotic DNA double-strand break processing" evidence=IGI

GO:0007276 "gamete generation" evidence=IMP

ZFIN\|ZDB-GENE-050220-14 rbbp8 "retinoblastoma binding protein 8" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0271058 vilC "villin-like protein C" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F6SNN2 rbbp8 "DNA endonuclease RBBP8" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF11_0486 PF11_0486 "MAEBL, putative" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IHP3 PF11_0486 "MAEBL, putative" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

MGI\|MGI:2442995 Rbbp8 "retinoblastoma binding protein 8" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BUP9 CENPF "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C703 CENPF "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C2F1 RBBP8 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9ZRT1	GR1_ARATH	No assigned EC number	0.3942	0.8872	0.8435	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00008839001	SubName- Full=Chromosome chr13 scaffold_210, whole genome shotgun sequence; (636 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		559
pfam08573		93	pfam08573, SAE2, DNA repair protein endonuclease S	4e-15
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-09
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	8e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-08
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-08
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	1e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	3e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	5e-07
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	5e-06
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	5e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-05
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	4e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	4e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	5e-05
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	6e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	7e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	8e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	1e-04
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	1e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-04
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	3e-04
PRK05771		646	PRK05771, PRK05771, V-type ATP synthase subunit I;	4e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	6e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-04
COG0610		962	COG0610, COG0610, Type I site-specific restriction	8e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.001
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.001
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.001
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.001
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	0.001
TIGR03319		514	TIGR03319, RNase_Y, ribonuclease Y	0.002
PHA02562		562	PHA02562, 46, endonuclease subunit; Provisional	0.002
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.003
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.003
COG1269		660	COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su	0.004

>gnl\|CDD\|192074 pfam08573, SAE2, DNA repair protein endonuclease SAE2/CtIP C-terminus	Back alignment and domain information

 Score = 70.6 bits (173), Expect = 4e-15
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 16/93 (17%)

Query: 481 KYVEPVRKKVERENLKG---VECKQCKKFYDAVLPSDGGKESDGSKKTLRCEHHEGV--- 534
            + E VRKK ER+ LKG     CK+C KFY+A+   +    +  +  T++ E  E +   
Sbjct: 1   AFDEVVRKKDERKCLKGCTRPSCKKCGKFYEALARLEEKNGNFHNLPTMKAEEREELLKE 60

Query: 535 ----------SRHRYKYIPPLTPEGFWNIGFES 557
                     SRHR+ +  P TP GFW   F  
Sbjct: 61  AKKKKLANTFSRHRHHHKRPDTPPGFWRFDFPD 93

SAE2 is a protein involved in repairing meiotic and mitotic double-strand breaks in DNA. It has been shown to negatively regulate DNA damage checkpoint signalling. SAE2 is homologous to the CtIP proteins in mammals and an homologous protein in plants. Crucial sequence motifs that are highly conserved are the CxxC and the RHR motifs in this C-terminal part of the protein. It is now known to be an endonuclease. In budding yeast, genetic evidence suggests that the SAE2 protein is essential for the processing of hairpin DNA intermediates and meiotic double-strand breaks by Mre11/Rad50 complexes. SAE2 binds DNA and exhibits endonuclease activity on single-stranded DNA independently of Mre11/Rad50 complexes, but hairpin DNA structures are cleaved cooperatively in the presence of Mre11/Rad50 or Mre11/Rad50/Xrs2. Hairpin structures are not processed at the tip by SAE2 but rather at single-stranded DNA regions adjacent to the hairpin. The catalytic activities of SAE2 are important for its biological functions. Length = 93

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|223683 COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|188306 TIGR03319, RNase_Y, ribonuclease Y	Back alignment and domain information

>gnl\|CDD\|222878 PHA02562, 46, endonuclease subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		559
KOG0965		988	consensus Predicted RNA-binding protein, contains	100.0
PF08573		93	SAE2: DNA repair protein endonuclease SAE2/CtIP C-	99.94
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.21
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.17
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.13
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.12
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	99.03
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	98.92
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.89
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.86
PRK02224		880	chromosome segregation protein; Provisional	98.86
PRK02224		880	chromosome segregation protein; Provisional	98.84
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	98.83
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.82
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.82
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.73
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.64
PRK03918		880	chromosome segregation protein; Provisional	98.62
PRK03918		880	chromosome segregation protein; Provisional	98.6
KOG0996		1293	consensus Structural maintenance of chromosome pro	98.53
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.48
PRK01156		895	chromosome segregation protein; Provisional	98.48
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.46
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.43
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.39
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.32
PRK11637		428	AmiB activator; Provisional	98.31
PHA02562		562	46 endonuclease subunit; Provisional	98.31
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.28
PRK11637		428	AmiB activator; Provisional	98.27
PHA02562		562	46 endonuclease subunit; Provisional	98.26
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.22
KOG0963		629	consensus Transcription factor/CCAAT displacement	98.21
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	98.21
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	98.19
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.18
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	98.18
KOG0996		1293	consensus Structural maintenance of chromosome pro	98.18
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.14
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.14
PRK04778		569	septation ring formation regulator EzrA; Provision	98.13
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	98.08
PRK04863		1486	mukB cell division protein MukB; Provisional	98.02
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.99
PRK04778		569	septation ring formation regulator EzrA; Provision	97.95
PF00038		312	Filament: Intermediate filament protein; InterPro:	97.94
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.93
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	97.92
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.92
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	97.9
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.87
PRK04863		1486	mukB cell division protein MukB; Provisional	97.85
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	97.85
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.84
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	97.82
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.82
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.81
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.81
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	97.8
PF00038		312	Filament: Intermediate filament protein; InterPro:	97.78
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	97.74
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.72
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.7
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.69
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.66
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.64
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.63
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.62
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	97.61
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	97.6
KOG0964		1200	consensus Structural maintenance of chromosome pro	97.59
KOG0971		1243	consensus Microtubule-associated protein dynactin	97.55
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	97.48
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.47
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.46
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.44
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.44
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.42
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.41
COG5185		622	HEC1 Protein involved in chromosome segregation, i	97.38
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.37
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.32
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.3
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	97.3
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.29
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	97.27
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	97.26
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	97.22
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	97.2
PRK09039		343	hypothetical protein; Validated	97.19
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.18
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.14
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.13
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	97.12
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.09
PRK09039		343	hypothetical protein; Validated	97.09
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.09
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.08
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.07
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.06
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	97.05
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.04
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	97.0
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	96.97
PF14662		193	CCDC155: Coiled-coil region of CCDC155	96.96
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.94
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	96.93
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.91
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	96.88
COG4942		420	Membrane-bound metallopeptidase [Cell division and	96.86
KOG0963		629	consensus Transcription factor/CCAAT displacement	96.84
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	96.81
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.8
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.8
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	96.72
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.71
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.69
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	96.63
PRK10929		1109	putative mechanosensitive channel protein; Provisi	96.63
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	96.57
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.56
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	96.54
PRK11281		1113	hypothetical protein; Provisional	96.49
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.48
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	96.48
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.46
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.46
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	96.42
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	96.35
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	96.31
KOG0979		1072	consensus Structural maintenance of chromosome pro	96.29
KOG1937		521	consensus Uncharacterized conserved protein [Funct	96.27
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	96.26
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.21
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.15
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.15
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	96.1
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	96.09
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.03
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	96.03
COG4372		499	Uncharacterized protein conserved in bacteria with	95.99
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	95.95
KOG1003		205	consensus Actin filament-coating protein tropomyos	95.94
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	95.85
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	95.75
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	95.74
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	95.71
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	95.65
PRK11281		1113	hypothetical protein; Provisional	95.62
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	95.59
KOG0249		916	consensus LAR-interacting protein and related prot	95.55
PF13166		712	AAA_13: AAA domain	95.51
KOG0979		1072	consensus Structural maintenance of chromosome pro	95.45
KOG2991		330	consensus Splicing regulator [RNA processing and m	95.42
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	95.38
PF13514		1111	AAA_27: AAA domain	95.36
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	95.33
PRK10869		553	recombination and repair protein; Provisional	95.28
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	95.25
PRK10246		1047	exonuclease subunit SbcC; Provisional	95.25
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	95.22
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	95.21
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	95.19
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	95.16
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	95.16
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	95.14
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	95.13
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	95.08
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	95.05
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	95.04
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	95.03
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	94.99
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	94.93
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.93
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	94.87
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	94.81
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	94.76
KOG4673		961	consensus Transcription factor TMF, TATA element m	94.72
KOG0249		916	consensus LAR-interacting protein and related prot	94.69
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	94.67
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	94.66
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	94.64
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.6
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	94.54
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	94.53
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	94.52
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	94.49
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	94.48
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	94.45
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.36
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	94.32
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	94.03
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.01
PRK10698		222	phage shock protein PspA; Provisional	94.0
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	93.96
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	93.9
PRK10929		1109	putative mechanosensitive channel protein; Provisi	93.89
KOG4438		446	consensus Centromere-associated protein NUF2 [Cell	93.86
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	93.86
PF10186		302	Atg14: UV radiation resistance protein and autopha	93.85
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	93.83
COG4372		499	Uncharacterized protein conserved in bacteria with	93.82
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	93.69
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	93.68
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	93.59
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	93.58
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	93.55
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	93.5
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.19
KOG1937		521	consensus Uncharacterized conserved protein [Funct	93.19
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	93.08
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.02
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	92.76
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	92.68
PRK10246		1047	exonuclease subunit SbcC; Provisional	92.65
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	92.65
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	92.56
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	92.56
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	92.48
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	92.38
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	92.14
KOG4302		660	consensus Microtubule-associated protein essential	92.03
PRK15422		79	septal ring assembly protein ZapB; Provisional	91.83
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	91.46
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	91.38
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	91.38
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	91.35
COG3074		79	Uncharacterized protein conserved in bacteria [Fun	91.28
PF13514		1111	AAA_27: AAA domain	91.2
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	90.55
COG2433		652	Uncharacterized conserved protein [Function unknow	90.42
PF13166		712	AAA_13: AAA domain	90.34
PRK15422		79	septal ring assembly protein ZapB; Provisional	90.33
COG4026		290	Uncharacterized protein containing TOPRIM domain,	89.86
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	89.58
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	89.55
COG2433		652	Uncharacterized conserved protein [Function unknow	89.53
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	89.52
KOG0965		988	consensus Predicted RNA-binding protein, contains	89.51
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	89.46
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	89.43
COG3074		79	Uncharacterized protein conserved in bacteria [Fun	89.33
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	89.32
cd07648		261	F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am	89.31
KOG4302		660	consensus Microtubule-associated protein essential	89.13
PLN03188		1320	kinesin-12 family protein; Provisional	89.11
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	88.99
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	88.92
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	88.59
COG4477		570	EzrA Negative regulator of septation ring formatio	88.58
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	88.55
KOG4403		575	consensus Cell surface glycoprotein STIM, contains	88.42
KOG0992		613	consensus Uncharacterized conserved protein [Funct	88.38
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	88.24
KOG4657		246	consensus Uncharacterized conserved protein [Funct	88.2
KOG3091		508	consensus Nuclear pore complex, p54 component (sc	87.64
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	87.62
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	87.57
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	87.51
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	87.24
PRK10869		553	recombination and repair protein; Provisional	87.18
PRK09343		121	prefoldin subunit beta; Provisional	87.16
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	87.14
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	87.1
COG1382		119	GimC Prefoldin, chaperonin cofactor [Posttranslati	87.06
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	87.05
PRK11519		719	tyrosine kinase; Provisional	87.04
PF14992		280	TMCO5: TMCO5 family	86.98
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	86.89
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	86.73
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	86.68
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	85.87
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	85.82
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	85.61
COG4026		290	Uncharacterized protein containing TOPRIM domain,	85.61
PRK11519		719	tyrosine kinase; Provisional	85.53
KOG3091		508	consensus Nuclear pore complex, p54 component (sc	85.22
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	85.2
PF05278		269	PEARLI-4: Arabidopsis phospholipase-like protein (	85.01
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	84.9
PLN02939		977	transferase, transferring glycosyl groups	84.86
COG4477		570	EzrA Negative regulator of septation ring formatio	84.78
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	84.74
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	84.72
PF15233		134	SYCE1: Synaptonemal complex central element protei	84.67
COG4717		984	Uncharacterized conserved protein [Function unknow	84.1
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	83.76
TIGR02338		110	gimC_beta prefoldin, beta subunit, archaeal. Chape	83.25
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	83.21
KOG2991		330	consensus Splicing regulator [RNA processing and m	83.16
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	82.39
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	82.33
PRK15178		434	Vi polysaccharide export inner membrane protein Ve	82.29
KOG3433		203	consensus Protein involved in meiotic recombinatio	82.22
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	82.14
PF13863		126	DUF4200: Domain of unknown function (DUF4200)	82.08
PF04949		159	Transcrip_act: Transcriptional activator; InterPro	81.76
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	81.4
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	81.01
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	81.01
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	80.89
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	80.73
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	80.19

>KOG0965 consensus Predicted RNA-binding protein, contains SWAP and G-patch domains [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=1.8e-37  Score=337.94  Aligned_cols=477  Identities=7%  Similarity=-0.144  Sum_probs=416.7

Q ss_pred             HHhhhHHHHHHHhHHHhHHHHHHHHHHHhHhhhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhhHHHH
Q 008630           30 EEKTGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKI  109 (559)
Q Consensus        30 e~~~~~~~~~~~sl~~~~~~l~~~~~~k~~~v~~~~el~~~l~~~~~~~~keL~~~Qk~L~Ele~kI~~le~e~k~leer  109 (559)
                      ..++.++.+++.|++.++++++...+..+++|++.+.+++++.+|.+.++..-..        .-.|+......+.+..+
T Consensus        32 ~~~~~s~~~~~~s~~~~~~~~k~~~~~~~~~~~d~rd~~~~~~~l~~~~~~d~~~--------~~~~~~~~~~~~~~~~~  103 (988)
T KOG0965|consen   32 VFPGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQDWKF--------ALRGSWEQDFGHPVSQE  103 (988)
T ss_pred             hCCCCCcccCCccccchHHHHHHhhhhhhhhccchHHHHHHHHHhhhhcchhhhh--------hccCceeeecCcchhhh
Confidence            4678889999999999999999999999999999999999999999998876544        66788888899999999


Q ss_pred             HHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 008630          110 VDELQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEELTKKTEEVEE  189 (559)
Q Consensus       110 L~~Leek~~kl~EEIee~kekleeL~~eIe~Le~eie~~e~eLee~EkEkeel~ek~e~leeEv~eLqekl~q~ekEIse  189 (559)
                      -.+++       +++....-.+..+..++..+...++.-...+..-+.+...+..+.....+.++++.+.+-+...++..
T Consensus       104 s~~~q-------e~~~~~s~v~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~r~~~~~~~~gr~~~i~~q~~~~~~~  176 (988)
T KOG0965|consen  104 SSWSQ-------EYSFGPSAVLGDFGSSRLIEKECLEKESRDYDVDHPGEADSVLRGSSQVQARGRALNIVDQEGSLLGK  176 (988)
T ss_pred             hHHHH-------HhhcCcchhhhhhhhHHHHHHHHhhhcccccccCCchhhhhhhhhhHHHHhhhHHHHHHHhhhhhhcc
Confidence            99998       67777778888888888888888888899999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhhhHHHHHhHHHH---HHHHHHHHHHHHH-HHHHHHHHHHHHHHHhhhhhcchhhhHHHHHHHHHHH
Q 008630          190 GRKLQEQLLQQIDFKSSEITKNKQEF---EKEKQLLLDKVRG-LEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIEQKT  265 (559)
Q Consensus       190 lr~~iq~LeQeLE~~~~Ei~kle~EL---EkE~~el~kkie~-l~ek~eeLq~eieelkekL~~~e~eieeL~eqL~~k~  265 (559)
                      +.++..-+..-+-.+...+..+.+.+   ++++.-.++...+ ++.........              ...+..+-.+..
T Consensus       177 g~t~~~~~~~~~~~~~~~~~n~~~k~~~~~~~~t~~~~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~  242 (988)
T KOG0965|consen  177 GETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTL--------------GTNPGTEDIQFP  242 (988)
T ss_pred             chhhhhhhhcCcceeEeeecccccccCCccccccccccccchhhcCCCCCcccc--------------ccCCCccccccc
Confidence            99999999988888888888888887   7777777666543 33333322111              134555666778


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCCccccccccccccccccccCCCCCCCCCCCCchh-HHHHhhhhhhh
Q 008630          266 AELMAEKKKRRDVIDAYKRLKSQYNYICAKFGLTTDKMTSEHKVEEESDSLTHRRNPIPFPDKHSDAS-AAYCEINKVKK  344 (559)
Q Consensus       266 ~el~~e~rKl~~l~~eyk~LKSqi~~L~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  344 (559)
                      .++.++..++..|+.-.+..+++|.++|..|.++..++|+.+.+++++++++.|+       +..+-- ..+.+++++..
T Consensus       243 ~~~~~~~~~~k~l~~~~~k~~~~~~~~~~~f~~~~~~i~~~~~~~~~~~~i~~~~-------~~~~~~e~~~~~~a~~~~  315 (988)
T KOG0965|consen  243 IQKIPLGLDLKNLRLPRRKMSFDIIDKSDVFSRFGIEIIKWAGFHTIKDDIKFSQ-------LFQTLFELETETCAKMLA  315 (988)
T ss_pred             HHHhhhhcchhhhcchhhhhhhhhhHHHhhhccccHhHhhhcccchhhhhhhHHH-------HHHHHHHhhhHHHHHHHh
Confidence            8899999999999999999999999999999999999999999999999999997       433222 66788899999


Q ss_pred             hccCCCCcchhhhhhhcccccccCCCCccccccCCCCCCCCCCccccCCCCCchhhhhhccCCCCCCCcccccCChhhhh
Q 008630          345 EVGLSDNLDNEKKAKSVQTSSFHSSSSGFIVTEKCPSNVKSAPIAGTKRPASSWRETRSRQYEGGPDPHDDFLDTPFENI  424 (559)
Q Consensus       345 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~p~~~~~~~r~~~~~~~~d~~d~~~d~~~~~~  424 (559)
                      .+..+.|.++++..+..++..++||+.+.   ...|...+....+|.++|.+.|+++||++.+++.||||+||++|.++|
T Consensus       316 ~~~~~~~~~~~~~~~~ti~~~~~s~~~t~---~~~~~~~~~~~~~G~~~~~~~~~~~~s~~~~~~~~~qd~lL~s~~~~l  392 (988)
T KOG0965|consen  316 SFKCSLKPEHRDFCFFTIKFLKHSALKTP---RVDNEFLNMLLDKGAVKTKNCFFEIISPFDKYIMRLQDRLLKSVTPLL  392 (988)
T ss_pred             heeeccCCcccchhhhhHHhhhccccccc---ccChhhccchhhhccccccceeccccCcccccCcChHHHHHhcchHHH
Confidence            99999999999999999999999999987   446888999999999999999999999999999999999999999999


Q ss_pred             hhccccccccccCCCCCCCcCCCCCCCCcchhccCCCCccccccCCCCCCCCCCCccccccccChhhhhcCCCCChhhhH
Q 008630          425 RGNLNKVMKEDVHDRPDPAAKDMNLDSSDDETQDMNIDTGRQRQQNPVPTAGKQGFKYVEPVRKKVERENLKGVECKQCK  504 (559)
Q Consensus       425 ~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~g~~fay~EvVR~K~eR~~L~G~~C~~C~  504 (559)
                      +    ..+..|.+......+     +++|++++++|..+++.++..+++-+....|.|.+-||.+++|-++.|..|+.|.
T Consensus       393 ~----a~~~~e~~v~~vA~~-----~p~d~~~~~~~~nssc~~~~~~~~~Tf~~~f~~~q~~~~~a~~~~~~~~~p~~~p  463 (988)
T KOG0965|consen  393 M----ACNAYELSVKMVALS-----NPLDLALALETTNSSCRKSLALLGQTFSLAFSFRQEKILEAVGLQDIAPSPAAFP  463 (988)
T ss_pred             H----HHHHHHhhhhhhccC-----CCCChHHHhcCCCcchHHHHHHhhhhHHHHHHHHHHHHHhhccccccCCCCccCC
Confidence            9    455666666555555     7789999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCCCCCCCCCccccchhhhhccccCCcccCCCCCCCCCCccCCCCCC
Q 008630          505 KFYDAVLPSDGGKESDGSKKTLRCEHHEGVSRHRYKYIPPLTPEGFWNIGFESE  558 (559)
Q Consensus       505 ~~Y~a~~~~~~~~~~~~~~~~~~~~~~~~~sRHR~~~~pp~TPpGFW~~~FPs~  558 (559)
                      .||++..+.....    ......|.|+..+++|||+|++|.||++||.++|-++
T Consensus       464 ~f~d~~~~~~e~~----~~~~~~~~~~g~v~~~~~a~~~Pm~~e~~~~~~~~~e  513 (988)
T KOG0965|consen  464 NFEDSTLFGREYI----DHLKAWLVSSGCVLQVKKAEPEPMREEEKMIPPTKPE  513 (988)
T ss_pred             Chhhccchhhhcc----ccceeeeecCCchhhhhcccCCCCCCCcccCCCCChH
Confidence            9999997765543    2334578999999999999999999999999999765

>PF08573 SAE2: DNA repair protein endonuclease SAE2/CtIP C-terminus; InterPro: IPR013882 SAE2 is a protein involved in repairing meiotic and mitotic double-strand breaks in DNA	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>KOG0965 consensus Predicted RNA-binding protein, contains SWAP and G-patch domains [General function prediction only]	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only]	Back alignment and domain information

>KOG0992 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>KOG4657 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PRK09343 prefoldin subunit beta; Provisional	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PF14992 TMCO5: TMCO5 family	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>PF15233 SYCE1: Synaptonemal complex central element protein 1	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional	Back alignment and domain information

>KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF13863 DUF4200: Domain of unknown function (DUF4200)	Back alignment and domain information

>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae []	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		559
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	7e-18
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	8e-16
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	5e-15
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-13
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-04
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-10
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	3e-06
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	9e-06
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	2e-05
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	5e-05
2xs1_A		704	Programmed cell death 6-interacting protein; prote	3e-05

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

 Score = 86.8 bits (215), Expect = 7e-18
 Identities = 65/293 (22%), Positives = 126/293 (43%), Gaps = 14/293 (4%)

Query: 5    QLQKQQAVEENKTLKFDKAKLLQEQEEKTGQLLVKLE----SQRCEINELKQELEFKSKE 60
             L K    EE    K ++ +  +E+++K    L +LE        E N L+++L+ +++ 
Sbjct: 848  PLLKVTRQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETEL 907

Query: 61   VEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDELQRQLGAK 120
                +EM+  L    Q     + +   ++EE EE+++ L AE    ++ + +L+ QL  +
Sbjct: 908  YAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEE 967

Query: 121  TEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFEVFEENVSRLQEEL 180
                 + +        KI+K+  DI   +       KE+K       + EE VS L   L
Sbjct: 968  EAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERK-------LLEERVSDLTTNL 1020

Query: 181  TKKTEEVEEGRKLQEQLLQQID---FKSSEITKNKQEFEKEKQLLLDKVRGLEEKANELK 237
             ++ E+ +   KL+ +    I     +  +  K++QE EK K+ L  +   L E+  EL+
Sbjct: 1021 AEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQ 1080

Query: 238  KNFCEKSSKQGWGMDSNDKLLQEIEQKTAELMAEKKKRRDVIDAYKRLKSQYN 290
                E  ++     +     L  +E +T++     KK R++      L+    
Sbjct: 1081 AQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLE 1133

PyMOL of 1i84

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		559
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	99.43
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	99.36
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	98.84
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	98.12
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	97.99
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	97.55
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	97.54
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.46
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	97.41
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	97.39
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	97.21
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	96.95
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	96.93
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	96.52
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	96.49
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	96.48
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	95.1
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	94.85
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	94.84
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	94.77
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	94.56
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	94.47
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	94.37
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	94.36
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	94.36
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	94.21
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	93.35
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	92.77
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	92.56
2b9c_A		147	Striated-muscle alpha tropomyosin; alpha-helix, co	92.42
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	91.06
4gkw_A		167	Spindle assembly abnormal protein 6; double helix,	90.93
2e7s_A		135	RAB guanine nucleotide exchange factor SEC2; coile	90.77
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	90.61
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	89.98
3i00_A		120	HIP-I, huntingtin-interacting protein 1; transcrip	89.97
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	89.89
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	89.68
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	89.33
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	89.27
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	89.14
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	89.02
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	88.89
3l4q_C		170	Phosphatidylinositol 3-kinase regulatory subunit b	88.68
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	88.51
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	88.49
3i00_A		120	HIP-I, huntingtin-interacting protein 1; transcrip	88.4
2xzr_A		114	Immunoglobulin-binding protein EIBD; cell adhesion	88.21
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	87.67
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	87.65
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	86.84
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	86.67
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	86.52
3swk_A		86	Vimentin; cytoskeleton, intermediate filament, alp	85.6
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	85.47
3hhm_B		373	NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil	85.36
1gk4_A		84	Vimentin; intermediate filament, dimer, parallel c	85.32
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	84.1
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	83.16
1m1j_C		409	Fibrinogen gamma chain; coiled coils, disulfide ri	82.98
3a7p_A		152	Autophagy protein 16; coiled-coil, coiled coil, cy	82.66
1x79_B		112	RAB GTPase binding effector protein 1; rabaptin5,	82.26
2xzr_A		114	Immunoglobulin-binding protein EIBD; cell adhesion	81.92
1l8d_A		112	DNA double-strand break repair RAD50 ATPase; zinc	81.33
2eqb_B		97	RAB guanine nucleotide exchange factor SEC2; coile	81.31
3edv_A		323	Spectrin beta chain, brain 1; spectrin repeat, coi	80.93
1x8y_A		86	Lamin A/C; structural protein, intermediate filame	80.78
2zqm_A		117	Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9	80.62

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

Probab=99.43  E-value=7.7e-09  Score=98.39  Aligned_cols=257  Identities=12%  Similarity=0.122  Sum_probs=146.3

Q ss_pred             hhHHHHHHHhHHHhHHHHHHHHHHHhHhhhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhhHHHHHHH
Q 008630           33 TGQLLVKLESQRCEINELKQELEFKSKEVEGVKEMQKGLIQLAQSKACEIKKKCDQLEEHEEKTKTLIAELNSHKKIVDE  112 (559)
Q Consensus        33 ~~~~~~~~~sl~~~~~~l~~~~~~k~~~v~~~~el~~~l~~~~~~~~keL~~~Qk~L~Ele~kI~~le~e~k~leerL~~  112 (559)
                      ++.+...+..++..+..|+..+......+.....-...+-..+......+...+..+..+...+..+...+..+..++..
T Consensus        15 ~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   94 (284)
T 1c1g_A           15 KENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQL   94 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444555555555555555555555555555555555555666666666666666677777777777777777777777


Q ss_pred             HHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHH
Q 008630          113 LQRQLGAKTEEVAREKELTENLFKKIEKLSLDISHYKQLLADEKKEKKCFLTKFE-------VFEENVSRLQEELTKKTE  185 (559)
Q Consensus       113 Leek~~kl~EEIee~kekleeL~~eIe~Le~eie~~e~eLee~EkEkeel~ek~e-------~leeEv~eLqekl~q~ek  185 (559)
                      +......+..++......+..+...+..+...+..+...+..+...+..+...+.       .++..+..+...+..+..
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~  174 (284)
T 1c1g_A           95 FEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIES  174 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            7766666666666666666666666665544444444444444444444444444       444445555555555555


Q ss_pred             HHHHHHHHHHHHHHHHhhhhHHHHHhHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcchhhhHHHHHHHH
Q 008630          186 EVEEGRKLQEQLLQQIDFKSSEITKNKQEF---EKEKQLLLDKVRGLEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIE  262 (559)
Q Consensus       186 EIselr~~iq~LeQeLE~~~~Ei~kle~EL---EkE~~el~kkie~l~ek~eeLq~eieelkekL~~~e~eieeL~eqL~  262 (559)
                      ++..+...+..+..++..+...+..+..++   ......+...+..+...+..+...+..+...+......+..+...+.
T Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  254 (284)
T 1c1g_A          175 DLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSID  254 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            555555555555555555555554444443   33334444444445555555555555555555555555555555555


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 008630          263 QKTAELMAEKKKRRDVIDAYKRLKSQYNYICAKF  296 (559)
Q Consensus       263 ~k~~el~~e~rKl~~l~~eyk~LKSqi~~L~~k~  296 (559)
                      ..       ...+..+...+..+...++.+..++
T Consensus       255 ~~-------~~~~~~~~~~~~~~~~~~~~~~~~L  281 (284)
T 1c1g_A          255 DL-------EDELYAQKLKYKAISEELDHALNDM  281 (284)
T ss_dssp             HH-------HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HH-------HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            55       6666666666667777776665554

PyMOL of 1c1g

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans}	Back alignment and structure

>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A	Back alignment and structure

>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd}	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A*	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens}	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A	Back alignment and structure

>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C	Back alignment and structure

>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2	Back alignment and structure

>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd}	Back alignment and structure

>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1	Back alignment and structure

>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens}	Back alignment and structure

>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A	Back alignment and structure

>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		559
d2ap3a1		185	Hypothetical protein MW0975 (SA0943) {Staphylococc	93.49
d2efla1		288	Formin-binding protein 1, FNBP1 {Human (Homo sapie	91.37
d2ap3a1		185	Hypothetical protein MW0975 (SA0943) {Staphylococc	90.86
d1fxka_		107	Prefoldin beta subunit {Archaeon Methanobacterium	83.68
d1fxkc_		133	Prefoldin alpha subunit {Archaeon Methanobacterium	81.13
d1seta1		110	Seryl-tRNA synthetase (SerRS) {Thermus thermophilu	81.03

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: MW0975(SA0943)-like
family: MW0975(SA0943)-like
domain: Hypothetical protein MW0975 (SA0943)
species: Staphylococcus aureus [TaxId: 1280]

Probab=93.49  E-value=1.6  Score=35.55  Aligned_cols=46  Identities=0%  Similarity=-0.210  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcchhhhHHHHHHHHHH
Q 008630          219 KQLLLDKVRGLEEKANELKKNFCEKSSKQGWGMDSNDKLLQEIEQK  264 (559)
Q Consensus       219 ~~el~kkie~l~ek~eeLq~eieelkekL~~~e~eieeL~eqL~~k  264 (559)
                      .......+..+...+..+......+...+......+..+...+..+
T Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l  156 (185)
T d2ap3a1         111 LKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAI  156 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhhHhHHHHHHHHHHHH
Confidence            3344444455555566666666666666666666666666666666

PyMOL of d2ap3a1

>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}	Back information, alignment and structure