Citrus Sinensis ID: 008769
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 554 | ||||||
| 225438333 | 735 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.745 | 0.734 | 0.0 | |
| 224083544 | 727 | predicted protein [Populus trichocarpa] | 0.983 | 0.749 | 0.736 | 0.0 | |
| 255563831 | 722 | conserved hypothetical protein [Ricinus | 0.983 | 0.754 | 0.740 | 0.0 | |
| 296082624 | 712 | unnamed protein product [Vitis vinifera] | 0.947 | 0.737 | 0.718 | 0.0 | |
| 357520155 | 742 | cyclase/dehydrase family protein [Medica | 0.990 | 0.739 | 0.692 | 0.0 | |
| 449520367 | 727 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.978 | 0.745 | 0.694 | 0.0 | |
| 356512876 | 725 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.742 | 0.687 | 0.0 | |
| 356527540 | 721 | PREDICTED: uncharacterized protein LOC10 | 0.976 | 0.750 | 0.689 | 0.0 | |
| 356518814 | 724 | PREDICTED: uncharacterized protein LOC10 | 0.976 | 0.747 | 0.678 | 0.0 | |
| 22326677 | 719 | uncharacterized protein [Arabidopsis tha | 0.962 | 0.741 | 0.675 | 0.0 |
| >gi|225438333|ref|XP_002273364.1| PREDICTED: uncharacterized protein LOC100262883 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 837 bits (2163), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 409/557 (73%), Positives = 471/557 (84%), Gaps = 9/557 (1%)
Query: 1 MVDGDFKKFEGKWSIKSGTRSSTTTLSYEVNVIPRLNFPAIFLERIIRSDLPVNLQALAC 60
MVDGDFKKFEGKWS+K G RSSTT+LSYEVNVIPR NFPAIFLERIIRSDLPVNLQALAC
Sbjct: 185 MVDGDFKKFEGKWSLKYGKRSSTTSLSYEVNVIPRFNFPAIFLERIIRSDLPVNLQALAC 244
Query: 61 RAERSFGWNQKIPMIKNSFGELSLPILASPSLDFDGGLPEKGKAPHGEFNENIVSSNFGS 120
R+E++F NQKIP I++S G S+ +A+P +D DG L + +P G F ++ SS+F
Sbjct: 245 RSEKNFEGNQKIPFIESSLGTASIADVANPGIDLDGALSVEKLSP-GVFKKSHASSSFDP 303
Query: 121 VPPSSSDLNSKWGVFGQVCRLDRPCFVDEVHLRRFDGLLENGGVHRCVVASITVKAPVSE 180
+ SSS+L+S WGVFG+VC+LDRPC VDEVHLRRFDGLLENGGVHRCVVAS+TVKAPV E
Sbjct: 304 LFQSSSELSSNWGVFGKVCKLDRPCMVDEVHLRRFDGLLENGGVHRCVVASMTVKAPVRE 363
Query: 181 VWNVMTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLHARVVMDICEQHEQ 240
VWNV+TAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLHAR V+D+CEQ EQ
Sbjct: 364 VWNVLTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLHARAVLDLCEQLEQ 423
Query: 241 EISFEQVEGDFDSFQGKWLFEQLGSHHTLLKYSVESKMQKNSLLSEAIMEEVIYEDLPSN 300
EISF QVEGDFDSFQGKW+ EQLG+ HTLLKY+VESKM ++S LSEAIMEEVIYEDLPSN
Sbjct: 424 EISFVQVEGDFDSFQGKWILEQLGNQHTLLKYTVESKMHRDSFLSEAIMEEVIYEDLPSN 483
Query: 301 LCAIRDYVEKREGDNSLANDSVETTNHTQSSDD--LTQSSDELGASSSSDNEDLVDSETP 358
LCAIRDY+EKRE NSL ET+++ + S++ ++ S+ +++ D P
Sbjct: 484 LCAIRDYIEKREASNSL-----ETSDYVRYSEEQFISSSNGRDVDYHPKPADEVSDVSGP 538
Query: 359 NSFKQRPRVPGLQTNIEVLKAELLEFISKHGQEGFMPMRKQLRKHGRVDVEKAITRMGGF 418
N +QRPRVPGLQ NIEVLKAELL+FI +HGQEGFMPMRKQLRKHGRVD+EKAITRMGGF
Sbjct: 539 NPLRQRPRVPGLQRNIEVLKAELLKFILEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGF 598
Query: 419 RRMASLMNLALAYKHRKPKGYWDNLENLEEEISRFQRSWGMDPSFMPSRKSFERAGRYDI 478
RR+ASLMNL+LAYKHRKPKGYWDNLENL+EEI+RFQRSWGMDPS+MPSRK+FERAGRYDI
Sbjct: 599 RRIASLMNLSLAYKHRKPKGYWDNLENLKEEITRFQRSWGMDPSYMPSRKTFERAGRYDI 658
Query: 479 ARALEKWGGLHEVSRLLSLKLRHPNRRAHIIKDKKVDYV-DPANLECEGKIPSKPYVSQD 537
ARALEKWGGLHEVSRLLSLK+RHPNR+ ++ K K+ D+V P + E + SKPYV QD
Sbjct: 659 ARALEKWGGLHEVSRLLSLKVRHPNRQPNLTKHKRSDFVASPDMVVDEDRTTSKPYVPQD 718
Query: 538 TQKWAMKLKDLDINWVE 554
QKW M L+ LDINWVE
Sbjct: 719 AQKWLMSLQHLDINWVE 735
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224083544|ref|XP_002307063.1| predicted protein [Populus trichocarpa] gi|222856512|gb|EEE94059.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255563831|ref|XP_002522916.1| conserved hypothetical protein [Ricinus communis] gi|223537843|gb|EEF39459.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296082624|emb|CBI21629.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357520155|ref|XP_003630366.1| cyclase/dehydrase family protein [Medicago truncatula] gi|355524388|gb|AET04842.1| cyclase/dehydrase family protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449520367|ref|XP_004167205.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101212159 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356512876|ref|XP_003525141.1| PREDICTED: uncharacterized protein LOC100797103 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527540|ref|XP_003532367.1| PREDICTED: uncharacterized protein LOC100785172 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356518814|ref|XP_003528072.1| PREDICTED: uncharacterized protein LOC100777483 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|22326677|ref|NP_680157.1| uncharacterized protein [Arabidopsis thaliana] gi|13548330|emb|CAC35877.1| putative protein [Arabidopsis thaliana] gi|26450803|dbj|BAC42510.1| unknown protein [Arabidopsis thaliana] gi|29029030|gb|AAO64894.1| At5g08720 [Arabidopsis thaliana] gi|332003958|gb|AED91341.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 554 | ||||||
| TAIR|locus:504956340 | 719 | AT5G08720 "AT5G08720" [Arabido | 0.960 | 0.739 | 0.661 | 1.6e-189 | |
| TAIR|locus:2133442 | 288 | AT4G01650 "AT4G01650" [Arabido | 0.182 | 0.350 | 0.383 | 9.7e-13 |
| TAIR|locus:504956340 AT5G08720 "AT5G08720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1837 (651.7 bits), Expect = 1.6e-189, P = 1.6e-189
Identities = 370/559 (66%), Positives = 430/559 (76%)
Query: 1 MVDGDFKKFEGKWSIKSGTRSSTTTLSYEVNVIPRLNFPAIFLERIIRSDLPVNLQALAC 60
MVDGDFKKFEGKWS+KSG RS T LSYEVNVIPR NFPAIFLERIIRSDLPVNL+A+A
Sbjct: 182 MVDGDFKKFEGKWSVKSGIRSVGTVLSYEVNVIPRFNFPAIFLERIIRSDLPVNLRAVAR 241
Query: 61 RAERSFGWNQKIPMIKNSFGELSLPILASPSLDFDGGLPEKGKAPHGEFNENIXXXXXXX 120
+AE+ + K +I++ G +S S ++FD E+ A
Sbjct: 242 QAEKIYKDCGKPSIIEDLLGIISSQPAPSNGIEFDSLATERSVA------------SSVG 289
Query: 121 XXXXXXDLNSKWGVFGQVCRLDRPCFVDEVHLRRFDGLLENGGVHRCVVASITVKAPVSE 180
+LN+ WGV+G+ C+LD+PC VDEVHLRRFDGLLENGGVHRC VASITVKAPV E
Sbjct: 290 SLAHSNELNNNWGVYGKACKLDKPCTVDEVHLRRFDGLLENGGVHRCAVASITVKAPVCE 349
Query: 181 VWNVMTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLHARVVMDICEQHEQ 240
VW V+T+YE+LPEIVPNLAISKILSR+NNKVRILQEGCKGLLYMVLHAR V+D+ E EQ
Sbjct: 350 VWKVLTSYESLPEIVPNLAISKILSRDNNKVRILQEGCKGLLYMVLHARAVLDLHEIREQ 409
Query: 241 EISFEQVEGDFDSFQGKWLFEQLGSHHTLLKYSVESKMQKNSLLSEAIMEEVIYEDLPSN 300
EI FEQVEGDFDS +GKW+FEQLGSHHTLLKY+VESKM+K+S LSEAIMEEVIYEDLPSN
Sbjct: 410 EIRFEQVEGDFDSLEGKWIFEQLGSHHTLLKYTVESKMRKDSFLSEAIMEEVIYEDLPSN 469
Query: 301 LCAIRDYVEKREGDNSLANDSVETTNHXXXXXXXXXXXXXXXXXXXXDNEDLVDSETPNS 360
LCAIRDY+EKR G+ S + +ET +N+D D +T
Sbjct: 470 LCAIRDYIEKR-GEKSSESCKLETCQ---VSEETCSSSRAKSVETVYNNDDGSD-QT--- 521
Query: 361 FKQRPRVPGLQTNIEVLKAELLEFISKHGQEGFMPMRKQLRKHGRVDVEKAITRMGGFRR 420
KQR R+PGLQ +IEVLK+E+L+FIS+HGQEGFMPMRKQLR HGRVD+EKAITRMGGFRR
Sbjct: 522 -KQRRRIPGLQRDIEVLKSEILKFISEHGQEGFMPMRKQLRLHGRVDIEKAITRMGGFRR 580
Query: 421 MASLMNLALAYKHRKPKGYWDNLENLEEEISRFQRSWGMDPSFMPSRKSFERAGRYDIAR 480
+A +MNL+LAYKHRKPKGYWDNLENL+EEI RFQ+SWGMDPSFMPSRKSFERAGRYDIAR
Sbjct: 581 IALMMNLSLAYKHRKPKGYWDNLENLQEEIGRFQQSWGMDPSFMPSRKSFERAGRYDIAR 640
Query: 481 ALEKWGGLHEVSRLLSLKLRHPNRRAHIIKDK-----KVDYVDPANLECEGKIPSKPYVS 535
ALEKWGGLHEVSRLL+L +RHPNR+ + KD + + + A+L +KPYVS
Sbjct: 641 ALEKWGGLHEVSRLLALNVRHPNRQLNSRKDNGNTILRTESTE-ADLNSTVNKNNKPYVS 699
Query: 536 QDTQKWAMKLKDLDINWVE 554
QDT+KW LKDLDINWV+
Sbjct: 700 QDTEKWLYNLKDLDINWVQ 718
|
|
| TAIR|locus:2133442 AT4G01650 "AT4G01650" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 554 | |||
| cd08866 | 144 | cd08866, SRPBCC_11, Ligand-binding SRPBCC domain o | 5e-52 | |
| pfam03364 | 125 | pfam03364, Polyketide_cyc, Polyketide cyclase / de | 2e-16 | |
| cd08866 | 144 | cd08866, SRPBCC_11, Ligand-binding SRPBCC domain o | 3e-16 | |
| cd07812 | 141 | cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/Cox | 8e-08 | |
| cd08861 | 142 | cd08861, OtcD1_ARO-CYC_like, N-terminal and C-term | 5e-06 | |
| pfam03364 | 125 | pfam03364, Polyketide_cyc, Polyketide cyclase / de | 6e-06 | |
| cd07821 | 140 | cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance | 0.004 |
| >gnl|CDD|176875 cd08866, SRPBCC_11, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
Score = 173 bits (442), Expect = 5e-52
Identities = 63/146 (43%), Positives = 87/146 (59%), Gaps = 5/146 (3%)
Query: 168 VVASITVKAPVSEVWNVMTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLH 227
VVA + V AP VW V+T Y+ L E +PNLA S++L R N+V + Q G +G+L+
Sbjct: 1 VVARVRVPAPPETVWAVLTDYDNLAEFIPNLAESRLLERNGNRVVLEQTGKQGILFFKFE 60
Query: 228 ARVVMDICEQHE--QEISFEQVEGDFDSFQGKWLFEQLGS-HHTLLKYSVESKMQKNSLL 284
ARVV+++ E+ E +E+ FE VEGDF F+G W E L TLL Y VE K +
Sbjct: 61 ARVVLELREREEFPRELDFEMVEGDFKRFEGSWRLEPLADGGGTLLTYEVEVKPDFFAP- 119
Query: 285 SEAIMEEVIYEDLPSNLCAIRDYVEK 310
++E V+ +DLP+NL AIR E
Sbjct: 120 -VFLVEFVLRQDLPTNLLAIRAEAES 144
|
Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins. Length = 144 |
| >gnl|CDD|217515 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydrase and lipid transport | Back alignment and domain information |
|---|
| >gnl|CDD|176875 cd08866, SRPBCC_11, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176854 cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|176870 cd08861, OtcD1_ARO-CYC_like, N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|217515 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydrase and lipid transport | Back alignment and domain information |
|---|
| >gnl|CDD|176863 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 554 | |||
| cd08866 | 144 | SRPBCC_11 Ligand-binding SRPBCC domain of an uncha | 99.91 | |
| PRK10724 | 158 | hypothetical protein; Provisional | 99.86 | |
| cd07813 | 138 | COQ10p_like Coenzyme Q-binding protein COQ10p and | 99.86 | |
| cd08861 | 142 | OtcD1_ARO-CYC_like N-terminal and C-terminal aroma | 99.79 | |
| cd08860 | 146 | TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom | 99.77 | |
| PF03364 | 130 | Polyketide_cyc: Polyketide cyclase / dehydrase and | 99.76 | |
| cd07819 | 140 | SRPBCC_2 Ligand-binding SRPBCC domain of an unchar | 99.74 | |
| COG2867 | 146 | Oligoketide cyclase/lipid transport protein [Lipid | 99.73 | |
| cd07817 | 139 | SRPBCC_8 Ligand-binding SRPBCC domain of an unchar | 99.64 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 99.63 | |
| cd08865 | 140 | SRPBCC_10 Ligand-binding SRPBCC domain of an uncha | 99.58 | |
| PF10604 | 139 | Polyketide_cyc2: Polyketide cyclase / dehydrase an | 99.57 | |
| cd07821 | 140 | PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), | 99.56 | |
| cd07818 | 150 | SRPBCC_1 Ligand-binding SRPBCC domain of an unchar | 99.54 | |
| cd05018 | 144 | CoxG Carbon monoxide dehydrogenase subunit G (CoxG | 99.54 | |
| cd08862 | 138 | SRPBCC_Smu440-like Ligand-binding SRPBCC domain of | 99.51 | |
| cd07824 | 146 | SRPBCC_6 Ligand-binding SRPBCC domain of an unchar | 99.47 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 99.47 | |
| cd07822 | 141 | SRPBCC_4 Ligand-binding SRPBCC domain of an unchar | 99.43 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 99.37 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 99.37 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 99.35 | |
| cd07820 | 137 | SRPBCC_3 Ligand-binding SRPBCC domain of an unchar | 99.34 | |
| cd07823 | 146 | SRPBCC_5 Ligand-binding SRPBCC domain of an unchar | 99.33 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 99.32 | |
| cd07814 | 139 | SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- | 99.32 | |
| cd07812 | 141 | SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR | 99.31 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 99.3 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 99.28 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 99.23 | |
| cd07825 | 144 | SRPBCC_7 Ligand-binding SRPBCC domain of an unchar | 99.21 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 99.2 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 99.2 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 99.18 | |
| cd08913 | 240 | START_STARD14-like Lipid-binding START domain of m | 99.15 | |
| COG5637 | 217 | Predicted integral membrane protein [Function unkn | 99.14 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 99.11 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 99.08 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 99.08 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 99.07 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 99.06 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 99.02 | |
| cd07816 | 148 | Bet_v1-like Ligand-binding bet_v_1 domain of major | 98.85 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 98.81 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 98.78 | |
| KOG3177 | 227 | consensus Oligoketide cyclase/lipid transport prot | 98.75 | |
| cd08866 | 144 | SRPBCC_11 Ligand-binding SRPBCC domain of an uncha | 98.73 | |
| cd08893 | 136 | SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi | 98.65 | |
| PF06240 | 140 | COXG: Carbon monoxide dehydrogenase subunit G (Cox | 98.64 | |
| COG3427 | 146 | Carbon monoxide dehydrogenase subunit G, CoxG [Ene | 98.63 | |
| cd08899 | 157 | SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan | 98.6 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 98.55 | |
| PF03364 | 130 | Polyketide_cyc: Polyketide cyclase / dehydrase and | 98.47 | |
| cd08894 | 139 | SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan | 98.37 | |
| cd08898 | 145 | SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan | 98.35 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 98.33 | |
| cd08897 | 133 | SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligan | 98.31 | |
| cd07813 | 138 | COQ10p_like Coenzyme Q-binding protein COQ10p and | 98.27 | |
| cd08861 | 142 | OtcD1_ARO-CYC_like N-terminal and C-terminal aroma | 98.17 | |
| cd08896 | 146 | SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan | 98.14 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 98.11 | |
| cd08895 | 146 | SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan | 98.08 | |
| cd08901 | 136 | SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligan | 98.06 | |
| PF08327 | 124 | AHSA1: Activator of Hsp90 ATPase homolog 1-like pr | 98.03 | |
| cd08900 | 143 | SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan | 97.99 | |
| PF00407 | 151 | Bet_v_1: Pathogenesis-related protein Bet v I fami | 97.97 | |
| cd08891 | 149 | SRPBCC_CalC Ligand-binding SRPBCC domain of Microm | 97.93 | |
| PRK10724 | 158 | hypothetical protein; Provisional | 97.91 | |
| cd07826 | 142 | SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan | 97.89 | |
| COG3832 | 149 | Uncharacterized conserved protein [Function unknow | 97.51 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 97.43 | |
| cd07819 | 140 | SRPBCC_2 Ligand-binding SRPBCC domain of an unchar | 97.42 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 97.32 | |
| cd08892 | 126 | SRPBCC_Aha1 Putative hydrophobic ligand-binding SR | 97.18 | |
| cd07817 | 139 | SRPBCC_8 Ligand-binding SRPBCC domain of an unchar | 97.02 | |
| PTZ00220 | 132 | Activator of HSP-90 ATPase; Provisional | 96.91 | |
| cd08860 | 146 | TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom | 96.84 | |
| cd07821 | 140 | PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), | 96.26 | |
| cd07818 | 150 | SRPBCC_1 Ligand-binding SRPBCC domain of an unchar | 96.02 | |
| cd08865 | 140 | SRPBCC_10 Ligand-binding SRPBCC domain of an uncha | 95.97 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 95.96 | |
| cd05018 | 144 | CoxG Carbon monoxide dehydrogenase subunit G (CoxG | 95.92 | |
| KOG2761 | 219 | consensus START domain-containing proteins involve | 95.6 | |
| COG4276 | 153 | Uncharacterized conserved protein [Function unknow | 95.56 | |
| PF10604 | 139 | Polyketide_cyc2: Polyketide cyclase / dehydrase an | 94.99 | |
| PF10698 | 159 | DUF2505: Protein of unknown function (DUF2505); In | 94.98 | |
| cd08862 | 138 | SRPBCC_Smu440-like Ligand-binding SRPBCC domain of | 94.87 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 93.61 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 93.6 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 93.46 | |
| cd07824 | 146 | SRPBCC_6 Ligand-binding SRPBCC domain of an unchar | 93.41 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 93.15 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 92.59 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 92.57 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 91.74 | |
| cd07812 | 141 | SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR | 91.6 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 91.12 | |
| cd08864 | 208 | SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- | 90.56 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 90.54 | |
| cd07820 | 137 | SRPBCC_3 Ligand-binding SRPBCC domain of an unchar | 89.85 | |
| COG2867 | 146 | Oligoketide cyclase/lipid transport protein [Lipid | 89.01 | |
| PF08982 | 149 | DUF1857: Domain of unknown function (DUF1857); Int | 88.9 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 87.59 | |
| cd07822 | 141 | SRPBCC_4 Ligand-binding SRPBCC domain of an unchar | 83.93 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 83.07 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 82.69 | |
| cd07823 | 146 | SRPBCC_5 Ligand-binding SRPBCC domain of an unchar | 82.44 | |
| COG2005 | 130 | ModE N-terminal domain of molybdenum-binding prote | 81.98 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 81.68 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 81.28 |
| >cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
Probab=99.91 E-value=6.2e-23 Score=184.99 Aligned_cols=141 Identities=44% Similarity=0.737 Sum_probs=124.0
Q ss_pred EEEEEEEcCCHHHHHHHHhCcCcccccCcCCcEEEEEEecCCEEEEEEEeccceeEEEEEEEEEEEEeecC--CCeEEEE
Q 008769 168 VVASITVKAPVSEVWNVMTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLHARVVMDICEQH--EQEISFE 245 (554)
Q Consensus 168 V~asI~I~APpe~VWaVLTDyE~yPewiP~V~sSrVL~r~g~~vrv~q~g~~gil~~~~~~rvvLdv~E~~--~rrIsf~ 245 (554)
|++++.|+|||++||++|+|+++||+|+|.|.+++++.+.+++.++++.+..+++...+...+++++.+.+ ++.+.|+
T Consensus 1 ~~~~~~i~a~~~~Vw~~l~D~~~~~~w~p~v~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~i~~~ 80 (144)
T cd08866 1 VVARVRVPAPPETVWAVLTDYDNLAEFIPNLAESRLLERNGNRVVLEQTGKQGILFFKFEARVVLELREREEFPRELDFE 80 (144)
T ss_pred CeEEEEECCCHHHHHHHHhChhhHHhhCcCceEEEEEEcCCCEEEEEEeeeEEEEeeeeeEEEEEEEEEecCCCceEEEE
Confidence 46899999999999999999999999999999999998877777777766666555556666666666544 6899999
Q ss_pred EEecCCceeEEEEEEEEcCC-CeEEEEEEEEEEeccCccchHHHHHHHHHhhHHHHHHHHHHHHHh
Q 008769 246 QVEGDFDSFQGKWLFEQLGS-HHTLLKYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEK 310 (554)
Q Consensus 246 ~veGdfr~f~G~W~Leplgd-G~TrVtY~v~~eP~~gg~LP~~Lver~vre~l~~~L~ALR~rAEr 310 (554)
+++|+|..+.|.|+|++.++ ++|+|+|.++++|. +.+|.++++.++++.+..+|++||++||+
T Consensus 81 ~~~g~~~~~~g~w~~~~~~~~~~t~v~~~~~~~~~--~~~p~~l~~~~~~~~~~~~l~~lr~~ae~ 144 (144)
T cd08866 81 MVEGDFKRFEGSWRLEPLADGGGTLLTYEVEVKPD--FFAPVFLVEFVLRQDLPTNLLAIRAEAES 144 (144)
T ss_pred EcCCchhceEEEEEEEECCCCCeEEEEEEEEEEeC--CCCCHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence 99999999999999999987 68999999999985 57899999999999999999999999984
|
Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins. |
| >PRK10724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins | Back alignment and domain information |
|---|
| >cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains | Back alignment and domain information |
|---|
| >cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains | Back alignment and domain information |
|---|
| >PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp | Back alignment and domain information |
|---|
| >cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis | Back alignment and domain information |
|---|
| >cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
| >cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) | Back alignment and domain information |
|---|
| >cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu | Back alignment and domain information |
|---|
| >cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins | Back alignment and domain information |
|---|
| >cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins | Back alignment and domain information |
|---|
| >COG5637 Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG3177 consensus Oligoketide cyclase/lipid transport protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain | Back alignment and domain information |
|---|
| >PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster | Back alignment and domain information |
|---|
| >COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp | Back alignment and domain information |
|---|
| >cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins | Back alignment and domain information |
|---|
| >cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains | Back alignment and domain information |
|---|
| >cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08901 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >PF08327 AHSA1: Activator of Hsp90 ATPase homolog 1-like protein; InterPro: IPR013538 This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms | Back alignment and domain information |
|---|
| >cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins | Back alignment and domain information |
|---|
| >PRK10724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >COG3832 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins | Back alignment and domain information |
|---|
| >cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PTZ00220 Activator of HSP-90 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains | Back alignment and domain information |
|---|
| >cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
| >cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) | Back alignment and domain information |
|---|
| >KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4276 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis | Back alignment and domain information |
|---|
| >PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria | Back alignment and domain information |
|---|
| >cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF08982 DUF1857: Domain of unknown function (DUF1857); InterPro: IPR015075 This protein has no known function | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >COG2005 ModE N-terminal domain of molybdenum-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 554 | ||||
| 3tvr_A | 173 | Crystal Structure Of Streptomyces Coelicolor Polyke | 6e-04 | ||
| 3tl1_A | 159 | Crystal Structure Of The Streptomyces Coelicolor Wh | 6e-04 |
| >pdb|3TVR|A Chain A, Crystal Structure Of Streptomyces Coelicolor Polyketide AromataseCYCLASE WHIE-Orfvi Length = 173 | Back alignment and structure |
|
| >pdb|3TL1|A Chain A, Crystal Structure Of The Streptomyces Coelicolor Whie Orfvi Polyketide AromataseCYCLASE Length = 159 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 554 | |||
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 1e-25 | |
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 9e-04 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 3e-25 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 1e-05 | |
| 3tvq_A | 169 | Multifunctional cyclase-dehydratase-3-O-methyl TR | 5e-20 | |
| 3tfz_A | 172 | Cyclase; helix-GRIP, BET V1-like superfamily, bios | 3e-10 | |
| 3ggn_A | 155 | Uncharacterized protein DR_A0006; structural genom | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 9e-05 |
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Length = 159 | Back alignment and structure |
|---|
Score = 102 bits (255), Expect = 1e-25
Identities = 33/152 (21%), Positives = 71/152 (46%), Gaps = 9/152 (5%)
Query: 171 SITVKAPVSEVWNVMTAYETLPEIVPNLAISKILSRENNKVRI---LQEGCKGLLYMVLH 227
IT+ AP+ VWN+ E P + A ++L R+++KV + G ++ +
Sbjct: 8 EITIAAPMELVWNMTNDIEKWPGLFSEYASVEVLGRDDDKVTFRLTMHPDADGKVWSWVS 67
Query: 228 ARVVMDICEQHEQEISFEQVE-GDFDSFQGKWLFEQLGSHHTLLKYSVESKMQKNSLLSE 286
RV + + + ++VE G F W + + T+++++ + M+ ++ + +
Sbjct: 68 ERVA----DPVTRTVRAQRVETGPFQYMNIVWEYAETA-EGTVMRWTQDFAMKPDAPVDD 122
Query: 287 AIMEEVIYEDLPSNLCAIRDYVEKREGDNSLA 318
A M + I + + + IRD +E+ G+ A
Sbjct: 123 AWMTDNINRNSRTQMALIRDRIEQAAGERRTA 154
|
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Length = 159 | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Length = 147 | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Length = 147 | Back alignment and structure |
|---|
| >3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Length = 169 | Back alignment and structure |
|---|
| >3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Length = 172 | Back alignment and structure |
|---|
| >3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Length = 155 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Length = 151 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 554 | |||
| 1t17_A | 148 | Conserved hypothetical protein; beta-alpha-beta-BE | 99.86 | |
| 3tfz_A | 172 | Cyclase; helix-GRIP, BET V1-like superfamily, bios | 99.85 | |
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 99.85 | |
| 3tvq_A | 169 | Multifunctional cyclase-dehydratase-3-O-methyl TR | 99.83 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 99.8 | |
| 3ggn_A | 155 | Uncharacterized protein DR_A0006; structural genom | 99.69 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 99.68 | |
| 3p9v_A | 161 | Uncharacterized protein; structural genomics, PSI- | 99.61 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 99.59 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 99.59 | |
| 2pcs_A | 162 | Conserved protein; structural genomics, unknown fu | 99.56 | |
| 2ns9_A | 157 | Hypothetical protein APE2225; uncharacterized cons | 99.5 | |
| 3ijt_A | 155 | SMU.440, putative uncharacterized protein; hypothe | 99.5 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 99.47 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 99.47 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 99.29 | |
| 1tw0_A | 157 | Pathogenesis-related class 10 protein SPE-16; seve | 99.28 | |
| 2qim_A | 158 | PR10.2B; trans-zeatin, cytokinin, plant hormones, | 99.27 | |
| 1e09_A | 159 | PRU AV 1; allergen, major cherry allergen, pathoge | 99.25 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 99.22 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 99.21 | |
| 1icx_A | 155 | Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, | 99.19 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 99.16 | |
| 3oqu_A | 205 | Abscisic acid receptor PYL9; RCAR1, hormone recept | 99.13 | |
| 2i9y_A | 166 | Major latex protein-like protein 28 or MLP-like pr | 99.12 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 99.12 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 99.11 | |
| 3kl1_A | 190 | PYL2, putative uncharacterized protein AT2G26040; | 99.04 | |
| 2qpv_A | 156 | Uncharacterized protein ATU1531; structural genomi | 99.03 | |
| 2flh_A | 155 | Cytokinin-specific binding protein; zeatin, pathog | 99.01 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 99.0 | |
| 3jrs_A | 208 | PYL1, putative uncharacterized protein AT5G46790; | 99.0 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 98.98 | |
| 3rws_A | 168 | MTN13 protein; zeatin, cytokinin, hormone, lucerne | 98.98 | |
| 4a8u_A | 159 | Major pollen allergen BET V 1-J; PR-10 protein; 1. | 98.95 | |
| 2vjg_A | 154 | Major allergen DAU C 1; major carrot allergen, pat | 98.94 | |
| 3k3k_A | 211 | Abscisic acid receptor PYR1; ABA receptor, plant h | 98.93 | |
| 1xuv_A | 178 | Hypothetical protein MM0500; alpha-beta protein, n | 98.85 | |
| 2il5_A | 171 | Hypothetical protein; structural genomics, APC2365 | 98.82 | |
| 2vq5_A | 201 | S-norcoclaurine synthase; lyase, S- norcoclaurine | 98.81 | |
| 2leq_A | 146 | Uncharacterized protein; start domains, structural | 98.79 | |
| 3qrz_A | 223 | Abscisic acid receptor PYL5; crystal, hormone rece | 98.76 | |
| 3oji_A | 189 | Abscisic acid receptor PYL3; crystal, PP2C, pyraba | 98.76 | |
| 3ie5_A | 165 | Phenolic oxidative coupling protein HYP-1; hyperic | 98.75 | |
| 1z94_A | 147 | Conserved hypothetical protein; NESG, CV1439, stru | 98.74 | |
| 2lcg_A | 142 | Uncharacterized protein; start domain, structural | 98.66 | |
| 2ldk_A | 172 | Uncharacterized protein; structural genomics, nort | 98.65 | |
| 1xfs_A | 178 | NC_840354, conserved hypothetical protein; structu | 98.64 | |
| 2lgh_A | 144 | Uncharacterized protein; AHSA1, start domain, COG3 | 98.64 | |
| 2lf2_A | 175 | Uncharacterized protein; NESG, structural genomics | 98.61 | |
| 3pu2_A | 164 | Uncharacterized protein; SRPBCC superfamily, PSI-b | 98.6 | |
| 2l8o_A | 144 | Uncharacterized protein; mixed alpha-beta protein, | 98.59 | |
| 1xn6_A | 143 | Hypothetical protein BC4709; structural genomics, | 98.59 | |
| 3q6a_A | 135 | Uncharacterized protein; structural genomics, PSI- | 98.59 | |
| 2l9p_A | 164 | Uncharacterized protein; structural genomics, nort | 98.52 | |
| 2lak_A | 160 | AHSA1-like protein RHE_CH02687; NESG, structural g | 98.49 | |
| 2nn5_A | 184 | Hypothetical protein EF_2215; structural genomics, | 98.46 | |
| 3put_A | 166 | Hypothetical conserved protein; structural genomic | 98.41 | |
| 2wql_A | 154 | Major allergen DAU C 1; pathogenesis-related prote | 98.41 | |
| 3rd6_A | 161 | MLL3558 protein; structural genomics, PSI-biology, | 98.41 | |
| 3q64_A | 162 | MLL3774 protein; structural genomics, PSI-biology, | 98.39 | |
| 3eli_A | 152 | AHSA1, AHA1 domain protein; alpha-beta protein, st | 98.36 | |
| 3uid_A | 168 | Putative uncharacterized protein; SRPBCC superfami | 98.28 | |
| 3q63_A | 151 | MLL2253 protein; structural genomics, PSI-biology, | 98.26 | |
| 2k5g_A | 191 | Uncharacterized protein; structural genomiccs, pro | 98.25 | |
| 1vjh_A | 122 | BET V I allergen family; structural genomics, cent | 98.23 | |
| 1xn5_A | 146 | BH1534 unknown conserved protein; structural genom | 98.19 | |
| 2kew_A | 152 | Uncharacterized protein YNDB; start domain, resona | 97.99 | |
| 1t17_A | 148 | Conserved hypothetical protein; beta-alpha-beta-BE | 97.96 | |
| 4fpw_A | 181 | CALU16; structural genomics, PSI-biology, northeas | 97.93 | |
| 1x53_A | 145 | Activator of 90 kDa heat shock protein ATPase homo | 97.85 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 97.68 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 97.63 | |
| 1zxf_A | 155 | CALC; SELF-sacrificing resistance protein, structu | 97.62 | |
| 2luz_A | 192 | CALU16; structural genomics, northeast structural | 97.62 | |
| 3tvq_A | 169 | Multifunctional cyclase-dehydratase-3-O-methyl TR | 97.62 | |
| 3ni8_A | 158 | PFC0360W protein; heat shock, malaria, ATPase, str | 97.58 | |
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 97.47 | |
| 3tfz_A | 172 | Cyclase; helix-GRIP, BET V1-like superfamily, bios | 97.3 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 97.05 | |
| 3p9v_A | 161 | Uncharacterized protein; structural genomics, PSI- | 96.63 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 95.99 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 95.76 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 95.57 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 95.54 | |
| 3ggn_A | 155 | Uncharacterized protein DR_A0006; structural genom | 95.34 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 94.06 | |
| 2lio_A | 136 | Uncharacterized protein; structural genomics, nort | 94.02 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 92.94 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 92.46 | |
| 3ijt_A | 155 | SMU.440, putative uncharacterized protein; hypothe | 92.39 | |
| 2pcs_A | 162 | Conserved protein; structural genomics, unknown fu | 92.05 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 91.99 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 91.62 | |
| 2ffs_A | 157 | Hypothetical protein PA1206; 7-stranded beta sheet | 90.58 | |
| 2ns9_A | 157 | Hypothetical protein APE2225; uncharacterized cons | 88.51 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 88.26 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 84.82 |
| >1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
Probab=99.86 E-value=9.4e-21 Score=171.12 Aligned_cols=140 Identities=16% Similarity=0.247 Sum_probs=117.7
Q ss_pred EEEEEEEEEcCCHHHHHHHHhCcCcccccCcCCcEEEEEEecC----CEEEEE-EEeccceeEEEEEEEEEEEEeecCCC
Q 008769 166 RCVVASITVKAPVSEVWNVMTAYETLPEIVPNLAISKILSREN----NKVRIL-QEGCKGLLYMVLHARVVMDICEQHEQ 240 (554)
Q Consensus 166 r~V~asI~I~APpe~VWaVLTDyE~yPewiP~V~sSrVL~r~g----~~vrv~-q~g~~gil~~~~~~rvvLdv~E~~~r 240 (554)
..++.++.|+||+++||++++|+++||+|+|+|.+++++++.+ +..... ..+..++ ...|++++++ .+++
T Consensus 2 ~~~~~s~~i~ap~~~v~~~v~D~~~~p~~~p~~~~~~v~~~~~~~g~~~~~~~~~~~~~~~-~~~~~~~v~~----~~~~ 76 (148)
T 1t17_A 2 HRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFL-REKFATRVRR----DKDA 76 (148)
T ss_dssp CEEEEEEEESSCTHHHHHHHTTTTCCSSCCSSCCCCCEEEEEEETTEEEEEEEEECSTTSS-CCEEEEEEEE----ETTT
T ss_pred CEEEEEEEecCCHHHHHHHHHHHhhHHhhCCCcCeeEEEEecCCCCCceEEEEEEEEecce-eEEEEEEEEE----cCCC
Confidence 4688999999999999999999999999999999999998644 333332 3344443 3567776654 3555
Q ss_pred -eEEEEEEecCCceeEEEEEEEEcCCCeEEEEEEEEEEeccCccchHHHHHHHHHhhHHHHHHHHHHHHHhhhC
Q 008769 241 -EISFEQVEGDFDSFQGKWLFEQLGSHHTLLKYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREG 313 (554)
Q Consensus 241 -rIsf~~veGdfr~f~G~W~LeplgdG~TrVtY~v~~eP~~gg~LP~~Lver~vre~l~~~L~ALR~rAEr~~~ 313 (554)
+|.|++++|+|+.+.|.|+|++.++| |+|+|.+++++. ++++..+++.++...+..++++|++|+++.++
T Consensus 77 ~~i~~~~~~G~f~~~~g~w~f~~~~~g-t~v~~~~~~~~~--~~l~~~l~~~~~~~~~~~~~~~f~~r~~~~~~ 147 (148)
T 1t17_A 77 RSIDVSLLYGPFKRLNNGWRFMPEGDA-TRVEFVIEFAFK--SALLDAMLAANVDRAAGKLIACFEARAQQLHG 147 (148)
T ss_dssp CEEEEEESSTTSSCEEEEEEEEEETTE-EEEEEEEEECCS--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred cEEEEEECCCChhccEEEEEEEECCCC-eEEEEEEEEEEC--cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence 99999999999999999999999876 999999999984 56788999999999999999999999998875
|
| >3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} | Back alignment and structure |
|---|
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A | Back alignment and structure |
|---|
| >3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} | Back alignment and structure |
|---|
| >2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* | Back alignment and structure |
|---|
| >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A | Back alignment and structure |
|---|
| >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C | Back alignment and structure |
|---|
| >1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* | Back alignment and structure |
|---|
| >2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 | Back alignment and structure |
|---|
| >2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A | Back alignment and structure |
|---|
| >3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* | Back alignment and structure |
|---|
| >1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* | Back alignment and structure |
|---|
| >2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* | Back alignment and structure |
|---|
| >3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 | Back alignment and structure |
|---|
| >1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} | Back alignment and structure |
|---|
| >2ldk_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, ALP protein, PSI; 1.70A {Nitrosomonas europaea} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2lgh_A Uncharacterized protein; AHSA1, start domain, COG3832, PF08327, HSP90, heat shock, ST genomics, PSI-biology; NMR {Aeromonas hydrophila subsp} | Back alignment and structure |
|---|
| >2lf2_A Uncharacterized protein; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >2l9p_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} | Back alignment and structure |
|---|
| >2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, structure initiative; HET: MSE; 1.45A {Enterococcus faecalis} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* | Back alignment and structure |
|---|
| >2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A | Back alignment and structure |
|---|
| >3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 | Back alignment and structure |
|---|
| >3q63_A MLL2253 protein; structural genomics, PSI-biology, protein structure initiati alpha-beta protein, unknown, structure genomics; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A | Back alignment and structure |
|---|
| >1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, BACI halodurans protein BH1534, alpha + beta; NMR {Bacillus halodurans} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown FU PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A | Back alignment and structure |
|---|
| >1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >4fpw_A CALU16; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.50A {Micromonospora echinospora} PDB: 2luz_A | Back alignment and structure |
|---|
| >1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A 2l65_A* | Back alignment and structure |
|---|
| >2luz_A CALU16; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A | Back alignment and structure |
|---|
| >3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A | Back alignment and structure |
|---|
| >3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} | Back alignment and structure |
|---|
| >3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >2lio_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A | Back alignment and structure |
|---|
| >2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2ffs_A Hypothetical protein PA1206; 7-stranded beta sheet, C-terminal helix, structural genomics protein structure initiative; HET: MSE; 2.50A {Pseudomonas aeruginosa} SCOP: d.129.3.7 | Back alignment and structure |
|---|
| >2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 554 | ||||
| d2d4ra1 | 146 | d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 | 2e-17 | |
| d2d4ra1 | 146 | d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 | 5e-06 | |
| d2rera1 | 155 | d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, c | 2e-16 | |
| d2b79a1 | 137 | d.129.3.9 (A:1-137) Hypothetical protein SMU440 {S | 8e-07 | |
| d2pcsa1 | 147 | d.129.3.10 (A:1-147) Hypothetical protein GKP20 {G | 0.001 | |
| d3cnwa1 | 138 | d.129.3.8 (A:3-140) Uncharacterized protein XoxI { | 0.002 | |
| d2qpva1 | 133 | d.129.3.8 (A:1-133) Uncharacterized protein Atu153 | 0.002 |
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Length = 146 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: oligoketide cyclase/dehydrase-like domain: Hypothetical protein TTHA0849 species: Thermus thermophilus [TaxId: 274]
Score = 77.2 bits (189), Expect = 2e-17
Identities = 27/145 (18%), Positives = 56/145 (38%), Gaps = 6/145 (4%)
Query: 168 VVASITVKAPVSEVWNVMTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLH 227
V A + AP V+ + E L + + ++++RE + R +
Sbjct: 3 VRAERYIPAPPERVYRLAKDLEGLKPYLKEVESLEVVAREGARTRSRWVAVAMGKKVRWL 62
Query: 228 ARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLLKYSVESKMQKNSL--LS 285
D F EGDFD ++G W+F G T + ++ ++ L
Sbjct: 63 EEEEWDDENLR---NRFFSPEGDFDRYEGTWVFLPEG-EGTRVVLTLTYELTIPIFGGLL 118
Query: 286 EAIMEEVIYEDLPSNLCAIRDYVEK 310
++++++ E++ S L + + V
Sbjct: 119 RKLVQKLMQENVESLLKGLEERVLA 143
|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Length = 146 | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Length = 155 | Back information, alignment and structure |
|---|
| >d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} Length = 137 | Back information, alignment and structure |
|---|
| >d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Length = 147 | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Length = 138 | Back information, alignment and structure |
|---|
| >d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 554 | |||
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 99.86 | |
| d1t17a_ | 148 | Hypothetical protein CC1736 {Caulobacter crescentu | 99.78 | |
| d2rera1 | 155 | Multifunctional enzyme TcmN, cyclase/aromatase dom | 99.76 | |
| d2b79a1 | 137 | Hypothetical protein SMU440 {Streptococcus mutans | 99.62 | |
| d3cnwa1 | 138 | Uncharacterized protein XoxI {Bacillus cereus [Tax | 99.6 | |
| d2ns9a1 | 147 | Hypothetical protein APE2225 {Aeropyrum pernix [Ta | 99.57 | |
| d2pcsa1 | 147 | Hypothetical protein GKP20 {Geobacillus kaustophil | 99.43 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 99.35 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 99.3 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 99.13 | |
| d2qpva1 | 133 | Uncharacterized protein Atu1531 {Agrobacterium tum | 98.95 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 98.87 | |
| d1xuva_ | 163 | Hypothetical protein MM0500 {Methanosarcina mazei | 98.78 | |
| d1txca1 | 147 | Plant pathogenesis-related protein PR10 {Jicama (P | 98.57 | |
| d2il5a1 | 164 | Hypothetical protein SA2116 {Staphylococcus aureus | 98.49 | |
| d2bk0a1 | 153 | Major allergen api g 1 {Celery (Apium graveolens) | 98.37 | |
| d1xfsa_ | 165 | Hypothetical protein NE0264 {Nitrosomonas europaea | 98.35 | |
| d1xdfa1 | 157 | Plant pathogenesis-related protein PR10 {Yellow lu | 98.27 | |
| d1fm4a_ | 159 | Major tree pollen allergen {European white birch ( | 98.27 | |
| d1e09a_ | 159 | Major tree pollen allergen {Sweet cherry (Prunus a | 98.27 | |
| d2rera1 | 155 | Multifunctional enzyme TcmN, cyclase/aromatase dom | 98.25 | |
| d1z94a1 | 143 | Hypothetical protein CV1439 {Chromobacterium viola | 98.23 | |
| d1icxa_ | 155 | Plant pathogenesis-related protein PR10 {Yellow lu | 98.22 | |
| d1xn5a_ | 138 | Hypothetical protein BH1534 {Bacillus halodurans [ | 98.05 | |
| d1xn6a_ | 143 | Hypothetical protein BC4709 {Bacillus cereus [TaxI | 98.02 | |
| d1zxfa1 | 155 | Calicheamicin gene cluster protein CalC {Micromono | 97.98 | |
| d2nn5a1 | 160 | Hypothetical protein EF2215 {Enterococcus faecalis | 97.92 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 97.91 | |
| d3elia1 | 143 | Uncharacterized protein SPO3351 {Silicibacter pome | 97.69 | |
| d2k5ga1 | 183 | Uncharacterized protein BPP1335 {Bordetella parape | 97.43 | |
| d1t17a_ | 148 | Hypothetical protein CC1736 {Caulobacter crescentu | 97.02 | |
| d1x53a1 | 132 | Activator of 90 kda heat shock protein ATPase homo | 96.53 | |
| d1vjha_ | 120 | Hypothetical protein At1G24000 {Thale cress (Arabi | 96.49 | |
| d2b79a1 | 137 | Hypothetical protein SMU440 {Streptococcus mutans | 96.49 | |
| d3cnwa1 | 138 | Uncharacterized protein XoxI {Bacillus cereus [Tax | 95.81 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 94.96 | |
| d2ns9a1 | 147 | Hypothetical protein APE2225 {Aeropyrum pernix [Ta | 94.13 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 92.45 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 90.7 | |
| d2ffsa1 | 151 | Hypothetical protein PA1206 {Pseudomonas aeruginos | 87.11 |
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: oligoketide cyclase/dehydrase-like domain: Hypothetical protein TTHA0849 species: Thermus thermophilus [TaxId: 274]
Probab=99.86 E-value=2.4e-20 Score=164.18 Aligned_cols=141 Identities=18% Similarity=0.246 Sum_probs=115.7
Q ss_pred EEEEEEEEcCCHHHHHHHHhCcCcccccCcCCcEEEEEEecCCEEEEEEEeccceeEEEEEEEEEEEEeecCCCeEEEEE
Q 008769 167 CVVASITVKAPVSEVWNVMTAYETLPEIVPNLAISKILSRENNKVRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQ 246 (554)
Q Consensus 167 ~V~asI~I~APpe~VWaVLTDyE~yPewiP~V~sSrVL~r~g~~vrv~q~g~~gil~~~~~~rvvLdv~E~~~rrIsf~~ 246 (554)
+|+++++|+|||++||++|+||++||+|+|+|.+++++++.++...+..........+.++.+++. ..+++.|.|.+
T Consensus 2 ~v~~~~~I~ap~~~V~~~l~D~~~~~~w~p~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~i~~~~ 78 (146)
T d2d4ra1 2 EVRAERYIPAPPERVYRLAKDLEGLKPYLKEVESLEVVAREGARTRSRWVAVAMGKKVRWLEEEEW---DDENLRNRFFS 78 (146)
T ss_dssp EEEEEEEESSCHHHHHHHHHCHHHHGGGCTTEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEE---ETTTTEEEEEE
T ss_pred EEEEEEEECCCHHHHHHHHHChhhHHhhccccEEEEEEEecCCcceEEEEEEeeeeeEEEEEEEEE---cCCCCEEEEEE
Confidence 489999999999999999999999999999999999999988876554432222223455554432 35678999999
Q ss_pred EecCCceeEEEEEEEEcCCCeEEEEEEEEEEeccC--ccchHHHHHHHHHhhHHHHHHHHHHHHHhh
Q 008769 247 VEGDFDSFQGKWLFEQLGSHHTLLKYSVESKMQKN--SLLSEAIMEEVIYEDLPSNLCAIRDYVEKR 311 (554)
Q Consensus 247 veGdfr~f~G~W~LeplgdG~TrVtY~v~~eP~~g--g~LP~~Lver~vre~l~~~L~ALR~rAEr~ 311 (554)
..|+|..+.|.|+|++.++ +|+|+|.+++++..+ ..++..++++.+++.+..+|++|+++++..
T Consensus 79 ~~g~~~~~~g~w~l~~~~~-gT~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~ 144 (146)
T d2d4ra1 79 PEGDFDRYEGTWVFLPEGE-GTRVVLTLTYELTIPIFGGLLRKLVQKLMQENVESLLKGLEERVLAA 144 (146)
T ss_dssp EEESCSEEEEEEEEEECSS-SEEEEEEEEEECCCTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred ccCCcceEEEEEEEEecCC-ceEEEEEEEEEEcCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence 9999999999999999886 599999999986422 235778899999999999999999999864
|
| >d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} | Back information, alignment and structure |
|---|
| >d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} | Back information, alignment and structure |
|---|
| >d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} | Back information, alignment and structure |
|---|
| >d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
| >d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} | Back information, alignment and structure |
|---|
| >d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} | Back information, alignment and structure |
|---|
| >d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
| >d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} | Back information, alignment and structure |
|---|
| >d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} | Back information, alignment and structure |
|---|
| >d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|