Citrus Sinensis ID: 008751

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-----

MKSSYTVSLCEAAQHADDEVVEVIHIPDDENSHGVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEENSTLRELSEGEGHDEMPSNQDMHNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRRKFKVVASSDSEDELIRNKSPVAERDINSKFLSENHSRFPSHFSNAQNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIGTYVSVDISCVPESSFVPETDIDNGAELLSGKECSGCVAEAVEVSVANEFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAESSHMEEVEDSQNEHVETIPRVYQLMDECSRMDFKRRSKLEELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQSPVSFIF

cccccccHHHHccccccHHHHHHHcccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHcccccccEEEcccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHHccccccHHHHHHHHHHccccccccccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccHHHHHHHHHcccccccccc

ccccccEEEcccccccccccEEEEcccccccccccccccccccEEEEEEEcccEEccccHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHccccHHHcccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccEcccccccccccccccccccccccccccccHHHccHHHccccccccccccccccccccccccccccccccEcccccEEccccccccccccccEEEEEccccEcccEEEEcccccEcccccccccccccHHHccccccHHcccccccHHHHHccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHcccccEEcc

MKSSYTVSLCEAAQHADDEVVEVihipddenshgvmgksdnhvkpliliedvdvffpedrgFIAGIQQIAEkakgpviltsnsnnitlpdsldrlevsftmpmpkDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCqnkgygkdkklqklyvpelfdpdaghhmlpkkipwgfpsqlSELVVKEIMKSLSLMEENSTLrelsegeghdempsnqdmhnnpadsvEAKKEEMLNMNssvhtnneledplgneceisnlphtpvsfsrknnrrkfkvvassdsedelirnkspvaerdinskflsenhsrfpshfsnaqncknppidklhyplkeklegshylcsevandlqiGTYVSVDiscvpessfvpetdidngaellsgkecsgCVAEAVEVSVanefdlnlppvgadnnsmlemhrnpDMLEKFCAVIAEsshmeevedsqnehVETIPRVYQLMDECSRMDFKRRSKLEELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLskcqspvsfif

MKSSYTVSLCEAAQHADDEVVEVIHIPddenshgvmgkSDNHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKakgpviltsnsnnitlpdSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEENSTLRELSEGEGhdempsnqdmhNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPhtpvsfsrknnrrkfkvvassdsedelirnkspvaerdiNSKFLSENHSRFPSHFSNAQNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIGTYVSVDISCVPESSFVPETDIDNGAELLSGKECSGCVAEAVEVSVANEFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAESSHmeevedsqnehvETIPRVYQLMDECSRMDFKRRskleelrsqeaidLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQSPVSFIF

MKSSYTVSLCEAAQHADDEVVEVIHIPDDENSHGVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEENSTLRELSEGEGHDEMPSNQDMHNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRRKFKVVASSDSEDELIRNKSPVAERDINSKFLSENHSRFPSHFSNAQNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIGTYVSVDISCVPESSFVPETDIDNGAELLSGKECSGCvaeavevsvaneFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAESSHMEEVEDSQNEHVETIPRVYQLMDECSRMDFKRRSKLEELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQSPVSFIF

********LCEAAQHADDEVVEVIHIP*************NHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIM******************************************************************************************************************************************DKLHYPLKEKLEGSHYLCSEVANDLQIGTYVSVDISCVPESSFVPETDIDNGAELLSGKECSGCVAEAVEVSVANEFDLNLPPV***************MLEKFCAVIA******************IPRVYQLMD*********************IDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQ*******

**SSYTVSLCEAAQHADDEVV************************LILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKG******LQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEENSTLRELSEGEGHDEMPSN***********************************GN************************************RN********************************************************VANDLQIGTYVSVDISCVPESSFVPETDIDN********************SVANEFDLNLPPVGA******************CAVIAESS*ME*****QNEHVETIPRVYQLMDECSRMDFK***************LVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQSPVSFIF

**********EAAQHADDEVVEVIHIPDDENSHGVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEEN****************SNQDMHNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRR***************RNKSPVAERDINSKFLSENHSRFPSHFSNAQNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIGTYVSVDISCVPESSFVPETDIDNGAELLSGKECSGCVAEAVEVSVANEFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAES************HVETIPRVYQLMDECSRMDFKRRSKLEELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQSPVSFIF

**SSYTVSLCEAAQHADDEVVEVIHIPD************NHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEENSTLRELSEGEGHDEMPSNQDMHNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRRKFKVVASS***D*LIRNKSPVAERDINSKFLSENHSRFPSHFS**QNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIGTYVSVDISCVPESSFVPETDIDNGAELLSGKECSGCVAEAVEVSVANEFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAESSHMEEVEDSQNEHVETIPRVYQLMDECSRMDFKRRSKLEELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADLLLSKCQSPVSFIF

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		555	2.2.26 [Sep-21-2011]
Q96QE3		1844	ATPase family AAA domain-	yes	no	0.216	0.065	0.366	2e-14
Q4QY64		1826	ATPase family AAA domain-	yes	no	0.194	0.059	0.370	2e-13
O43086		920	Telomere length regulatio	yes	no	0.183	0.110	0.285	3e-07
P38630		861	Replication factor C subu	yes	no	0.232	0.149	0.286	5e-07
Q12050		791	Telomere length regulatio	no	no	0.174	0.122	0.307	1e-06
Q8TZC5		510	Replication factor C larg	yes	no	0.207	0.225	0.295	2e-05
Q9UXF6		405	Replication factor C larg	yes	no	0.192	0.264	0.353	0.0001
C3NHF4		405	Replication factor C larg	yes	no	0.196	0.269	0.342	0.0002
C4KHA7		405	Replication factor C larg	yes	no	0.196	0.269	0.342	0.0002
C3NE95		405	Replication factor C larg	yes	no	0.196	0.269	0.342	0.0002

>sp\|Q96QE3\|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens GN=ATAD5 PE=1 SV=4	Back alignment and function desciption

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 63/120 (52%)

Query: 34   GVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLD 93
            G    S  +   LIL E+VDV F ED GF+  I+      K PVILT++    +L     
Sbjct: 1289 GAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKRPVILTTSDPTFSLMFDGC 1348

Query: 94   RLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKG 153
              E+ F+ P   ++ S+LQMIC  E         V L+ +   DIRK+I++LQFW ++ G
Sbjct: 1349 FEEIKFSTPSLLNVASYLQMICLTENFRTDVKDFVTLLTANTCDIRKSILYLQFWIRSGG 1408

Involved in DNA damage response. Involved in a RAD9A-related damage checkpoint, a pathway that is important in determining whether DNA damage is compatible with cell survival or whether it requires cell elimination by apoptosis. Modulates the RAD9A interaction with BCL2 and thereby induces DNA damages-induced apoptosis.
Homo sapiens (taxid: 9606)

>sp\|Q4QY64\|ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus GN=Atad5 PE=1 SV=1	Back alignment and function description

>sp\|O43086\|ELG1_SCHPO Telomere length regulation protein elg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elg1 PE=1 SV=1	Back alignment and function description

>sp\|P38630\|RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1	Back alignment and function description

>sp\|Q12050\|ELG1_YEAST Telomere length regulation protein ELG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELG1 PE=1 SV=1	Back alignment and function description

>sp\|Q8TZC5\|RFCL_METKA Replication factor C large subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcL PE=3 SV=1	Back alignment and function description

>sp\|Q9UXF6\|RFCL_SULSO Replication factor C large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcL PE=1 SV=1	Back alignment and function description

>sp\|C3NHF4\|RFCL_SULIN Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rfcL PE=3 SV=1	Back alignment and function description

>sp\|C4KHA7\|RFCL_SULIK Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rfcL PE=3 SV=1	Back alignment and function description

>sp\|C3NE95\|RFCL_SULIY Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rfcL PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		555
147794989		1170	hypothetical protein VITISV_006652 [Viti	0.976	0.463	0.478	1e-128
302141826		919	unnamed protein product [Vitis vinifera]	0.956	0.577	0.478	1e-125
224066839		1068	predicted protein [Populus trichocarpa]	0.947	0.492	0.457	1e-112
255545476		1247	hypothetical protein RCOM_1032100 [Ricin	0.888	0.395	0.440	1e-105
356507654		1199	PREDICTED: uncharacterized protein LOC10	0.935	0.432	0.433	2e-96
357461523		1283	ATPase family AAA domain-containing prot	0.909	0.393	0.409	1e-92
356518537		1197	PREDICTED: uncharacterized protein LOC10	0.933	0.432	0.409	4e-89
297789753		960	nucleoside-triphosphatase/ nucleotide bi	0.926	0.535	0.390	2e-84
15224020		1151	P-loop containing nucleoside triphosphat	0.920	0.443	0.389	3e-83
297842539		1154	nucleoside-triphosphatase/ nucleotide bi	0.926	0.445	0.385	4e-83

>gi\|147794989\|emb\|CAN67425.1\| hypothetical protein VITISV_006652 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 272/569 (47%), Positives = 353/569 (62%), Gaps = 27/569 (4%)

Query: 1   MKSSYTVSLCEAAQHADDEVVEVIHIPDDENSHGVMGKSDNHVK-------------PLI 47
           MKS   +    A Q  + +V+E+I   D+E+SH  +G  + H+               LI
Sbjct: 404 MKSFPALPNGTATQEFESKVIELIPSSDEEDSHDAIGTPEKHIHKKNRTACDRGETITLI 463

Query: 48  LIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDL 107
           L EDVD+ FPEDRG IA IQQ+AE AK P+ILTSNSNN  LPD+LDRLEV FT+P PK+L
Sbjct: 464 LFEDVDITFPEDRGLIAAIQQLAETAKRPIILTSNSNNPVLPDNLDRLEVCFTLPSPKEL 523

Query: 108 LSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPE 167
           L H  M+CAAEK  +Q  L+ + IE C+ DIRKT+MHLQFWCQ K Y +D+K  K+Y P 
Sbjct: 524 LCHAYMVCAAEKTNIQPWLIERFIEYCQGDIRKTLMHLQFWCQGKRYRQDRKAHKIYGPL 583

Query: 168 LFDPDAGHHMLPKKIPWGFPSQLSELVVKEIMKSLSLMEENSTLRELSEGEG--HDEMPS 225
            FD +AGH +LPK IPW FPSQLSELV KEI KSLS ME +S+  E+ + EG  + EM +
Sbjct: 584 SFDLEAGHQILPKIIPWDFPSQLSELVEKEIAKSLSKMEGDSSSMEVIKEEGLHNKEMQN 643

Query: 226 NQDMHNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRRK 285
             +MH+   DS+EAKKE M + N SV   N         CE+SN   +P +F+R+N RRK
Sbjct: 644 GLEMHDYEKDSIEAKKEAMFSRNCSVLDGNGFAAEFDIGCELSNSSGSPATFTRRNVRRK 703

Query: 286 FKVVASSDSEDELIRNKSPVAERDI----NSKFLSENHSRFPSHFSNAQNCKNPPIDKLH 341
              + SS+SEDE+  +  PV   ++    +S    +  S+FP H   + NC NP  D+L 
Sbjct: 704 LDTILSSNSEDEVFSDSFPVVSHNLLDGTDSGVFLDIDSKFP-HCQESNNCLNPFTDQLL 762

Query: 342 YPLKEKLEGSHYLCSEVANDLQI-GTYVSVDISCVPESSFVPETDIDNGAELLSGKECSG 400
           +  + K E + Y CSE AN L I  T  S DIS VPESSFVPET++ +G ELLS     G
Sbjct: 763 HSEEGKFEENRYQCSETANSLCIYDTCKSFDISRVPESSFVPETEMSDGTELLSVALSCG 822

Query: 401 CVAEAVE-VSVANEFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAESSHMEEVEDSQN 459
            VA+  E VS+ N+   NL  V A N         P + +    +I   S  EEV DSQN
Sbjct: 823 RVADIAETVSICNDLTQNLLQVEAKNPE----KSVPGLSQNLETMINGDSVNEEVGDSQN 878

Query: 460 EHVETIPRVYQLMDECSRMDFKRRSK-LEELRSQEAIDLVRESWKKLRDGNTDLRQYATL 518
           EHVE++ R Y +MDECSRM F   SK LE+ RS    + V+E+W+KLR  +TDLR+YA L
Sbjct: 879 EHVESVTREYPVMDECSRMAFTIGSKSLEDPRSWMVTNSVQETWRKLRGCHTDLRRYAIL 938

Query: 519 EKPNAFQIIKLTHGMCDLISEADLLLSKC 547
           E+ +A QI++LT+ M +LISEAD L   C
Sbjct: 939 EQRDASQIVELTYKMSNLISEADQLRYNC 967

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|302141826\|emb\|CBI19029.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224066839\|ref\|XP_002302240.1\| predicted protein [Populus trichocarpa] gi\|222843966\|gb\|EEE81513.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255545476\|ref\|XP_002513798.1\| hypothetical protein RCOM_1032100 [Ricinus communis] gi\|223546884\|gb\|EEF48381.1\| hypothetical protein RCOM_1032100 [Ricinus communis]	Back alignment and taxonomy information

>gi\|356507654\|ref\|XP_003522579.1\| PREDICTED: uncharacterized protein LOC100784209 [Glycine max]	Back alignment and taxonomy information

>gi\|357461523\|ref\|XP_003601043.1\| ATPase family AAA domain-containing protein [Medicago truncatula] gi\|355490091\|gb\|AES71294.1\| ATPase family AAA domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356518537\|ref\|XP_003527935.1\| PREDICTED: uncharacterized protein LOC100784968 [Glycine max]	Back alignment and taxonomy information

>gi\|297789753\|ref\|XP_002862810.1\| nucleoside-triphosphatase/ nucleotide binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297308545\|gb\|EFH39068.1\| nucleoside-triphosphatase/ nucleotide binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|15224020\|ref\|NP_177885.1\| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi\|12323399\|gb\|AAG51680.1\|AC010704_24 hypothetical protein; 83388-78455 [Arabidopsis thaliana] gi\|332197880\|gb\|AEE36001.1\| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297842539\|ref\|XP_002889151.1\| nucleoside-triphosphatase/ nucleotide binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297334992\|gb\|EFH65410.1\| nucleoside-triphosphatase/ nucleotide binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		555
TAIR\|locus:2204705		1151	AT1G77620 [Arabidopsis thalian	0.933	0.450	0.383	8.2e-85
UNIPROTKB\|J9NTZ2		1836	ATAD5 "Uncharacterized protein	0.230	0.069	0.359	2.2e-11
UNIPROTKB\|E2RCC4		1883	ATAD5 "Uncharacterized protein	0.230	0.067	0.359	2.4e-11
UNIPROTKB\|F1NJA2		1760	F1NJA2 "Uncharacterized protei	0.207	0.065	0.387	8.3e-11
MGI\|MGI:2442925		1826	Atad5 "ATPase family, AAA doma	0.221	0.067	0.362	1e-10
UNIPROTKB\|Q96QE3		1844	ATAD5 "ATPase family AAA domai	0.236	0.071	0.351	5.5e-10
ASPGD\|ASPL0000063791		1127	AN10917 [Emericella nidulans (	0.230	0.113	0.323	1e-09
UNIPROTKB\|E1BCE1		1847	ATAD5 "Uncharacterized protein	0.194	0.058	0.388	4.8e-09
ZFIN\|ZDB-GENE-030131-338		1060	atad5b "ATPase family, AAA dom	0.190	0.1	0.369	9.2e-09
ZFIN\|ZDB-GENE-070912-20		1778	atad5a "ATPase family, AAA dom	0.194	0.060	0.333	4.6e-08

TAIR\|locus:2204705 AT1G77620 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 830 (297.2 bits), Expect = 8.2e-85, Sum P(2) = 8.2e-85
 Identities = 209/545 (38%), Positives = 305/545 (55%)

Query:    10 CEAAQHADD--EVVEVIHIPDDENSHGVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQ 67
             C      +D  EV+ V+HI +D    G       ++KPLIL EDVD+ F EDRG ++ IQ
Sbjct:   451 CTDGNGVEDVVEVMPVLHIQND----GA------NLKPLILFEDVDICFAEDRGLVSAIQ 500

Query:    68 QIAEKAKGPVILTSNSNNITLPDSLDRLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLL 127
             QIA KAKGPV+LT+N  N  LPD+L+R+E+ F++P  ++L +HL ++CAAE+V++    L
Sbjct:   501 QIAVKAKGPVVLTANDKNHGLPDNLERIEIYFSLPSKEELFNHLSLVCAAEEVKVNHGSL 560

Query:   128 VQLIESCRADIRKTIMHLQFWCQNKGYGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFP 187
              ++   C  DIRK IM LQFW Q+K   + +K++     +LFD +AGH +LPK I   FP
Sbjct:   561 EEMTTFCGGDIRKAIMQLQFWFQSKPK-RARKVKNTGNQDLFDHEAGHLLLPKIIARDFP 619

Query:   188 SQLSELVVKEIMKSLSLMEE-NSTLRELSEGEGHDEMPSNQDMHNNPADSVEAKKEEMLN 246
             SQLS+LV  EI K LS+ EE N+T+    E   +++M +         +S++AKK  M  
Sbjct:   620 SQLSQLVENEIAKVLSMEEERNNTVEVFVEEVENEKMLNRLWRRGTGKNSIQAKKAAMFR 679

Query:   247 MNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRRKFKVVASSDSEDELIRN-KSPV 305
              N++    +ELED L   CE+SN  + P+SFS+ N RRK  VV SSDSEDE + + +  +
Sbjct:   680 QNTTFEDYDELEDVLRIPCELSNTSYQPLSFSQPNRRRKLNVVMSSDSEDEPLTDIRVSI 739

Query:   306 AERDINSKFLSENHSRFPSHFSNAQNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIG 365
             ++   + + + +      S++ + Q   NP  D       E LE + Y   E +    I 
Sbjct:   740 SQHQKDDRLIFQEDGTLSSYWPDMQKETNPLADPSR---AEILEAACYQY-ETSKFSYIN 795

Query:   366 TYV-SVDISCVPESSFVPETDIDNGAELLSGKECSGCXXXXXXXXXXXXFDL-NLPPVGA 423
                 SV+ISCVPESS+VPET +D  AEL S +  S C             D+   PP   
Sbjct:   796 EVSQSVEISCVPESSYVPETLMDGEAEL-SPRAVS-CGHFDGRVEVSMNEDVVQTPP--- 850

Query:   424 DNNSMLEMHRNPDMLEKFCAVIAESSHMEEVEDSQNEHVETIPRVYQLMDECSRMDFKRR 483
                  ++  +  D L+    +IAESS    +ED   E+V    ++ Q+ DECSRMDF + 
Sbjct:   851 SKEIYIDRFQIFDCLKNTSEIIAESSDATVMEDCFKEYVGAAQKMQQVSDECSRMDFGKT 910

Query:   484 SKL-EELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMCDLISEADL 542
              K  E+ +   +   V+ESW+K+     D + Y   E   A Q++ LTH + +LISEADL
Sbjct:   911 YKTAEKPKLDTSRSAVQESWEKICSNLADFKPYLDSEPVEAPQVLDLTHQITNLISEADL 970

Query:   543 LLSKC 547
               S+C
Sbjct:   971 THSRC 975

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0005886 "plasma membrane" evidence=ISM

GO:0006281 "DNA repair" evidence=IEA

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

UNIPROTKB\|J9NTZ2 ATAD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RCC4 ATAD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NJA2 F1NJA2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:2442925 Atad5 "ATPase family, AAA domain containing 5" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q96QE3 ATAD5 "ATPase family AAA domain-containing protein 5" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000063791 AN10917 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BCE1 ATAD5 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-338 atad5b "ATPase family, AAA domain containing 5b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-070912-20 atad5a "ATPase family, AAA domain containing 5a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		555
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	1e-05

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

 Score = 47.6 bits (114), Expect = 1e-05
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 46  LILIEDVDVFFP-EDRGFIAGIQQIAEKAKGPVILTSNS----NNITLPDSLDRLEVSFT 100
           LIL+++VD     EDRG    I ++ +KAK P+ILT+N     +   L ++   L + F 
Sbjct: 101 LILLDEVDGIHGNEDRGGARAILELIKKAKQPIILTANDPYDPSLRELRNAC--LMIEFK 158

Query: 101 MPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQ 146
               + ++  L+ IC  E +E     L ++ E    D+R  I  LQ
Sbjct: 159 RLSTRSIVPVLKRICRKEGIECDDEALKEIAERSGGDLRSAINDLQ 204

Length = 482

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		555
KOG1968		871	consensus Replication factor C, subunit RFC1 (larg	99.96
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.88
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.82
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.78
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.77
PRK04195		482	replication factor C large subunit; Provisional	99.76
PRK04132		846	replication factor C small subunit; Provisional	99.75
PLN03025		319	replication factor C subunit; Provisional	99.67
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.52
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.43
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.43
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.42
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.38
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.38
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.36
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.36
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.36
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.32
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.31
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.3
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.29
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	99.29
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.29
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.28
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.27
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.27
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.25
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.23
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.21
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.21
PHA02544		316	44 clamp loader, small subunit; Provisional	99.21
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.2
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.19
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.19
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.19
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.17
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.16
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.15
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.15
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.14
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.11
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.07
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.07
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.03
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.03
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.02
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.01
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.01
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	99.0
PRK12402		337	replication factor C small subunit 2; Reviewed	99.0
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.0
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	98.97
PRK13342		413	recombination factor protein RarA; Reviewed	98.64
PRK09112		351	DNA polymerase III subunit delta'; Validated	98.56
PRK08727		233	hypothetical protein; Validated	98.53
PRK13341		725	recombination factor protein RarA/unknown domain f	98.53
PRK08084		235	DNA replication initiation factor; Provisional	98.47
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.42
PRK07399		314	DNA polymerase III subunit delta'; Validated	98.41
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	98.38
PRK08903		227	DnaA regulatory inactivator Hda; Validated	98.32
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.27
TIGR01128		302	holA DNA polymerase III, delta subunit. subunit ar	98.24
PRK06893		229	DNA replication initiation factor; Validated	98.24
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.24
PRK06620		214	hypothetical protein; Validated	98.19
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.16
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.13
PRK09087		226	hypothetical protein; Validated	98.1
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	98.05
PRK07471		365	DNA polymerase III subunit delta'; Validated	97.94
PRK05564		313	DNA polymerase III subunit delta'; Validated	97.93
PRK08769		319	DNA polymerase III subunit delta'; Validated	97.93
PRK05707		328	DNA polymerase III subunit delta'; Validated	97.93
PRK05642		234	DNA replication initiation factor; Validated	97.91
PRK07993		334	DNA polymerase III subunit delta'; Validated	97.89
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	97.83
PRK00149		450	dnaA chromosomal replication initiation protein; R	97.83
PRK06871		325	DNA polymerase III subunit delta'; Validated	97.79
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	97.74
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.74
PRK08058		329	DNA polymerase III subunit delta'; Validated	97.71
PRK12422		445	chromosomal replication initiation protein; Provis	97.67
PTZ00112		1164	origin recognition complex 1 protein; Provisional	97.65
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.64
PRK14088		440	dnaA chromosomal replication initiation protein; P	97.55
CHL00181		287	cbbX CbbX; Provisional	97.55
KOG2028		554	consensus ATPase related to the helicase subunit o	97.52
PRK14087		450	dnaA chromosomal replication initiation protein; P	97.51
PRK00411		394	cdc6 cell division control protein 6; Reviewed	97.51
PRK06090		319	DNA polymerase III subunit delta'; Validated	97.48
PF06144		172	DNA_pol3_delta: DNA polymerase III, delta subunit;	97.47
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	97.31
PRK06964		342	DNA polymerase III subunit delta'; Validated	97.27
PRK07132		299	DNA polymerase III subunit delta'; Validated	97.25
PRK05574		340	holA DNA polymerase III subunit delta; Reviewed	97.25
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.21
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	97.21
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	97.19
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	97.14
PRK14086		617	dnaA chromosomal replication initiation protein; P	97.11
PRK08485		206	DNA polymerase III subunit delta'; Validated	97.1
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	97.07
PRK06585		343	holA DNA polymerase III subunit delta; Reviewed	97.04
PRK07276		290	DNA polymerase III subunit delta'; Validated	97.04
PRK14700		300	recombination factor protein RarA; Provisional	97.02
PF00004		132	AAA: ATPase family associated with various cellula	97.0
PRK07452		326	DNA polymerase III subunit delta; Validated	96.99
PRK05917		290	DNA polymerase III subunit delta'; Validated	96.82
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	96.5
PRK05818		261	DNA polymerase III subunit delta'; Validated	96.41
CHL00176		638	ftsH cell division protein; Validated	96.33
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	96.31
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.31
PRK03992		389	proteasome-activating nucleotidase; Provisional	96.31
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	96.29
COG0593		408	DnaA ATPase involved in DNA replication initiation	96.2
CHL00195		489	ycf46 Ycf46; Provisional	96.05
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	96.0
PRK08699		325	DNA polymerase III subunit delta'; Validated	95.96
PRK07914		320	hypothetical protein; Reviewed	95.82
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	95.81
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	95.8
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	95.76
PRK05629		318	hypothetical protein; Validated	95.69
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	95.49
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	95.22
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	94.93
PRK08487		328	DNA polymerase III subunit delta; Validated	94.61
PRK06581		263	DNA polymerase III subunit delta'; Validated	94.42
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	93.68
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	93.36
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	93.35
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	93.11
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	92.96
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	92.82
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	92.59
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	92.01
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	91.83
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	91.53
PRK15115		444	response regulator GlrR; Provisional	91.15
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	91.11
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	90.91
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	90.63
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	90.09
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	89.88
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	89.86
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	89.84
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	89.75
PRK05907		311	hypothetical protein; Provisional	89.61
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	89.59
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	88.95
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	88.93
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	88.85
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	88.57
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	88.32
PRK13695		174	putative NTPase; Provisional	87.81
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	87.18
CHL00195		489	ycf46 Ycf46; Provisional	86.85
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	86.81
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	86.11
PRK10365		441	transcriptional regulatory protein ZraR; Provision	85.66
COG1466		334	HolA DNA polymerase III, delta subunit [DNA replic	85.38
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	85.36
CHL00095		821	clpC Clp protease ATP binding subunit	84.92
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	84.03
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	84.01
PRK05022		509	anaerobic nitric oxide reductase transcription reg	83.83
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	83.6
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	83.54
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	82.87
PRK11608		326	pspF phage shock protein operon transcriptional ac	82.81
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	82.29
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	81.77
PRK10865		857	protein disaggregation chaperone; Provisional	81.76
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	80.73

>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair]	Back alignment and domain information

Probab=99.96  E-value=4.6e-29  Score=283.55  Aligned_cols=450  Identities=18%  Similarity=0.147  Sum_probs=319.9

Q ss_pred             hhHHHhhCCCceEEEeCCCcccc------------cccccccCC--------CCCCcEEEEeCCCCCCcccHHHHHHHHH
Q 008751            9 LCEAAQHADDEVVEVIHIPDDEN------------SHGVMGKSD--------NHVKPLILIEDVDVFFPEDRGFIAGIQQ   68 (555)
Q Consensus         9 ~~~iAkelGy~VIELNASDdR~r------------n~~v~gsl~--------~~kkkLILiDEVD~Lf~eDrGf~sAL~~   68 (555)
                      .+++|+++||+|+|+||+|.|++            ++.+.+++.        .....||||||||+|+.+|||+|++|..
T Consensus       374 ~h~~~k~~g~~v~E~Nas~~RSk~~l~~~~~~~~~s~si~~~~~~~~~~~~~~~~~~vil~devD~~~~~dRg~v~~l~~  453 (871)
T KOG1968|consen  374 AHKAAKELGFKVVEKNASDVRSKKELLNKLGNATSSHSIKGSKKKKGNRQSLNSDHFLILMDEVDGMFGEDRGGVSKLSS  453 (871)
T ss_pred             HhhhhhhcccceeecCccccccccHHHhhhhccccccchhhhhcccccccccccceeEEEEeccccccchhhhhHHHHHH
Confidence            46889999999999999998854            234444330        1234599999999999999999999999


Q ss_pred             HHHHcCCcEEEEecCCCCCCcCccc--eeEEEecCCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHcCCcHHHHHHHHH
Q 008751           69 IAEKAKGPVILTSNSNNITLPDSLD--RLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQ  146 (555)
Q Consensus        69 liekSKrPIILtCND~n~~L~~l~~--~l~I~FkrPs~~eI~srL~~Ic~kEgl~Id~~~L~~Li~~S~GDIRqaLN~LQ  146 (555)
                      +++++++||||||||.+.+..+.+.  |+.|+|++|....+..|++.||.+|+++|+++.++.+++.++||||++||+||
T Consensus       454 l~~ks~~Piv~~cndr~~p~sr~~~~~~~~l~f~kP~~~~i~~ri~si~~se~~ki~~~~l~~~s~~~~~DiR~~i~~lq  533 (871)
T KOG1968|consen  454 LCKKSSRPLVCTCNDRNLPKSRALSRACSDLRFSKPSSELIRSRIMSICKSEGIKISDDVLEEISKLSGGDIRQIIMQLQ  533 (871)
T ss_pred             HHHhccCCeEEEecCCCCccccchhhhcceeeecCCcHHHHHhhhhhhhcccceecCcHHHHHHHHhcccCHHHHHHHHh
Confidence            9999999999999999976666665  69999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCC-------CCcccccccccCCCCCCcccccccC-CCccCCCC-CchhHHHHHHHHHhhhhhhhcccchhhcccc
Q 008751          147 FWCQNKG-------YGKDKKLQKLYVPELFDPDAGHHML-PKKIPWGF-PSQLSELVVKEIMKSLSLMEENSTLRELSEG  217 (555)
Q Consensus       147 f~s~s~~-------~~~~k~~~k~~~~~pFD~i~g~~l~-p~i~p~~~-P~~L~el~l~Ei~~si~~~ee~~~~le~~e~  217 (555)
                      ||+....       ....+.+.+.....+|| .+..++. .....-.. --.=.++++.++..+.++             
T Consensus       534 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d-~~~~~L~~~~~~s~~~~~~~k~~~~~ed~~~~p~~-------------  599 (871)
T KOG1968|consen  534 FWSLSKPAELPKKKGTPIKTSKKNITVKDFD-AAEGLLDISRVASEETSNQSKAELYFEDYSISPLK-------------  599 (871)
T ss_pred             hhhccchhhhccccCccccccccccccchhH-HHhhhccHhhhhhhhhhccchHHHhccccccchhh-------------
Confidence            9977632       22223355777778888 4444443 01100000 000033444444333333             


Q ss_pred             CCCCCCCCCCcCCCCCCcchHHHHHHhhccCCccCCCccccccccCccccCCCCCCCcccccccccccceeecCCCchhh
Q 008751          218 EGHDEMPSNQDMHNNPADSVEAKKEEMLNMNSSVHTNNELEDPLGNECEISNLPHTPVSFSRKNNRRKFKVVASSDSEDE  297 (555)
Q Consensus       218 l~~~~~~n~l~~~~~~~d~~~~~k~~~l~~~~s~~~~~e~~~~~~~~~e~~~~~~~p~~~~~~~~r~k~~~v~~s~s~d~  297 (555)
                          +++|++....          .+|-      .+..++++.+.+.|.++.....|..+.+...+.++.++...+|.++
T Consensus       600 ----v~~n~~~~~~----------~~~~------~~~~~l~~~~~~ad~is~~d~~~~~~r~~~~~~~L~~~~a~~s~~~  659 (871)
T KOG1968|consen  600 ----VQENYLQVLP----------RSMK------QILDELEDVSEAADSISLGDLRPKSIRGPELDWKLNPLHAVDSKVL  659 (871)
T ss_pred             ----cchhhhcccc----------hhhh------hhHHHHHHHhhhhhhhhhhhhcchhhcCccchhhhhhhhhhhhhhc
Confidence                4444432221          1221      4667888888888889999999999999999899999988888887


Q ss_pred             hhhCCCcccccccccccccccCCCCCccccc-ccCCCCCCCcccCCchhhhccccccccccccccceee-eeeeeccccc
Q 008751          298 LIRNKSPVAERDINSKFLSENHSRFPSHFSN-AQNCKNPPIDKLHYPLKEKLEGSHYLCSEVANDLQIG-TYVSVDISCV  375 (555)
Q Consensus       298 ~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~-~q~~~~~~~~~~~~s~~~~~e~~~~~~~~~~~~~~i~-t~~s~~~scv  375 (555)
                      ++.   .+.+|...       .-.||. |.. +-.|.          ....               .+. --.+..+++.
T Consensus       660 p~~---~~~~~~~~-------~i~f~~-~~~~~sk~~----------~~~~---------------~l~el~~h~~~~~s  703 (871)
T KOG1968|consen  660 PAS---KVGGHLLF-------RLGFPQ-WLGENSKSG----------KLKR---------------FLQELLPHTRLKQS  703 (871)
T ss_pred             chh---hhhhcccc-------cccccc-ccCcccccc----------chhH---------------HHHHhchhhhhhhc
Confidence            766   45555422       222333 322 22222          1111               111 3345567889


Q ss_pred             cCCcccccccccCCcccccccccccccccceeeeeecccccCCCCcccCcchhhccCCCChhhHHHHHHHhccCCccccc
Q 008751          376 PESSFVPETDIDNGAELLSGKECSGCVAEAVEVSVANEFDLNLPPVGADNNSMLEMHRNPDMLEKFCAVIAESSHMEEVE  455 (555)
Q Consensus       376 pess~~~e~~~~~~~e~~~~~vs~g~~~~~~~vs~~n~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~  455 (555)
                      |...++++.-..-..++.......++..+             .+++-.   .+.......|-+..+-|.++......+..
T Consensus       704 ~~~~~~~~~y~~i~~~~~~~~~~~~~~d~-------------~p~~i~---~~vdy~~~~ed~~~i~Ei~~~~~~~~~~~  767 (871)
T KOG1968|consen  704 ANKARVRESYNPISRQFSPVPLALQSKDG-------------KPSAIE---SMVDYDLINEDLDGISEIIAAPGEAKVPN  767 (871)
T ss_pred             cchhhhhhhhhhhhhhccCCccccccCCC-------------CchhHH---hhhhhhhhhhhhhhHHHHhhccccccchh
Confidence            99999999999888888888888888742             112111   12333566677778888888877766666


Q ss_pred             ccccchhcccccccccccccccccccccchh-hccchhHHHHHHHHHHHHHHccccccccchhhcCCChhhHHHhhhccc
Q 008751          456 DSQNEHVETIPRVYQLMDECSRMDFKRRSKL-EELRSQEAIDLVRESWKKLRDGNTDLRQYATLEKPNAFQIIKLTHGMC  534 (555)
Q Consensus       456 d~~~e~~~~~~~~~~~mdecsr~df~~~~~~-~~~~~~~~~~~vq~~w~kl~~~~~dl~~~~~~e~~~a~~~~~l~~~~s  534 (555)
                      +.. +......-+.++-++|.++.|....+- .+.....-...++..|.+...-.++..  ..++-+.+...+++++.+.
T Consensus       768 ~~i-~~~~~~~~~R~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~--~~~~~~e~~~~l~~~~~i~  844 (871)
T KOG1968|consen  768 KKI-EGTVKAVFTRTYKKLTEELRFFGQCKIRWKNAELSSAKREDLELGKGAEHLSLSG--DSSEELEADHNLSLDKLIK  844 (871)
T ss_pred             hhh-ccccccccccchhhhHhhccccchheeeccCccccccccchhhcccchhhccccc--cchhhhhhhhhcchhheee
Confidence            655 655566666677799999999999988 444444677888999999997655555  3456689999999999999


Q ss_pred             cccchhhhhhhccCCC
Q 008751          535 DLISEADLLLSKCQSP  550 (555)
Q Consensus       535 ~liseadl~~~~c~~~  550 (555)
                      ..++.   .+.+|.+.
T Consensus       845 ~~~~~---t~~k~~~~  857 (871)
T KOG1968|consen  845 VELTT---TKRKALNH  857 (871)
T ss_pred             ecccc---cccccccc
Confidence            98888   56665543

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>TIGR01128 holA DNA polymerase III, delta subunit	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF06144 DNA_pol3_delta: DNA polymerase III, delta subunit; InterPro: IPR010372 DNA polymerase III, delta subunit (2	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05574 holA DNA polymerase III subunit delta; Reviewed	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08485 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PRK06585 holA DNA polymerase III subunit delta; Reviewed	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14700 recombination factor protein RarA; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK07452 DNA polymerase III subunit delta; Validated	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07914 hypothetical protein; Reviewed	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK05629 hypothetical protein; Validated	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK08487 DNA polymerase III subunit delta; Validated	Back alignment and domain information

>PRK06581 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PRK05907 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>COG1466 HolA DNA polymerase III, delta subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		555
1sxj_A		516	Crystal Structure Of The Eukaryotic Clamp Loader (R		6e-08

>pdb|1SXJ|A Chain A, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna) Length = 516

Back alignment and structure

Iteration: 1

Score = 55.8 bits (133), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 39/136 (28%), Positives = 66/136 (48%), Gaps = 7/136 (5%) Query: 9 LCEAAQHADDEVVEVIHIPDDENSHGVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQQ 68 L ++A D + V + +E + + GK H +I++++VD DRG + + Q Sbjct: 119 LNAGVKNALDNMSVVGYFKHNEEAQNLNGK---HF--VIIMDEVDGMSGGDRGGVGQLAQ 173 Query: 69 IAEKAKGPVILTSNSNNITLPDSLDR--LEVSFTMPMPKDLLSHLQMICAAEKVELQQHL 126 K P+IL N N+ DR L++ F P + S L I EK +L ++ Sbjct: 174 FCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNV 233 Query: 127 LVQLIESCRADIRKTI 142 + +LI++ R DIR+ I Sbjct: 234 IDRLIQTTRGDIRQVI 249 Database: pdbaa

PyMOL of 1sxj

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		555
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	6e-14
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	9e-05
2chg_A		226	Replication factor C small subunit; DNA-binding pr	1e-04
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	1e-04
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	2e-04
2chq_A		319	Replication factor C small subunit; DNA-binding pr	2e-04
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	2e-04

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516	Back alignment and structure

 Score = 73.4 bits (180), Expect = 6e-14
 Identities = 46/193 (23%), Positives = 77/193 (39%), Gaps = 17/193 (8%)

Query: 31  NSHGVMGKSDNHVKPLILIEDVDVFFPEDRGFIAGIQQIAEKAKGPVILTSNSNNITLPD 90
             H    ++ N    +I++++VD     DRG +  + Q   K   P+IL  N  N+    
Sbjct: 136 FKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILICNERNLPKMR 195

Query: 91  SLDR--LEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQFW 148
             DR  L++ F  P    + S L  I   EK +L  +++ +LI++ R DIR+ I  L   
Sbjct: 196 PFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLSTI 255

Query: 149 CQNKG-------YGKDKKLQKLYVPELFDPDAGHHMLPKKIPWGFPSQ------LSELVV 195
                           K  +K    + F  D  H ML  +I     S+         L  
Sbjct: 256 STTTKTINHENINEISKAWEKNIALKPF--DIAHKMLDGQIYSDIGSRNFTLNDKIALYF 313

Query: 196 KEIMKSLSLMEEN 208
            +   +  +++EN
Sbjct: 314 DDFDFTPLMIQEN 326

PyMOL of 1sxj

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 340	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 353	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 323	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		555
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	99.7
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	99.4
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	99.2
2chq_A		319	Replication factor C small subunit; DNA-binding pr	99.16
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	99.12
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	99.11
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	99.09
1jr3_D		343	DNA polymerase III, delta subunit; processivity, p	98.91
2chg_A		226	Replication factor C small subunit; DNA-binding pr	98.91
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	98.91
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	98.84
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	98.84
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	98.83
3bos_A		242	Putative DNA replication factor; P-loop containing	98.75
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	98.65
3pvs_A		447	Replication-associated recombination protein A; ma	98.6
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	98.5
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	98.49
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	98.47
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	98.4
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	98.31
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	98.24
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	98.08
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	98.06
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	98.0
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	97.96
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	97.96
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	97.96
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	97.86
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	97.85
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	97.83
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	97.68
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	97.66
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	97.63
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	97.62
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	97.55
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	97.49
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	97.44
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	97.37
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	97.29
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	97.26
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	97.09
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	97.08
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	97.06
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	96.96
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	96.92
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	96.9
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	96.83
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	96.8
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	96.76
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	96.61
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	96.55
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	96.42
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	96.4
2r44_A		331	Uncharacterized protein; putative ATPase, structur	96.36
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	96.35
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	96.29
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	96.28
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	96.02
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	95.94
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	95.75
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	95.69
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	95.51
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	95.34
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	95.08
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	95.07
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	95.03
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	94.81
1u0j_A		267	DNA replication protein; AAA+ protein, P-loop atpa	94.47
3dzd_A		368	Transcriptional regulator (NTRC family); sigma43 a	94.35
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	94.22
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	93.31
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	92.55
1ny5_A		387	Transcriptional regulator (NTRC family); AAA+ ATPa	92.47
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	92.32
2fna_A		357	Conserved hypothetical protein; structural genomic	89.87
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	88.87
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	88.57
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	88.53
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	88.15
1tue_A		212	Replication protein E1; helicase, replication, E1E	86.68
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	86.24
3co5_A		143	Putative two-component system transcriptional RES	86.23
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	85.1
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	83.98
3nbx_X		500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	81.9
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	81.42

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

Probab=99.70  E-value=4.2e-17  Score=174.45  Aligned_cols=200  Identities=22%  Similarity=0.203  Sum_probs=149.7

Q ss_pred             hhHHHhhCCCceEEEeCCCcccc-------c-----ccccccCC--------CCCCcEEEEeCCCCCCcccHHHHHHHHH
Q 008751            9 LCEAAQHADDEVVEVIHIPDDEN-------S-----HGVMGKSD--------NHVKPLILIEDVDVFFPEDRGFIAGIQQ   68 (555)
Q Consensus         9 ~~~iAkelGy~VIELNASDdR~r-------n-----~~v~gsl~--------~~kkkLILiDEVD~Lf~eDrGf~sAL~~   68 (555)
                      ..++|+++|+.++|+|+++.+..       .     ..+.+.+.        ..++.+|||||||.|+.++++++.+|.+
T Consensus        94 a~~la~~l~~~~i~in~s~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~vliIDEid~l~~~~~~~l~~L~~  173 (516)
T 1sxj_A           94 AHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQ  173 (516)
T ss_dssp             HHHHHHHTTCEEEEECTTSCCCHHHHHHTGGGGTTBCCSTTTTTC----CCSSTTSEEEEECSGGGCCTTSTTHHHHHHH
T ss_pred             HHHHHHHcCCCEEEEeCCCcchHHHHHHHHHHHhccccHHHHHhhhhhhhhccCCCeEEEEECCCccchhhHHHHHHHHH
Confidence            45889999999999999996542       0     01111111        1356899999999999989999999999


Q ss_pred             HHHHcCCcEEEEecCCC-CCCcCccc-eeEEEecCCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHcCCcHHHHHHHHH
Q 008751           69 IAEKAKGPVILTSNSNN-ITLPDSLD-RLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQ  146 (555)
Q Consensus        69 liekSKrPIILtCND~n-~~L~~l~~-~l~I~FkrPs~~eI~srL~~Ic~kEgl~Id~~~L~~Li~~S~GDIRqaLN~LQ  146 (555)
                      +++..++|||+|||+.. +.++++.. +..++|.+|+..++..+|..+|.+||+.++++.++.|++.+.||+|++++.||
T Consensus       174 ~l~~~~~~iIli~~~~~~~~l~~l~~r~~~i~f~~~~~~~~~~~L~~i~~~~~~~i~~~~l~~la~~s~GdiR~~i~~L~  253 (516)
T 1sxj_A          174 FCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLS  253 (516)
T ss_dssp             HHHHCSSCEEEEESCTTSSTTGGGTTTSEEEECCCCCHHHHHHHHHHHHHHHTCCCCTTHHHHHHHHTTTCHHHHHHHHT
T ss_pred             HHHhcCCCEEEEEcCCCCccchhhHhceEEEEeCCCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHcCCcHHHHHHHHH
Confidence            99999999999999976 44454444 68999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCccc-------ccccccCCCCCCcccccccCCCccCCCC--Cch---hHHHHHHHHHhhhhhhhccc
Q 008751          147 FWCQNKGYGKDK-------KLQKLYVPELFDPDAGHHMLPKKIPWGF--PSQ---LSELVVKEIMKSLSLMEENS  209 (555)
Q Consensus       147 f~s~s~~~~~~k-------~~~k~~~~~pFD~i~g~~l~p~i~p~~~--P~~---L~el~l~Ei~~si~~~ee~~  209 (555)
                      +++..++..+..       .|++.....+|+ ++++.+..+++...-  ...   .+++++.+....+..++|||
T Consensus       254 ~~~~~~~~It~~~v~~~~~~~~~~~~~~~f~-~~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~eNy  327 (516)
T 1sxj_A          254 TISTTTKTINHENINEISKAWEKNIALKPFD-IAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQENY  327 (516)
T ss_dssp             HHHHHSSCCCTTHHHHHHHHHHTTTTSHHHH-HHHHHTBGGGTSTTGGGTSCHHHHHHHHTTSTTTHHHHHHHHS
T ss_pred             HHHhcCCCCchHHHHHHHHhhccCCCCCHHH-HHHHHhcCCccccccccCCCHHHhhhhhccCHHHHHHHHHHHh
Confidence            998865432222       255666677888 666666555432210  011   24445555555556666655

PyMOL of 1sxj

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A	Back alignment and structure

>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A*	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		555
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	99.74
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	99.72
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	99.63
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	99.62
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	99.6
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	99.58
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	99.51
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	99.29
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	99.28
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	99.25
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	98.29
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	97.9
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	97.85
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	97.6
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	97.37
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.05
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	96.89
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	96.79
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.31
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	95.86
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	91.4
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	89.74
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	88.29
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	87.48
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	83.14
d1sxje1		99	Replication factor C5 {Baker's yeast (Saccharomyce	82.32
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	82.2

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.74  E-value=1e-17  Score=157.27  Aligned_cols=146  Identities=24%  Similarity=0.327  Sum_probs=122.9

Q ss_pred             hhHHHhhCCCceEEEeCCCcccc-------cccc-----cc--------cCCCCCCcEEEEeCCCCCCcccHHHHHHHHH
Q 008751            9 LCEAAQHADDEVVEVIHIPDDEN-------SHGV-----MG--------KSDNHVKPLILIEDVDVFFPEDRGFIAGIQQ   68 (555)
Q Consensus         9 ~~~iAkelGy~VIELNASDdR~r-------n~~v-----~g--------sl~~~kkkLILiDEVD~Lf~eDrGf~sAL~~   68 (555)
                      ..++|+++|++++++|+++.++.       ....     ..        .....+..+|++||+|.++..+++++..+.+
T Consensus        69 a~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~ide~~~~~~~~~~~~~~~~~  148 (253)
T d1sxja2          69 AHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQ  148 (253)
T ss_dssp             HHHHHHHTTCEEEEECTTSCCCHHHHHHTGGGGTTBCCSTTTTTC----CCSSTTSEEEEECSGGGCCTTSTTHHHHHHH
T ss_pred             HHHHHHHHHhhhhccccccchhhHHHHHHHHHHhhcchhhhhhhhhhhcccccccceEEEeeeccccccchhhhhHHHhh
Confidence            45899999999999999996642       0000     00        0112356799999999999999999999999


Q ss_pred             HHHHcCCcEEEEecCCCC-CCcCccc-eeEEEecCCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHHHcCCcHHHHHHHHH
Q 008751           69 IAEKAKGPVILTSNSNNI-TLPDSLD-RLEVSFTMPMPKDLLSHLQMICAAEKVELQQHLLVQLIESCRADIRKTIMHLQ  146 (555)
Q Consensus        69 liekSKrPIILtCND~n~-~L~~l~~-~l~I~FkrPs~~eI~srL~~Ic~kEgl~Id~~~L~~Li~~S~GDIRqaLN~LQ  146 (555)
                      +.....+|||+|||+.+. .+.++++ +..|+|.+|+..++..+|+.||.+||+.++++.++.|+..++||||++||.||
T Consensus       149 ~~~~~~~~ii~i~~~~~~~~~~~l~~~~~~i~f~~~~~~~i~~~l~~i~~~e~i~i~~~~l~~i~~~s~GDiR~ai~~L~  228 (253)
T d1sxja2         149 FCRKTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTRGDIRQVINLLS  228 (253)
T ss_dssp             HHHHCSSCEEEEESCTTSSTTGGGTTTSEEEECCCCCHHHHHHHHHHHHHHHTCCCCTTHHHHHHHHTTTCHHHHHHHHT
T ss_pred             hhcccccccccccccccccccccccceeeeeeccccchhHHHHHHHHHHHHhCCCCCHHHHHHHHHhCCCcHHHHHHHHH
Confidence            999999999999999864 4444444 58999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCC
Q 008751          147 FWCQNKGY  154 (555)
Q Consensus       147 f~s~s~~~  154 (555)
                      +++...+.
T Consensus       229 ~~~~~~~~  236 (253)
T d1sxja2         229 TISTTTKT  236 (253)
T ss_dssp             HHHHHSSC
T ss_pred             HHHHcCCC
Confidence            99887653

PyMOL of d1sxja2

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxje1 a.80.1.1 (E:256-354) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure