Citrus Sinensis ID: 008708


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------
MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLSISVDEEDDDDDDDEDDDDNIYHDGDGDGDGDDNEDDAEETIACSGKEDELIFFNGDHQRSQEGLHTLQTVDL
ccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHccc
ccccccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHEHHEEEEcccccHHHHHHHHHHHHHcccccccEEcccc
mgmlaprkfMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRsertrgqplpkdlvLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMnkkgyapsvVSHTALMEaygrggryknAEAIFRRmqssgprpsalTYQIILKLFVEANKFKEAEEVFMTLLdeeksplkpdqKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKcmrrdrcspdicsyTTMLSAYVNASDMEGAEKFFRRLkqdgfvpnvitYGTLIKGYAKVNNLEKMMEIYDKMrvngikpnqTIFTTIMDaygknkdfDSAVVWYKEmescgfppdqkAKNILLSLAKTADERNEANELlgnfnhpnnepginglsisvdeedddddddeddddniyhdgdgdgdgddneddaeetiacsgkedeliffngdhqrsqeglhtlqtvdl
mgmlaprkfmqkrrkvevfkdaadeagkknWRRLMNQIEEVGSAVAVlrsertrgqplpkdlvlgtlvrlkqlkkwnvVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTlldeeksplkpdqKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRrlkqdgfvpnvitygtlikgyaKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELlgnfnhpnnepgINGLSISVDEEDDDDDDDEDDDDNIyhdgdgdgdgddnEDDAEETIACSGKEDELIFFNGDhqrsqeglhtlqtvdl
MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLSISVdeedddddddeddddniyhdgdgdgdgddneddAEETIACSGKEDELIFFNGDHQRSQEGLHTLQTVDL
******************************WRRLMNQIEEVGSAVAVLR********LPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFR**********ALTYQIILKLFVEANKFKEAEEVFMTLLD**********KMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFP******NILL*********************************************************************************LIFF*******************
MGMLA*RKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLSISVDEEDDDDDDDEDDDDNIYHDGDGDGDGDDNEDDAEETIACSGKEDELIFFNGDHQRSQEGLHTLQTVDL
MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLSISVD***********DDDNIYHDGDGDGDGDDNEDDAEETIACSGKEDELIFFNGDHQRSQEGLHTLQTVDL
MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLSISVDEEDDDDDDDEDDDDNIYHDGDGDGDGDDNEDDAEETIACSGKEDELIFFNGDHQRSQEGLHTLQT*DL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLSISVDEEDDDDDDDEDDDDNIYHDGDGDGDGDDNEDDAEETIACSGKEDELIFFNGDHQRSQEGLHTLQTVDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query557 2.2.26 [Sep-21-2011]
Q9LYT2583 Pentatricopeptide repeat- yes no 0.928 0.886 0.724 0.0
Q9LYZ9 819 Pentatricopeptide repeat- no no 0.719 0.489 0.264 2e-44
Q8RWS8 822 Pentatricopeptide repeat- no no 0.707 0.479 0.254 2e-41
Q9SIC9 918 Pentatricopeptide repeat- no no 0.624 0.379 0.282 7e-41
Q8L844709 Pentatricopeptide repeat- no no 0.737 0.579 0.254 1e-40
Q9CAN5614 Pentatricopeptide repeat- no no 0.725 0.657 0.242 3e-40
Q9FIX3747 Pentatricopeptide repeat- no no 0.795 0.593 0.253 5e-40
Q9FIT7 974 Pentatricopeptide repeat- no no 0.612 0.350 0.277 5e-40
Q9SXD1630 Pentatricopeptide repeat- no no 0.775 0.685 0.240 7e-40
Q3EDF8598 Pentatricopeptide repeat- no no 0.635 0.591 0.269 6e-39
>sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 Back     alignment and function desciption
 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/527 (72%), Positives = 441/527 (83%), Gaps = 10/527 (1%)

Query: 1   MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRG-QPLP 59
           MGMLAPRKF+QKRRK+EVFKDAADE  +K WR LM +IE  GSAV VLR  +T G Q LP
Sbjct: 43  MGMLAPRKFLQKRRKMEVFKDAADETDQKRWRGLMLEIESTGSAVPVLRQYKTDGDQGLP 102

Query: 60  KDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVL 119
           +DLVLGTLVR KQLKKWN+VSE+LEWLR Q+WW+F+E+DFLMLITAYGK G+FN AE+VL
Sbjct: 103 RDLVLGTLVRFKQLKKWNLVSEILEWLRYQNWWNFSEIDFLMLITAYGKLGNFNGAERVL 162

Query: 120 SFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEA 179
           S ++K G  P+V+S+TALME+YGRGG+  NAEAIFRRMQSSGP PSA+TYQIILK FVE 
Sbjct: 163 SVLSKMGSTPNVISYTALMESYGRGGKCNNAEAIFRRMQSSGPEPSAITYQIILKTFVEG 222

Query: 180 NKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQST 239
           +KFKEAEEVF TLLDE+KSPLKPDQKM+HMMIYMYKKAG YEKARK+F+ M  +GV QST
Sbjct: 223 DKFKEAEEVFETLLDEKKSPLKPDQKMYHMMIYMYKKAGNYEKARKVFSSMVGKGVPQST 282

Query: 240 VTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLD 299
           VTYNSLMSFET+YKEVSKIYDQMQR+ +QPDVVSYALLI AYG+ARREEEAL+VFEEMLD
Sbjct: 283 VTYNSLMSFETSYKEVSKIYDQMQRSDIQPDVVSYALLIKAYGRARREEEALSVFEEMLD 342

Query: 300 AGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEG 359
           AGVRPTHKAYNILLDAFAISGMV+QA+TVFK MRRDR  PD+ SYTTMLSAYVNASDMEG
Sbjct: 343 AGVRPTHKAYNILLDAFAISGMVEQAKTVFKSMRRDRIFPDLWSYTTMLSAYVNASDMEG 402

Query: 360 AEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMD 419
           AEKFF+R+K DGF PN++TYGTLIKGYAK N++EKMME+Y+KMR++GIK NQTI TTIMD
Sbjct: 403 AEKFFKRIKVDGFEPNIVTYGTLIKGYAKANDVEKMMEVYEKMRLSGIKANQTILTTIMD 462

Query: 420 AYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEP 479
           A G+ K+F SA+ WYKEMESCG PPDQKAKN+LLSLA T DE  EA EL G  N      
Sbjct: 463 ASGRCKNFGSALGWYKEMESCGVPPDQKAKNVLLSLASTQDELEEAKELTGIRNET---- 518

Query: 480 GINGLSISVDEEDDDDDDDEDDDDNIYHDGDGDGDGDDNEDDAEETI 526
                +  +      DDD+E  +D      D + +GDD++DDA ET+
Sbjct: 519 -----ATIIARVYGSDDDEEGVEDISSESSDDEDEGDDDDDDARETV 560





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 Back     alignment and function description
>sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
224054488575 predicted protein [Populus trichocarpa] 0.992 0.961 0.745 0.0
449463623580 PREDICTED: pentatricopeptide repeat-cont 0.843 0.810 0.823 0.0
255583688553 pentatricopeptide repeat-containing prot 0.843 0.849 0.812 0.0
225446761548 PREDICTED: pentatricopeptide repeat-cont 0.861 0.875 0.790 0.0
356536414553 PREDICTED: pentatricopeptide repeat-cont 0.885 0.891 0.752 0.0
356575428562 PREDICTED: pentatricopeptide repeat-cont 0.867 0.859 0.759 0.0
297820746582 pentatricopeptide repeat-containing prot 0.843 0.807 0.783 0.0
30694913583 pentatricopeptide repeat-containing prot 0.928 0.886 0.724 0.0
42572723590 pentatricopeptide repeat-containing prot 0.928 0.876 0.724 0.0
357444885553 Pentatricopeptide repeat-containing prot 0.863 0.869 0.758 0.0
>gi|224054488|ref|XP_002298285.1| predicted protein [Populus trichocarpa] gi|222845543|gb|EEE83090.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/559 (74%), Positives = 477/559 (85%), Gaps = 6/559 (1%)

Query: 1   MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRGQPLPK 60
           MGML+PRKF+QKRRKVEVFKDA+DEA +KNWRRLM QIE+ GSAV+VLR ER +   LP+
Sbjct: 21  MGMLSPRKFLQKRRKVEVFKDASDEADQKNWRRLMKQIEDTGSAVSVLRRERIKKDGLPR 80

Query: 61  DLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVLS 120
           DLVLGTLVR KQLKKW++VSE+LEWL+ Q WWDFNEMDFLMLITAYGK GDFN AE VL 
Sbjct: 81  DLVLGTLVRFKQLKKWDLVSEILEWLQSQHWWDFNEMDFLMLITAYGKLGDFNGAEMVLR 140

Query: 121 FMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEAN 180
            MN  GY P+VVSHTALMEAYGRGGRY NAEAIFRRMQ+SGP PSALTYQIILK FVE N
Sbjct: 141 SMNGNGYVPNVVSHTALMEAYGRGGRYNNAEAIFRRMQTSGPEPSALTYQIILKTFVEGN 200

Query: 181 KFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTV 240
           KFKEAEEVF TLL++E SPL+PDQKMFHMMIYM KKAG YEKARK+FALMAERGV QSTV
Sbjct: 201 KFKEAEEVFETLLNKENSPLEPDQKMFHMMIYMQKKAGNYEKARKVFALMAERGVPQSTV 260

Query: 241 TYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDA 300
           TYNSLMSFETNYKEVSKIYDQMQR+GL+PDVVSYALLI AYG+ARREEEALAVFEEMLDA
Sbjct: 261 TYNSLMSFETNYKEVSKIYDQMQRSGLRPDVVSYALLIKAYGRARREEEALAVFEEMLDA 320

Query: 301 GVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGA 360
           GVRP+HKAYNILLDAFAISGMV+QAR VFK MRRDRC+PD+CSYTTMLSAYVNASDMEGA
Sbjct: 321 GVRPSHKAYNILLDAFAISGMVEQARVVFKSMRRDRCTPDLCSYTTMLSAYVNASDMEGA 380

Query: 361 EKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDA 420
           E FF+RL+QDG  PNV+TYG LIKG+AKVNNLEKMMEIY++M++N IK NQTI TTIMDA
Sbjct: 381 ENFFKRLRQDGLKPNVVTYGALIKGHAKVNNLEKMMEIYEEMQLNSIKANQTILTTIMDA 440

Query: 421 YGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNE-- 478
           YGKNKDF SAV+WYKEME  G PPDQKA+NILLSLAKT DE+ EA++L+G   +P++   
Sbjct: 441 YGKNKDFGSAVIWYKEMEHHGVPPDQKAQNILLSLAKTQDEQKEASQLVG---YPDDCGI 497

Query: 479 PGINGLSISVDEEDDDDDDDEDDDDNIYHDGDGDGDGDDNEDDAEETIACSGKEDELIFF 538
             ING S   D++  DD+ D++DD +     D + D D  +D A +T++ S + ++LIF 
Sbjct: 498 QSINGASRFADDDGSDDETDDEDDYDEADKNDDEDDCDGVDDTA-KTVSYSKECEDLIFL 556

Query: 539 NGDHQRSQEGLHTLQTVDL 557
           +GD+Q + E LH L  +DL
Sbjct: 557 DGDNQHNLEALHALTVIDL 575




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449463623|ref|XP_004149531.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255583688|ref|XP_002532598.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527686|gb|EEF29795.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225446761|ref|XP_002278350.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Vitis vinifera] gi|302143502|emb|CBI22063.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356536414|ref|XP_003536733.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like [Glycine max] Back     alignment and taxonomy information
>gi|356575428|ref|XP_003555843.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040-like [Glycine max] Back     alignment and taxonomy information
>gi|297820746|ref|XP_002878256.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324094|gb|EFH54515.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30694913|ref|NP_191463.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218525907|sp|Q9LYT2.2|PP287_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g59040 gi|332646344|gb|AEE79865.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42572723|ref|NP_974457.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332646343|gb|AEE79864.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357444885|ref|XP_003592720.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355481768|gb|AES62971.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query557
TAIR|locus:2077735590 AT3G59040 "AT3G59040" [Arabido 0.843 0.796 0.779 1.8e-197
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.678 0.461 0.271 3.8e-44
TAIR|locus:2157607709 AT5G42310 [Arabidopsis thalian 0.784 0.616 0.256 2.1e-41
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.775 0.578 0.262 1.3e-39
TAIR|locus:2054331 822 EMB2654 "EMBRYO DEFECTIVE 2654 0.680 0.461 0.258 1.8e-39
TAIR|locus:2177028816 AT5G12100 [Arabidopsis thalian 0.800 0.546 0.267 2.3e-39
TAIR|locus:2061310 918 GUN1 "AT2G31400" [Arabidopsis 0.624 0.379 0.280 3.3e-39
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.761 0.673 0.246 2e-38
TAIR|locus:2178037678 AT5G39980 [Arabidopsis thalian 0.734 0.603 0.242 5.8e-38
TAIR|locus:2174008 974 AT5G61990 "AT5G61990" [Arabido 0.617 0.353 0.274 9.6e-38
TAIR|locus:2077735 AT3G59040 "AT3G59040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1912 (678.1 bits), Expect = 1.8e-197, P = 1.8e-197
 Identities = 367/471 (77%), Positives = 417/471 (88%)

Query:     1 MGMLAPRKFMQKRRKVEVFKDAADEAGKKNWRRLMNQIEEVGSAVAVLRSERTRG-QPLP 59
             MGMLAPRKF+QKRRK+EVFKDAADE  +K WR LM +IE  GSAV VLR  +T G Q LP
Sbjct:    50 MGMLAPRKFLQKRRKMEVFKDAADETDQKRWRGLMLEIESTGSAVPVLRQYKTDGDQGLP 109

Query:    60 KDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMDFLMLITAYGKQGDFNKAEKVL 119
             +DLVLGTLVR KQLKKWN+VSE+LEWLR Q+WW+F+E+DFLMLITAYGK G+FN AE+VL
Sbjct:   110 RDLVLGTLVRFKQLKKWNLVSEILEWLRYQNWWNFSEIDFLMLITAYGKLGNFNGAERVL 169

Query:   120 SFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEA 179
             S ++K G  P+V+S+TALME+YGRGG+  NAEAIFRRMQSSGP PSA+TYQIILK FVE 
Sbjct:   170 SVLSKMGSTPNVISYTALMESYGRGGKCNNAEAIFRRMQSSGPEPSAITYQIILKTFVEG 229

Query:   180 NKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQST 239
             +KFKEAEEVF TLLDE+KSPLKPDQKM+HMMIYMYKKAG YEKARK+F+ M  +GV QST
Sbjct:   230 DKFKEAEEVFETLLDEKKSPLKPDQKMYHMMIYMYKKAGNYEKARKVFSSMVGKGVPQST 289

Query:   240 VTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLD 299
             VTYNSLMSFET+YKEVSKIYDQMQR+ +QPDVVSYALLI AYG+ARREEEAL+VFEEMLD
Sbjct:   290 VTYNSLMSFETSYKEVSKIYDQMQRSDIQPDVVSYALLIKAYGRARREEEALSVFEEMLD 349

Query:   300 AGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEG 359
             AGVRPTHKAYNILLDAFAISGMV+QA+TVFK MRRDR  PD+ SYTTMLSAYVNASDMEG
Sbjct:   350 AGVRPTHKAYNILLDAFAISGMVEQAKTVFKSMRRDRIFPDLWSYTTMLSAYVNASDMEG 409

Query:   360 AEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMD 419
             AEKFF+R+K DGF PN++TYGTLIKGYAK N++EKMME+Y+KMR++GIK NQTI TTIMD
Sbjct:   410 AEKFFKRIKVDGFEPNIVTYGTLIKGYAKANDVEKMMEVYEKMRLSGIKANQTILTTIMD 469

Query:   420 AYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLG 470
             A G+ K+F SA+ WYKEMESCG PPDQKAKN+LLSLA T DE  EA EL G
Sbjct:   470 ASGRCKNFGSALGWYKEMESCGVPPDQKAKNVLLSLASTQDELEEAKELTG 520


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157607 AT5G42310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054331 EMB2654 "EMBRYO DEFECTIVE 2654" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177028 AT5G12100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061310 GUN1 "AT2G31400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178037 AT5G39980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174008 AT5G61990 "AT5G61990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LYT2PP287_ARATHNo assigned EC number0.72480.92810.8867yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-26
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-21
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-19
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-18
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-18
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-17
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-15
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-12
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-09
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 7e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-04
pfam10446 449 pfam10446, DUF2457, Protein of unknown function (D 3e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 7e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam09538104 pfam09538, FYDLN_acid, Protein of unknown function 0.001
pfam09538104 pfam09538, FYDLN_acid, Protein of unknown function 0.001
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.002
PHA0260880 PHA02608, 67, prohead core protein; Provisional 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.003
pfam0153531 pfam01535, PPR, PPR repeat 0.004
pfam09538104 pfam09538, FYDLN_acid, Protein of unknown function 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  113 bits (285), Expect = 3e-26
 Identities = 73/352 (20%), Positives = 158/352 (44%), Gaps = 8/352 (2%)

Query: 99  FLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQ 158
           F ML++      D + A +VL  + + G       +T L+    + G+      +F  M 
Sbjct: 440 FNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMV 499

Query: 159 SSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAG 218
           ++G   +  T+  ++     A +  +A   +  +  +    +KPD+ +F+ +I    ++G
Sbjct: 500 NAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKN---VKPDRVVFNALISACGQSG 556

Query: 219 GYEKARKLFALM-AE-RGVQQSTVTYNSLMSFETNYKEVSK---IYDQMQRAGLQPDVVS 273
             ++A  + A M AE   +    +T  +LM    N  +V +   +Y  +    ++     
Sbjct: 557 AVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEV 616

Query: 274 YALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMR 333
           Y + +N+  +    + AL+++++M   GV+P    ++ L+D    +G +D+A  + +  R
Sbjct: 617 YTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDAR 676

Query: 334 RDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLE 393
           +        SY++++ A  NA + + A + +  +K     P V T   LI    + N L 
Sbjct: 677 KQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLP 736

Query: 394 KMMEIYDKMRVNGIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPD 445
           K +E+  +M+  G+ PN   ++ ++ A  +  D D  +    + +  G  P+
Sbjct: 737 KALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPN 788


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 557
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.96
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.88
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.81
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.8
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.78
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.74
KOG1915677 consensus Cell cycle control protein (crooked neck 99.72
KOG2076 895 consensus RNA polymerase III transcription factor 99.68
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.66
KOG2003840 consensus TPR repeat-containing protein [General f 99.65
KOG2076 895 consensus RNA polymerase III transcription factor 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
KOG2003840 consensus TPR repeat-containing protein [General f 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.63
KOG1126638 consensus DNA-binding cell division cycle control 99.62
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.62
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.62
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.61
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.6
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.6
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.59
KOG1915677 consensus Cell cycle control protein (crooked neck 99.58
KOG0547606 consensus Translocase of outer mitochondrial membr 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.54
KOG1126638 consensus DNA-binding cell division cycle control 99.52
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.51
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.46
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.44
KOG0547606 consensus Translocase of outer mitochondrial membr 99.43
KOG1129478 consensus TPR repeat-containing protein [General f 99.43
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
PRK12370553 invasion protein regulator; Provisional 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.39
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.39
PRK12370553 invasion protein regulator; Provisional 99.38
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.36
KOG2376652 consensus Signal recognition particle, subunit Srp 99.35
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.34
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.33
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.33
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.32
KOG1129478 consensus TPR repeat-containing protein [General f 99.29
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.29
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.29
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.26
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.26
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.26
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.24
PF1304150 PPR_2: PPR repeat family 99.22
PF1304150 PPR_2: PPR repeat family 99.21
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.19
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.16
PRK11189296 lipoprotein NlpI; Provisional 99.16
PRK11189296 lipoprotein NlpI; Provisional 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.14
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.13
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.11
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.09
KOG2376652 consensus Signal recognition particle, subunit Srp 99.08
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.96
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.94
PRK04841903 transcriptional regulator MalT; Provisional 98.93
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.92
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.92
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.88
KOG1125579 consensus TPR repeat-containing protein [General f 98.86
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.85
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.83
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.83
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.8
PRK04841903 transcriptional regulator MalT; Provisional 98.79
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.78
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.77
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.67
PLN02789320 farnesyltranstransferase 98.67
KOG1125579 consensus TPR repeat-containing protein [General f 98.67
KOG1128777 consensus Uncharacterized conserved protein, conta 98.66
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.66
PRK10370198 formate-dependent nitrite reductase complex subuni 98.64
PLN02789320 farnesyltranstransferase 98.63
KOG1128777 consensus Uncharacterized conserved protein, conta 98.63
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.6
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.59
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.59
PRK15359144 type III secretion system chaperone protein SscB; 98.59
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.59
PRK10370198 formate-dependent nitrite reductase complex subuni 98.58
PF1285434 PPR_1: PPR repeat 98.57
PF1285434 PPR_1: PPR repeat 98.54
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.51
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.5
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.46
PRK15359144 type III secretion system chaperone protein SscB; 98.45
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.44
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.42
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.42
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.42
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.4
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.37
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.35
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.28
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.15
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.1
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.06
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.98
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.96
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.94
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.93
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.92
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.91
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.9
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.88
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.88
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.85
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.84
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.82
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.77
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.75
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.73
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.72
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.71
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.61
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.61
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.59
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.58
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.56
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.56
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.54
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.52
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.52
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.51
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.51
COG4700251 Uncharacterized protein conserved in bacteria cont 97.51
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.5
PF12688120 TPR_5: Tetratrico peptide repeat 97.49
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.47
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.45
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.44
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.41
KOG0553304 consensus TPR repeat-containing protein [General f 97.41
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.38
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.37
COG4700251 Uncharacterized protein conserved in bacteria cont 97.37
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.27
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.27
PF12688120 TPR_5: Tetratrico peptide repeat 97.26
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.25
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.2
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.2
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.19
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.12
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.07
KOG20411189 consensus WD40 repeat protein [General function pr 97.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.02
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.01
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.0
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.96
COG3898531 Uncharacterized membrane-bound protein [Function u 96.96
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.9
PRK10803263 tol-pal system protein YbgF; Provisional 96.89
PRK15331165 chaperone protein SicA; Provisional 96.88
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.88
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.85
PRK10803263 tol-pal system protein YbgF; Provisional 96.84
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.78
PF1337173 TPR_9: Tetratricopeptide repeat 96.77
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.76
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.71
PF1337173 TPR_9: Tetratricopeptide repeat 96.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.52
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.52
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.47
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.46
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.4
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.31
PRK15331165 chaperone protein SicA; Provisional 96.23
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.11
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.96
KOG20411189 consensus WD40 repeat protein [General function pr 95.93
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.9
KOG4555175 consensus TPR repeat-containing protein [Function 95.86
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.84
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.79
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.65
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.64
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.63
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.58
COG3898531 Uncharacterized membrane-bound protein [Function u 95.57
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.55
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.47
KOG1585308 consensus Protein required for fusion of vesicles 95.42
KOG3941 406 consensus Intermediate in Toll signal transduction 95.27
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.23
smart00299140 CLH Clathrin heavy chain repeat homology. 95.06
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.05
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.99
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.95
KOG3941406 consensus Intermediate in Toll signal transduction 94.94
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.9
PF13512142 TPR_18: Tetratricopeptide repeat 94.87
PF1342844 TPR_14: Tetratricopeptide repeat 94.73
KOG1941518 consensus Acetylcholine receptor-associated protei 94.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.65
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.61
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.59
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.56
PRK11906458 transcriptional regulator; Provisional 94.55
KOG4555175 consensus TPR repeat-containing protein [Function 94.52
PRK11906458 transcriptional regulator; Provisional 94.46
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.37
KOG1941518 consensus Acetylcholine receptor-associated protei 94.37
PF13512142 TPR_18: Tetratricopeptide repeat 94.32
PF1342844 TPR_14: Tetratricopeptide repeat 94.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.24
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.14
smart00299140 CLH Clathrin heavy chain repeat homology. 93.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.78
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.59
KOG1585308 consensus Protein required for fusion of vesicles 93.25
PF13929292 mRNA_stabil: mRNA stabilisation 93.02
KOG1258577 consensus mRNA processing protein [RNA processing 92.81
COG3629280 DnrI DNA-binding transcriptional activator of the 92.61
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.52
KOG1258577 consensus mRNA processing protein [RNA processing 92.51
COG3629280 DnrI DNA-binding transcriptional activator of the 92.32
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.26
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.23
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.23
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.19
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.16
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.15
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.04
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 91.96
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.95
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.94
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.61
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.52
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.0
PF13929292 mRNA_stabil: mRNA stabilisation 90.8
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.95
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.88
PF1343134 TPR_17: Tetratricopeptide repeat 89.66
KOG1550552 consensus Extracellular protein SEL-1 and related 89.62
PF1343134 TPR_17: Tetratricopeptide repeat 89.33
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.21
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.92
PF06552186 TOM20_plant: Plant specific mitochondrial import r 88.79
KOG4234271 consensus TPR repeat-containing protein [General f 88.78
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 88.67
KOG4570 418 consensus Uncharacterized conserved protein [Funct 88.64
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 88.48
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.41
KOG4234271 consensus TPR repeat-containing protein [General f 88.4
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.18
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.64
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.63
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 87.33
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 87.27
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.26
COG4455273 ImpE Protein of avirulence locus involved in tempe 87.08
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.17
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 86.01
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.98
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.93
KOG4570418 consensus Uncharacterized conserved protein [Funct 85.91
KOG1586288 consensus Protein required for fusion of vesicles 85.7
KOG1550552 consensus Extracellular protein SEL-1 and related 85.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.48
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.74
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.22
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.89
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.88
KOG4648 536 consensus Uncharacterized conserved protein, conta 82.91
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.89
PRK09687280 putative lyase; Provisional 82.81
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 82.78
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 82.41
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 81.54
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 80.09
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 80.09
COG4455273 ImpE Protein of avirulence locus involved in tempe 80.05
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.5e-67  Score=560.91  Aligned_cols=503  Identities=18%  Similarity=0.238  Sum_probs=464.8

Q ss_pred             hhhhhccchhchhcchhHHHHHHHHHhhC---hHHHHHHHhhhcCCCCChHHHHHHHH-HhhhccchHHHHHHHHHHHhc
Q 008708           14 RKVEVFKDAADEAGKKNWRRLMNQIEEVG---SAVAVLRSERTRGQPLPKDLVLGTLV-RLKQLKKWNVVSEVLEWLRIQ   89 (557)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~a~~~~~~~~~~~~~~~~~~~~~~l~-~~~~~~~~~~a~~~~~~~~~~   89 (557)
                      .+..+|+ .++.+|+++||.+++++.+.+   +|+.+|.. +...+..|+..++.++. .+...++.+.+.+++..+.+.
T Consensus       240 ~A~~lf~-~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~-M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~  317 (857)
T PLN03077        240 SARLVFD-RMPRRDCISWNAMISGYFENGECLEGLELFFT-MRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKT  317 (857)
T ss_pred             HHHHHHh-cCCCCCcchhHHHHHHHHhCCCHHHHHHHHHH-HHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHh
Confidence            7888994 458999999999999998766   77888884 46677888888887776 467889999999999999988


Q ss_pred             CCCCCCHhhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHH
Q 008708           90 SWWDFNEMDFLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTY  169 (557)
Q Consensus        90 ~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~  169 (557)
                      + +.++..+|+.|+.+|++.|++++|.++|++|..    ||..+||.+|.+|++.|++++|+++|++|.+.|+.||..||
T Consensus       318 g-~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~----~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~  392 (857)
T PLN03077        318 G-FAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMET----KDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITI  392 (857)
T ss_pred             C-CccchHHHHHHHHHHHhcCCHHHHHHHHhhCCC----CCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeH
Confidence            6 789999999999999999999999999999974    79999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHhHhccCCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHhcc-
Q 008708          170 QIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSF-  248 (557)
Q Consensus       170 ~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~ll~~-  248 (557)
                      +.++.+|++.|+++.|.++++.+.   +.+..|+..+++.|+++|++.|++++|.++|++|.+    ++..+|+.++.+ 
T Consensus       393 ~~ll~a~~~~g~~~~a~~l~~~~~---~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~----~d~vs~~~mi~~~  465 (857)
T PLN03077        393 ASVLSACACLGDLDVGVKLHELAE---RKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPE----KDVISWTSIIAGL  465 (857)
T ss_pred             HHHHHHHhccchHHHHHHHHHHHH---HhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCC----CCeeeHHHHHHHH
Confidence            999999999999999999999998   467899999999999999999999999999999875    588999999986 


Q ss_pred             --cCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHH
Q 008708          249 --ETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQAR  326 (557)
Q Consensus       249 --~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~  326 (557)
                        .++.++|..+|++|.. ++.||..||+.++.+|++.|..+.+.+++..+.+.|+.++..++++|+.+|+++|++++|.
T Consensus       466 ~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~  544 (857)
T PLN03077        466 RLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAW  544 (857)
T ss_pred             HHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHH
Confidence              5889999999999986 5899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH-HC
Q 008708          327 TVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMR-VN  405 (557)
Q Consensus       327 ~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~m~-~~  405 (557)
                      .+|+.+     .||..+||++|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|++.|.+++|.++|+.|. +.
T Consensus       545 ~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~  619 (857)
T PLN03077        545 NQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKY  619 (857)
T ss_pred             HHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHh
Confidence            999987     579999999999999999999999999999999999999999999999999999999999999999 68


Q ss_pred             CCCcCHHHHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHhcCCCCCCCCcccce
Q 008708          406 GIKPNQTIFTTIMDAYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNEPGINGLS  485 (557)
Q Consensus       406 ~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~  485 (557)
                      |+.|+..+|++++.+|++.|++++|.+++++|.   +.||..+|.+|+.+|..+|+.+.++...+++.+..+......  
T Consensus       620 gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~---~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y--  694 (857)
T PLN03077        620 SITPNLKHYACVVDLLGRAGKLTEAYNFINKMP---ITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYY--  694 (857)
T ss_pred             CCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCC---CCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchH--
Confidence            999999999999999999999999999999994   799999999999999999999999999888876555322222  


Q ss_pred             eeccCCCCCCCCCCCCcccccccCCCCCC-----CCCCccchhhhhhccCCCcc-----eeeecCCcccccccccccccc
Q 008708          486 ISVDEEDDDDDDDEDDDDNIYHDGDGDGD-----GDDNEDDAEETIACSGKEDE-----LIFFNGDHQRSQEGLHTLQTV  555 (557)
Q Consensus       486 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~s~i~~~-----~~~~~~~~~~~~~~~~~l~~~  555 (557)
                      .+              +.|+|...|+|++     +.|++++++|.|||||||++     |..+|.+||++.+||..|+.+
T Consensus       695 ~l--------------l~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l  760 (857)
T PLN03077        695 IL--------------LCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGF  760 (857)
T ss_pred             HH--------------HHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHH
Confidence            11              6799999999999     58999999999999999997     888999999999999998865



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query557
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 81.0 bits (198), Expect = 4e-16
 Identities = 35/354 (9%), Positives = 95/354 (26%), Gaps = 43/354 (12%)

Query: 115 AEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILK 174
           A  +     +   +P       L++           +A   +   +             K
Sbjct: 76  AGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFK 135

Query: 175 LFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERG 234
             +  ++   A  + +    + +        M++ ++  + + G +++   +  ++ +  
Sbjct: 136 CCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKD-- 193

Query: 235 VQQSTVTYNSLMSFETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYGKARREEEALA-V 293
                                         AGL PD++SYA  +   G+  ++   +   
Sbjct: 194 ------------------------------AGLTPDLLSYAAALQCMGRQDQDAGTIERC 223

Query: 294 FEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVN 353
            E+M   G++       +LL     + ++     V          P   + + +L     
Sbjct: 224 LEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYA 283

Query: 354 ASDMEGAEKFFRRLKQDGFVPNV-----ITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIK 408
                   K    LK    +        +     +    K     K ++   K       
Sbjct: 284 KDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKPTLPSKEVKHARKTLKTLRD 343

Query: 409 PNQTIFTTIMD---AYGKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTA 459
             +      +       + + ++     Y  +  C     +  + +L  L    
Sbjct: 344 QWEKALCRALRETKNRLEREVYEGRFSLYPFL--CLLDEREVVRMLLQVLQALP 395


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.85
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.7
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.67
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.61
3u4t_A272 TPR repeat-containing protein; structural genomics 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.61
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.55
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.51
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.51
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.5
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.49
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.49
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.46
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.42
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.39
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.38
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.27
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.27
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.26
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.25
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.1
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.09
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.07
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.01
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.01
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.98
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.97
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.92
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.91
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.91
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.9
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.89
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.88
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.87
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.83
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.77
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.76
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.72
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.68
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.63
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.63
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.62
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.59
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.59
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.59
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.59
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.57
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.56
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.55
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.54
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.54
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.54
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.54
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.5
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.5
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.47
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.41
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.39
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.38
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.37
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.37
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.34
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.32
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.29
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.24
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.23
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.2
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.17
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.15
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.14
3k9i_A117 BH0479 protein; putative protein binding protein, 98.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.13
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.07
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.06
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.02
3k9i_A117 BH0479 protein; putative protein binding protein, 98.02
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.96
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.94
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.93
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.91
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.83
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.81
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.71
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.67
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.63
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.6
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.59
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.53
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.37
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.35
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.33
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.29
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.98
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.94
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.93
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.88
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.83
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.6
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.55
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.47
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.31
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.06
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.05
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.94
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.85
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.48
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.4
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.7
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.7
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.22
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.74
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.31
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.27
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.8
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.59
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.02
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 88.94
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.89
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.6
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.73
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.51
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.89
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.17
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.06
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.65
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 84.95
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 84.78
2p58_C116 Putative type III secretion protein YSCG; type III 83.8
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.43
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.94
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.63
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 80.61
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.1e-35  Score=309.96  Aligned_cols=440  Identities=10%  Similarity=0.005  Sum_probs=366.5

Q ss_pred             hhchhcchhHHHHHHHHHhhC---hHHHHHHHhhhcCCCCChHHHHHHHHHhhhccchHHHHHHHHHHHhcCCCCCCHhh
Q 008708           22 AADEAGKKNWRRLMNQIEEVG---SAVAVLRSERTRGQPLPKDLVLGTLVRLKQLKKWNVVSEVLEWLRIQSWWDFNEMD   98 (557)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~~~~---~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~   98 (557)
                      ..+.+++..|+.++..+.+.+   +|+..++.+. ...+ .+...+.....+...|+++.|.++|+.+...   +.+..+
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~-~~~p-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~---~~~~~~  152 (597)
T 2xpi_A           78 TDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVL-DITG-NPNDAFWLAQVYCCTGDYARAKCLLTKEDLY---NRSSAC  152 (597)
T ss_dssp             ----CHHHHHHHHHHHHHHTTCHHHHHHHHHHHH-HHHC-CHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG---GTCHHH
T ss_pred             cchHHHHHHHHHHHHHHHHccCchHHHHHHHHHH-hhCC-CchHHHHHHHHHHHcCcHHHHHHHHHHHhcc---ccchhH
Confidence            346678999999999887655   6777777543 2222 2233344445677889999999999987544   367889


Q ss_pred             HHHHHHHHHhcCChhHHHHHHHHHHhC---------------CCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCC
Q 008708           99 FLMLITAYGKQGDFNKAEKVLSFMNKK---------------GYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPR  163 (557)
Q Consensus        99 ~~~l~~~~~~~g~~~~A~~~~~~~~~~---------------g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~  163 (557)
                      ++.++.+|.+.|++++|.++|+++...               +.+++..+|+.++.+|.+.|++++|+++|++|.+.++.
T Consensus       153 ~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~  232 (597)
T 2xpi_A          153 RYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK  232 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch
Confidence            999999999999999999999953221               22345889999999999999999999999999886543


Q ss_pred             CCHHHHHHH--------------------------------------HHHHHHcCCHHHHHHHHHHhHhccCCCCCCCHH
Q 008708          164 PSALTYQII--------------------------------------LKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQK  205 (557)
Q Consensus       164 ~~~~~~~~l--------------------------------------l~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  205 (557)
                       +...+..+                                      +..|.+.|++++|.++|+++.+.     +++..
T Consensus       233 -~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~-----~~~~~  306 (597)
T 2xpi_A          233 -CYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL-----EKSSD  306 (597)
T ss_dssp             -CHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG-----GGCHH
T ss_pred             -hhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC-----CchHH
Confidence             44443333                                      44566789999999999999742     58899


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHhcc---cCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q 008708          206 MFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMSF---ETNYKEVSKIYDQMQRAGLQPDVVSYALLINAYG  282 (557)
Q Consensus       206 ~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~ll~~---~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~  282 (557)
                      +++.++.+|.+.|++++|..+|+++.+.+.. +..+++.+...   .|++++|..+++.+.+.. +.+..++..++.+|.
T Consensus       307 ~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~  384 (597)
T 2xpi_A          307 LLLCKADTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYL  384 (597)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHH
Confidence            9999999999999999999999999977543 45556555543   699999999999998764 447889999999999


Q ss_pred             hcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHH
Q 008708          283 KARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDICSYTTMLSAYVNASDMEGAEK  362 (557)
Q Consensus       283 ~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~  362 (557)
                      +.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|..+|+++.+.. +.+..+|+.++.+|.+.|++++|.+
T Consensus       385 ~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~  462 (597)
T 2xpi_A          385 CVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANE  462 (597)
T ss_dssp             HTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHH
T ss_pred             HhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHH
Confidence            9999999999999998753 4568899999999999999999999999998764 4578999999999999999999999


Q ss_pred             HHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHC----CCCcC--HHHHHHHHHHHHhcCChhHHHHHHHH
Q 008708          363 FFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVN----GIKPN--QTIFTTIMDAYGKNKDFDSAVVWYKE  436 (557)
Q Consensus       363 ~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~----~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~  436 (557)
                      +|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|..++++
T Consensus       463 ~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  541 (597)
T 2xpi_A          463 YLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQ  541 (597)
T ss_dssp             HHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHH
Confidence            999999875 668999999999999999999999999999875    56777  78999999999999999999999999


Q ss_pred             HHhCCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHhcCCCCCC
Q 008708          437 MESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHPNNE  478 (557)
Q Consensus       437 m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~  478 (557)
                      +.+.+ +.+..+|..+..+|.+.|++++|.+.++++.+.++.
T Consensus       542 ~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          542 GLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             HHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCC
Confidence            98854 557899999999999999999999999998765553



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 557
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1qkla_127 a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 1e-04
 Identities = 53/343 (15%), Positives = 108/343 (31%), Gaps = 19/343 (5%)

Query: 99  FLMLITAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAY-GRGGRYKNAEAIFRRM 157
            L+L + + +    +++              ++  +  L EAY   G  YK    +   +
Sbjct: 36  LLLLSSIHFQCRRLDRSAHF--------STLAIKQNPLLAEAYSNLGNVYKERGQLQEAI 87

Query: 158 QSSGPRPSALTYQIILKLFVEANKFKEAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKA 217
           +            I   + + A      +               PD       +    KA
Sbjct: 88  EHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKA 147

Query: 218 GGYEKARKLFALMAERGVQQSTVTYNSLMSFETNYKEVSKIYDQMQRA-GLQPDVV-SYA 275
            G  +  K   L A        V +++L        E+       ++A  L P+ + +Y 
Sbjct: 148 LGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYI 207

Query: 276 LLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVF-KCMRR 334
            L N   +AR  + A+A +   L          +  L   +   G++D A   + + +  
Sbjct: 208 NLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL 266

Query: 335 DRCSPDICSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEK 394
               PD  +Y  + +A      +  AE  +    +            L     +  N+E+
Sbjct: 267 QPHFPD--AYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLN-NLANIKREQGNIEE 323

Query: 395 MMEIYDKMRVNGIKPNQ-TIFTTIMDAYGKNKDFDSAVVWYKE 436
            + +Y K     + P      + +     +      A++ YKE
Sbjct: 324 AVRLYRK--ALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE 364


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query557
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.32
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.28
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.23
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.22
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.09
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.05
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.03
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.79
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.69
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.51
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.49
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.45
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.38
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.36
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.29
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.13
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.09
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.08
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.03
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.96
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.92
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.9
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.84
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.71
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.6
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.59
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.57
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.51
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.51
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.31
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.22
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.19
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.7
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.29
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.65
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.12
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.97
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.64
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.46
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 89.82
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.43
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.45
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=3.4e-21  Score=186.05  Aligned_cols=360  Identities=13%  Similarity=0.056  Sum_probs=160.3

Q ss_pred             HHHHhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHH
Q 008708          104 TAYGKQGDFNKAEKVLSFMNKKGYAPSVVSHTALMEAYGRGGRYKNAEAIFRRMQSSGPRPSALTYQIILKLFVEANKFK  183 (557)
Q Consensus       104 ~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~ll~~~~~~g~~~  183 (557)
                      ..+.+.|++++|.+.|+++.+.. |.+..++..+..+|.+.|++++|+..|++.++..+. +..++..+..++.+.|+++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhcccc
Confidence            33444455555555555444432 223444444444555555555555555544443222 3444444444455555555


Q ss_pred             HHHHHHHHhHhccCCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCHHHHHHHhc--ccCCHHHHHHHHHH
Q 008708          184 EAEEVFMTLLDEEKSPLKPDQKMFHMMIYMYKKAGGYEKARKLFALMAERGVQQSTVTYNSLMS--FETNYKEVSKIYDQ  261 (557)
Q Consensus       184 ~A~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~ll~--~~~~~~~a~~~~~~  261 (557)
                      +|...+....+..    +.+..............+....+........................  ..+....+...+..
T Consensus        85 ~A~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          85 EAIEHYRHALRLK----PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             HHHHHHHHHHHHC----TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             ccccccccccccc----cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHH
Confidence            5555554444321    22233333333333333333333333333333222222222111111  12333333333333


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCH
Q 008708          262 MQRAGLQPDVVSYALLINAYGKARREEEALAVFEEMLDAGVRPTHKAYNILLDAFAISGMVDQARTVFKCMRRDRCSPDI  341 (557)
Q Consensus       262 ~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~  341 (557)
                      ..... +.+...+..+...+...|++++|...+.+..+.. +.+...+..+...+...|++++|...+++..... +.+.
T Consensus       161 ~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~  237 (388)
T d1w3ba_         161 AIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHA  237 (388)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCH
T ss_pred             hhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHH
Confidence            33322 1133444444555555555555555555544432 2233444455555555555555555555544332 2234


Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHH
Q 008708          342 CSYTTMLSAYVNASDMEGAEKFFRRLKQDGFVPNVITYGTLIKGYAKVNNLEKMMEIYDKMRVNGIKPNQTIFTTIMDAY  421 (557)
Q Consensus       342 ~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~l~~~~  421 (557)
                      ..+..+...+.+.|++++|+..|+++.+.. +.+..++..+..++...|++++|.+.++...... +.+...+..+..++
T Consensus       238 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~  315 (388)
T d1w3ba_         238 VVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIK  315 (388)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHH
Confidence            444445555555555555555555554442 3344445555555555555555555555544431 33444455555555


Q ss_pred             HhcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHhhcCCHHHHHHHHHhcCCC
Q 008708          422 GKNKDFDSAVVWYKEMESCGFPPDQKAKNILLSLAKTADERNEANELLGNFNHP  475 (557)
Q Consensus       422 ~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~  475 (557)
                      ...|++++|+..+++.++.. |-+..++..+..++...|++++|...++++.+.
T Consensus       316 ~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l  368 (388)
T d1w3ba_         316 REQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI  368 (388)
T ss_dssp             HTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT
T ss_pred             HHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Confidence            55555555555555554421 122334444555555555555555555554433



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure