Citrus Sinensis ID: 008816

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550--
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEAK
cccEEEEEccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccEEEEEEEEccccEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHccccccEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHcc
cccEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEEccHHcHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHcHccccccccccccccccccccccHHHHccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHccccEEEEEccccHHccHHHHHHHHHHHHHHcccccEEEEEEHHHcccHHHHHHHcc
MLEQLLIFTRGGLILWTCKELgnalkgspidTLIRSCLLEersglasfnydsagaaYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFseiydpkrtdysdFDEMFRQLRKEAEARAEELKKSKqvtkpmnnlkkqggqlqkggfergsnrsgggsanddgdsdnmrgrklenghsnvgnveieesrvtgvangkentssnigafdvSKLQKLRnkggkktdtvvskgsnpdpkkkitkknrvwddsppeskldftdpaggngsnieveaadhgesmmdkeevfssdseseedeevgkhnkpdakktgwfSSMFQSIAgkanldkaDLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLqvpifekgyekdpAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEAK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSeiydpkrtdySDFDEMFRQLRKEAEARAEElkkskqvtkpmnnlkkqggqlqkggfergsnrsgggsanddgdsdnMRGRKLenghsnvgnveieESRVTgvangkentssnigafdvsklqklrnkggkktdtvvskgsnpdpkkkitkknrvwddsppeskldftdpaggngSNIEVEaadhgesmMDKEEVFssdseseedeevgkhnkpdakktgwFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAaslegkklaSFTRISSIVQAAMEEALVRILTPRRSIDILRDVhaakeqrkpyVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRlqvpifekgyekdpAIVAKEAIqeatrngsdvvLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEAK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQlrkeaearaeelkkSKQVTKPMNNlkkqggqlqkggfergsnrsgggsanddgdsdnMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKeevfssdseseedeevGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYvvvfvgvngvgKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEAK
***QLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYD***********************************************************************************************************************************************************************************************************************WFSSMFQSIA*************LKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCL******
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLR***********************************************************************************************************************************************************************************************************FQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAA*LE*****SFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRK***
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFER**************DSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQK***********************KITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGE***************************DAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEAK
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEE********************************************************************************************************************************************************************************************GWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESKLDFTDPAGGNGSNIEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFVNIITFRGMWSFDCLKRKEAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query552 2.2.26 [Sep-21-2011]
Q9DBG7636 Signal recognition partic yes no 0.871 0.756 0.367 5e-84
Q9U5L1614 Signal recognition partic yes no 0.867 0.780 0.372 1e-78
Q3MHE8639 Signal recognition partic yes no 0.869 0.751 0.359 3e-78
P08240638 Signal recognition partic yes no 0.875 0.757 0.363 4e-77
P06625638 Signal recognition partic yes no 0.856 0.741 0.357 1e-76
Q54ZR7615 Signal recognition partic yes no 0.360 0.323 0.56 6e-59
O43032547 Signal recognition partic yes no 0.333 0.336 0.479 1e-45
P32916621 Signal recognition partic yes no 0.514 0.457 0.342 2e-40
P27414369 Signal recognition partic yes no 0.365 0.547 0.352 9e-31
Q57739409 Signal recognition partic yes no 0.315 0.425 0.428 5e-27
>sp|Q9DBG7|SRPR_MOUSE Signal recognition particle receptor subunit alpha OS=Mus musculus GN=Srpr PE=1 SV=1 Back     alignment and function desciption
 Score =  312 bits (799), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 203/553 (36%), Positives = 300/553 (54%), Gaps = 72/553 (13%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           ML+   IF++GGL+LW  + + ++  G P++ LIRS LL+ER G  SF ++    A TLK
Sbjct: 1   MLDFFTIFSKGGLVLWCFQGVSDSCTG-PVNALIRSVLLQERGGNNSFTHE----ALTLK 55

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYS---------DFDE 111
           +   N+  LVFV  +Q+IL L YVD L+  + + F + Y  +    S         DF  
Sbjct: 56  YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQN 115

Query: 112 MFRQLRKEAEARAE--------ELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGS 163
            F +L +EAE  ++        + + S++  KP+ ++ +  G+  K   E+  N      
Sbjct: 116 DFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKTK---EKAKN------ 166

Query: 164 ANDDGDSDNMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNK 223
                  +  RG K E     +   +   +  +G++ G EN   +       K ++   K
Sbjct: 167 -------NKKRGAKKEGSDGTLATSKTAPAEKSGLSAGPENGELSKEELIRRKREEFIQK 219

Query: 224 GGKKTDTVVSKGSNPDPKKKITKKNRVWDDSPPESK--LDFTDPAGGNGS---------N 272
            GK  D       +  PK+K  K  RVW+     +K  LD++ P   NG+         N
Sbjct: 220 HGKGLDKSSKSTKSDTPKEKGKKAPRVWELGGCANKEVLDYSTPTT-NGTPEAALSEDIN 278

Query: 273 IEVEAADHGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKK--TGWFSSMFQSIAGKANL 330
           + +     G  + D       D  S +DE   ++ KP A K   G    M + + G  +L
Sbjct: 279 L-IRGTGPGGQLQD------LDCSSSDDEGATQNTKPSATKGTLGGMFGMLKGLVGSKSL 331

Query: 331 DKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEAL 390
            + D+E  L  ++D L+ KNVA +IA +LCESVA  LEGK + +F+ ++S V+ A++E+L
Sbjct: 332 SREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESL 391

Query: 391 VRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAA 450
           V+IL P+R +D+LRD+  A+ +++PYVV F GVNGVGKSTNLAK+++WLL++  SV++AA
Sbjct: 392 VQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAA 451

Query: 451 CDTFRSGAVEQLRTHARRL-------------QVPIFEKGYEKDPAIVAKEAIQEATRNG 497
           CDTFR+GAVEQLRTH RRL              V +FEKGY KD A +A EAI  A   G
Sbjct: 452 CDTFRAGAVEQLRTHTRRLTALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQG 511

Query: 498 SDVVLVDTAGRMQ 510
            DVVLVDTAGRMQ
Sbjct: 512 FDVVLVDTAGRMQ 524
Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.
Mus musculus (taxid: 10090)
>sp|Q9U5L1|SRPR_DROME Signal recognition particle receptor subunit alpha homolog OS=Drosophila melanogaster GN=Gtp-bp PE=1 SV=2 Back     alignment and function description
>sp|Q3MHE8|SRPR_BOVIN Signal recognition particle receptor subunit alpha OS=Bos taurus GN=SRPR PE=2 SV=1 Back     alignment and function description
>sp|P08240|SRPR_HUMAN Signal recognition particle receptor subunit alpha OS=Homo sapiens GN=SRPR PE=1 SV=2 Back     alignment and function description
>sp|P06625|SRPR_CANFA Signal recognition particle receptor subunit alpha OS=Canis familiaris GN=SRPR PE=2 SV=2 Back     alignment and function description
>sp|Q54ZR7|SRPR_DICDI Signal recognition particle receptor subunit alpha OS=Dictyostelium discoideum GN=srpr PE=3 SV=1 Back     alignment and function description
>sp|O43032|SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp101 PE=3 SV=1 Back     alignment and function description
>sp|P32916|SRPR_YEAST Signal recognition particle receptor subunit alpha homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP101 PE=1 SV=2 Back     alignment and function description
>sp|P27414|FTSY_SULAC Signal recognition particle receptor FtsY OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ftsY PE=3 SV=1 Back     alignment and function description
>sp|Q57739|FTSY_METJA Signal recognition particle receptor FtsY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ftsY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
449453958617 PREDICTED: signal recognition particle r 0.914 0.818 0.835 0.0
224091775624 predicted protein [Populus trichocarpa] 0.918 0.812 0.817 0.0
225445848616 PREDICTED: signal recognition particle r 0.913 0.818 0.827 0.0
255577019618 signal recognition particle receptor alp 0.913 0.815 0.832 0.0
297798906633 signal recognition particle receptor alp 0.918 0.800 0.777 0.0
15234792634 signal recognition particle receptor sub 0.918 0.799 0.773 0.0
356517002623 PREDICTED: signal recognition particle r 0.913 0.808 0.756 0.0
357480047631 Signal recognition particle receptor sub 0.896 0.784 0.723 0.0
356562565626 PREDICTED: signal recognition particle r 0.909 0.801 0.713 0.0
414864259516 TPA: hypothetical protein ZEAMMB73_08856 0.903 0.967 0.677 0.0
>gi|449453958|ref|XP_004144723.1| PREDICTED: signal recognition particle receptor subunit alpha homolog [Cucumis sativus] Back     alignment and taxonomy information
 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/511 (83%), Positives = 460/511 (90%), Gaps = 6/511 (1%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           MLEQLLIFTRGGLILWTCKELGNAL+GSPIDTLIRSCLLEERSG AS+NYD+ GAAYTLK
Sbjct: 1   MLEQLLIFTRGGLILWTCKELGNALRGSPIDTLIRSCLLEERSGAASYNYDAPGAAYTLK 60

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQLRKEA 120
           WTFHNELGLVFVAVYQRILHLLYVDDLLAM+KQ FSEIYDPKR  Y DFDE FRQLR EA
Sbjct: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMVKQGFSEIYDPKRMVYDDFDETFRQLRMEA 120

Query: 121 EARAEELKKSKQVTKPMNNLKKQGGQLQKGGFERGSNRSGGGSANDDGDSDNMRGRKLEN 180
           EAR  ELKK+KQV KP+NN +KQG Q QK GF  G N+       DDGD++  +G KLEN
Sbjct: 121 EARTNELKKTKQVGKPLNNARKQG-QDQKTGF--GENKKSNSGLADDGDAERTKGHKLEN 177

Query: 181 GHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSKGSNPDP 240
           G+SN GN  + ES++T V NGKENTSSN+GAFDV+KLQKLR+KGGKKTD V +KGS  +P
Sbjct: 178 GYSN-GN-HVIESKLTAVVNGKENTSSNVGAFDVNKLQKLRSKGGKKTDPVANKGSKEEP 235

Query: 241 KKKITKKNRVWDDSPPESKLDFTDPAGGNG-SNIEVEAADHGESMMDKEEVFSSDSESEE 299
           KKK+TKKNRVWD+ P E+KLDFTDP G NG +NI+V AAD G+SMMDKEEVFSSDSE EE
Sbjct: 236 KKKVTKKNRVWDEKPTEAKLDFTDPVGENGDNNIDVLAADQGQSMMDKEEVFSSDSEDEE 295

Query: 300 DEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKL 359
           DEE  K +KPDAKK GWFSSMFQSI+GKA+LDKADLEPALKALKDRLMTKNVAEEIAEKL
Sbjct: 296 DEEGDKGSKPDAKKKGWFSSMFQSISGKASLDKADLEPALKALKDRLMTKNVAEEIAEKL 355

Query: 360 CESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDVHAAKEQRKPYVVV 419
           CESVAASLEGKKLASFTRISS VQAAMEEALVRILTPRRSIDILRDVHAAKEQ+KPYVVV
Sbjct: 356 CESVAASLEGKKLASFTRISSTVQAAMEEALVRILTPRRSIDILRDVHAAKEQKKPYVVV 415

Query: 420 FVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQVPIFEKGYE 479
           FVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQ+PIFEKGYE
Sbjct: 416 FVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARRLQIPIFEKGYE 475

Query: 480 KDPAIVAKEAIQEATRNGSDVVLVDTAGRMQ 510
           KDPA+VAKEAIQEA+RNGSDVVLVDTAGRMQ
Sbjct: 476 KDPAVVAKEAIQEASRNGSDVVLVDTAGRMQ 506

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224091775|ref|XP_002309350.1| predicted protein [Populus trichocarpa] gi|222855326|gb|EEE92873.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225445848|ref|XP_002278056.1| PREDICTED: signal recognition particle receptor subunit alpha [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577019|ref|XP_002529394.1| signal recognition particle receptor alpha subunit, putative [Ricinus communis] gi|223531142|gb|EEF32990.1| signal recognition particle receptor alpha subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297798906|ref|XP_002867337.1| signal recognition particle receptor alpha subunit family protein [Arabidopsis lyrata subsp. lyrata] gi|297313173|gb|EFH43596.1| signal recognition particle receptor alpha subunit family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234792|ref|NP_194789.1| signal recognition particle receptor subunit alpha [Arabidopsis thaliana] gi|7269961|emb|CAB79778.1| signal recognition particle receptor-like protein [Arabidopsis thaliana] gi|18086492|gb|AAL57699.1| AT4g30600/F17I23_60 [Arabidopsis thaliana] gi|22137194|gb|AAM91442.1| AT4g30600/F17I23_60 [Arabidopsis thaliana] gi|332660385|gb|AEE85785.1| signal recognition particle receptor subunit alpha [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356517002|ref|XP_003527179.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Glycine max] Back     alignment and taxonomy information
>gi|357480047|ref|XP_003610309.1| Signal recognition particle receptor subunit alpha [Medicago truncatula] gi|355511364|gb|AES92506.1| Signal recognition particle receptor subunit alpha [Medicago truncatula] Back     alignment and taxonomy information
>gi|356562565|ref|XP_003549540.1| PREDICTED: signal recognition particle receptor subunit alpha-like [Glycine max] Back     alignment and taxonomy information
>gi|414864259|tpg|DAA42816.1| TPA: hypothetical protein ZEAMMB73_088569 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
TAIR|locus:2118701634 AT4G30600 [Arabidopsis thalian 0.920 0.801 0.676 2.4e-172
DICTYBASE|DDB_G0277377615 srpR "signal recognition parti 0.576 0.517 0.379 2e-75
UNIPROTKB|F1NXV4644 SRPR "Uncharacterized protein" 0.603 0.517 0.387 4.7e-70
FB|FBgn0010391614 Gtp-bp "GTP-binding protein" [ 0.548 0.493 0.415 3.3e-69
MGI|MGI:1914648636 Srpr "signal recognition parti 0.606 0.526 0.380 4.7e-68
RGD|1311504636 Srpr "signal recognition parti 0.606 0.526 0.378 3.3e-67
UNIPROTKB|F1MNJ2598 SRPR "Signal recognition parti 0.605 0.558 0.372 6.1e-66
UNIPROTKB|Q3MHE8639 SRPR "Signal recognition parti 0.605 0.522 0.372 6.1e-66
UNIPROTKB|F1S754638 SRPR "Uncharacterized protein" 0.605 0.523 0.361 2.6e-65
UNIPROTKB|P08240638 SRPR "Signal recognition parti 0.603 0.521 0.365 5.4e-65
TAIR|locus:2118701 AT4G30600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1675 (594.7 bits), Expect = 2.4e-172, P = 2.4e-172
 Identities = 355/525 (67%), Positives = 393/525 (74%)

Query:     1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
             MLEQLLIFTRGGLILWTCKE+GNALKGSPIDTLIRSCLLEERSG  SFNYD+ GAAYTLK
Sbjct:     1 MLEQLLIFTRGGLILWTCKEIGNALKGSPIDTLIRSCLLEERSGAVSFNYDAPGAAYTLK 60

Query:    61 WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYSDFDEMFRQXXXXX 120
             WTFHN+LGLVFVAVYQRILHLLYVDDLL+M+KQSFSE+YDPKR  Y DFDE FRQ     
Sbjct:    61 WTFHNDLGLVFVAVYQRILHLLYVDDLLSMVKQSFSEVYDPKRMAYDDFDETFRQLRIEA 120

Query:   121 XXXXXXXXXSKQVTKPMNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRGR--KL 178
                      +KQV KP+ +                                  + +   L
Sbjct:   121 EARAEELRKTKQVGKPVTSVKKQGQVSKPGLEGGNKRVSSEGGSKKDDGDGGNKAKVSTL 180

Query:   179 ENGHSNVGNVEIEE-SRVTG-VANGKENTSSNIGAFDVSKLQKLRNKG--GK----KTDT 230
              NGHSN GN ++E+ S+ T  +ANGKENTSSN+ A D+SKLQKLR+KG  G+    KTD+
Sbjct:   181 TNGHSN-GNHQMEDDSQETNDLANGKENTSSNV-AVDLSKLQKLRSKGVRGRGGVRKTDS 238

Query:   231 VVSKGSN-PDPKKKITKKNRVWDDSPP-ESKLDFTDPAGGNGSN--IEVEAADHGESMMD 286
             + +K S   +P KK TKKNRVWDD+ P +SKLDFTD    NG+N  +++ AAD GESMMD
Sbjct:   239 IGNKSSKVAEPAKKATKKNRVWDDAAPKQSKLDFTDSIDENGNNDHVDIVAADQGESMMD 298

Query:   287 KXXXXXXXXXXXXXXXXGKHNKP-DAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDR 345
             K                G   KP  AKK GWFSS+FQSI GKANL++ DL PALKALK+R
Sbjct:   299 KEEVFSSDSESEDDDEPGSDEKPAQAKKKGWFSSVFQSITGKANLERTDLGPALKALKER 358

Query:   346 LMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRD 405
             LMTKNVAEEIAEKLCESV ASLEGKKL+SFTRISS VQAAME+ALVRILTPRRSIDILRD
Sbjct:   359 LMTKNVAEEIAEKLCESVEASLEGKKLSSFTRISSTVQAAMEDALVRILTPRRSIDILRD 418

Query:   406 VHAAKEQRKPYXXXXXXXXXXXKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTH 465
             VHAAKEQRKPY           KSTNLAKVAYWL QHKVSVMMAACDTFRSGAVEQLRTH
Sbjct:   419 VHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLQQHKVSVMMAACDTFRSGAVEQLRTH 478

Query:   466 ARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQ 510
             ARRLQ+PIFEKGYEKDPA+VAKEAIQEATRNGSDVVLVDTAGRMQ
Sbjct:   479 ARRLQIPIFEKGYEKDPAVVAKEAIQEATRNGSDVVLVDTAGRMQ 523
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0005047 "signal recognition particle binding" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005786 "signal recognition particle, endoplasmic reticulum targeting" evidence=ISS
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0006605 "protein targeting" evidence=ISS
GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
DICTYBASE|DDB_G0277377 srpR "signal recognition particle receptor alpha subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXV4 SRPR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0010391 Gtp-bp "GTP-binding protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1914648 Srpr "signal recognition particle receptor ('docking protein')" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311504 Srpr "signal recognition particle receptor ('docking protein')" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNJ2 SRPR "Signal recognition particle receptor subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHE8 SRPR "Signal recognition particle receptor subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S754 SRPR "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P08240 SRPR "Signal recognition particle receptor subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00061301
hypothetical protein (625 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.IX.3691.1
annotation not avaliable (410 aa)
  •     0.462
gw1.V.685.1
hypothetical protein (385 aa)
  •     0.408
estExt_Genewise1_v1.C_1230114
hypothetical protein (221 aa)
  •  •  0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
COG0552340 COG0552, FtsY, Signal recognition particle GTPase 2e-57
pfam04086272 pfam04086, SRP-alpha_N, Signal recognition particl 4e-55
PRK14974336 PRK14974, PRK14974, cell division protein FtsY; Pr 9e-55
smart00962197 smart00962, SRP54, SRP54-type protein, GTPase doma 3e-43
PRK10416318 PRK10416, PRK10416, signal recognition particle-do 9e-43
cd03115173 cd03115, SRP, The signal recognition particle (SRP 2e-42
TIGR00064272 TIGR00064, ftsY, signal recognition particle-docki 1e-40
pfam00448196 pfam00448, SRP54, SRP54-type protein, GTPase domai 2e-39
COG0541 451 COG0541, Ffh, Signal recognition particle GTPase [ 1e-32
TIGR00959 428 TIGR00959, ffh, signal recognition particle protei 5e-30
PRK10867 433 PRK10867, PRK10867, signal recognition particle pr 1e-28
PRK00771 437 PRK00771, PRK00771, signal recognition particle pr 2e-21
TIGR01425 429 TIGR01425, SRP54_euk, signal recognition particle 1e-18
TIGR03499283 TIGR03499, FlhF, flagellar biosynthetic protein Fl 6e-18
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator F 2e-16
COG1419407 COG1419, FlhF, Flagellar GTP-binding protein [Cell 1e-14
PRK12724432 PRK12724, PRK12724, flagellar biosynthesis regulat 2e-11
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-09
PRK12726407 PRK12726, PRK12726, flagellar biosynthesis regulat 4e-09
smart0096377 smart00963, SRP54_N, SRP54-type protein, helical b 9e-07
PRK14723 767 PRK14723, flhF, flagellar biosynthesis regulator F 2e-06
PRK12727559 PRK12727, PRK12727, flagellar biosynthesis regulat 8e-05
PRK06731270 PRK06731, flhF, flagellar biosynthesis regulator F 2e-04
pfam0288177 pfam02881, SRP54_N, SRP54-type protein, helical bu 2e-04
PRK12723388 PRK12723, PRK12723, flagellar biosynthesis regulat 4e-04
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 0.001
PRK14721420 PRK14721, flhF, flagellar biosynthesis regulator F 0.002
PRK11889436 PRK11889, flhF, flagellar biosynthesis regulator F 0.004
>gnl|CDD|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information 
 Score =  194 bits (496), Expect = 2e-57
 Identities = 84/224 (37%), Positives = 123/224 (54%), Gaps = 13/224 (5%)

Query: 293 SDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGK------ANLDKADLEPALKALKDRL 346
            +   EEDEE  K    +  K G  S   ++            + +   E  L+ L++ L
Sbjct: 18  KEKIEEEDEEEEKEGWFERLKQG-LSKTKKNFGKGIKGLFLKKIKEKLDEDLLEELEELL 76

Query: 347 MTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRSIDILRDV 406
           +  +V  E AE++ E +    EGKK          V+ A+ EAL+ IL P   +D+  ++
Sbjct: 77  IEADVGVETAEEIIEELRKR-EGKKKKIKD--EETVKEALREALIEILRPVDKVDLPLEI 133

Query: 407 HAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHA 466
               +++KP+V++FVGVNGVGK+T +AK+A +L Q   SV++AA DTFR+ A+EQL    
Sbjct: 134 ---PKEKKPFVILFVGVNGVGKTTTIAKLAKYLKQQGKSVLLAAGDTFRAAAIEQLEVWG 190

Query: 467 RRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQ 510
            RL VP+       DPA VA +AIQ A   G DVVL+DTAGR+ 
Sbjct: 191 ERLGVPVISGKEGADPAAVAFDAIQAAKARGIDVVLIDTAGRLH 234

Length = 340
>gnl|CDD|217884 pfam04086, SRP-alpha_N, Signal recognition particle, alpha subunit, N-terminal Back     alignment and domain information
>gnl|CDD|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|214940 smart00962, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|236686 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>gnl|CDD|239389 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>gnl|CDD|232804 TIGR00064, ftsY, signal recognition particle-docking protein FtsY Back     alignment and domain information
>gnl|CDD|215925 pfam00448, SRP54, SRP54-type protein, GTPase domain Back     alignment and domain information
>gnl|CDD|223615 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|233210 TIGR00959, ffh, signal recognition particle protein Back     alignment and domain information
>gnl|CDD|236780 PRK10867, PRK10867, signal recognition particle protein; Provisional Back     alignment and domain information
>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>gnl|CDD|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54 Back     alignment and domain information
>gnl|CDD|234232 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|224337 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|214941 smart00963, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|217266 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain Back     alignment and domain information
>gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 552
KOG0781587 consensus Signal recognition particle receptor, al 100.0
PF04086279 SRP-alpha_N: Signal recognition particle, alpha su 100.0
COG0552340 FtsY Signal recognition particle GTPase [Intracell 100.0
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 100.0
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 99.97
PRK14974336 cell division protein FtsY; Provisional 99.97
PRK10867 433 signal recognition particle protein; Provisional 99.97
KOG0780 483 consensus Signal recognition particle, subunit Srp 99.96
TIGR00959 428 ffh signal recognition particle protein. This mode 99.96
PRK00771 437 signal recognition particle protein Srp54; Provisi 99.95
PRK10416318 signal recognition particle-docking protein FtsY; 99.95
TIGR00064272 ftsY signal recognition particle-docking protein F 99.94
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 99.88
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 99.85
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 99.85
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 99.84
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 99.83
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 99.83
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 99.83
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 99.82
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 99.8
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 99.79
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 99.75
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 99.74
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 99.73
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 99.71
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.62
cd03115173 SRP The signal recognition particle (SRP) mediates 99.6
COG4586325 ABC-type uncharacterized transport system, ATPase 99.58
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.55
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.54
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.46
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.46
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.44
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.43
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.43
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.41
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.41
PRK13537306 nodulation ABC transporter NodI; Provisional 99.4
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.4
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.39
COG4152300 ABC-type uncharacterized transport system, ATPase 99.38
COG1127263 Ttg2A ABC-type transport system involved in resist 99.38
COG0410237 LivF ABC-type branched-chain amino acid transport 99.38
cd03246173 ABCC_Protease_Secretion This family represents the 99.37
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.37
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 99.37
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.37
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.37
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.36
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.36
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.36
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.36
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.35
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.35
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.35
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.35
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.34
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.34
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.34
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.34
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.34
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.34
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.34
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.33
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.33
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.33
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.33
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.33
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.33
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.33
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.33
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.33
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.33
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.33
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.33
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.33
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.33
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.32
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.32
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.32
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.32
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.32
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.32
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.32
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.32
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.31
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.31
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.31
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.31
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.31
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.31
PRK10908222 cell division protein FtsE; Provisional 99.31
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.31
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.3
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.3
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.3
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.3
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.3
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.3
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.3
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.3
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.3
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.29
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.29
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.29
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.29
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.29
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.29
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.29
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.29
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.29
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.28
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.28
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.28
COG0411250 LivG ABC-type branched-chain amino acid transport 99.28
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.28
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.28
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.28
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.28
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.28
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.28
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.28
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.27
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.27
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.27
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.27
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.27
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.27
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.27
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.27
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.27
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.27
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.27
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.27
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.26
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.26
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.26
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.26
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.26
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.26
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.26
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.26
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.26
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.26
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.26
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.26
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.26
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.26
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.26
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.26
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.26
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.25
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.25
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.25
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.25
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.25
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.25
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.25
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.25
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.25
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.25
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.25
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.25
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.25
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.25
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.24
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.24
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.24
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.24
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.24
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.24
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.24
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.24
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.24
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.24
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.24
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.24
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.24
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.24
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.24
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.24
cd03234226 ABCG_White The White subfamily represents ABC tran 99.24
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.24
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.23
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.23
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.23
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.23
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.23
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.23
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.23
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.22
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.22
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.22
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.22
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.22
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.22
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.22
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.22
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.22
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.22
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.21
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.21
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.21
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.21
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.21
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.21
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.21
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.21
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.21
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.21
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.21
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.21
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.2
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.2
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.2
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.2
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.2
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.2
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.2
PRK10938 490 putative molybdenum transport ATP-binding protein 99.2
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.2
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.2
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.2
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.2
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.2
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.19
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.19
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.19
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.19
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.19
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.19
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.19
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.19
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.18
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.18
COG4988559 CydD ABC-type transport system involved in cytochr 99.18
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.18
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.18
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.18
COG4181228 Predicted ABC-type transport system involved in ly 99.18
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.17
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.17
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.17
PRK09984262 phosphonate/organophosphate ester transporter subu 99.17
PRK11147 635 ABC transporter ATPase component; Reviewed 99.17
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.17
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.17
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.16
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.16
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.16
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.16
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.16
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.16
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.16
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.16
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.16
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.16
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.16
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.15
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.15
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.15
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.15
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.15
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.15
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.15
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.15
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.15
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.15
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.15
COG1123539 ATPase components of various ABC-type transport sy 99.14
COG0488 530 Uup ATPase components of ABC transporters with dup 99.14
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.14
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.14
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.14
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.14
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.14
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.14
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.14
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.14
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.14
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.14
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.14
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.13
COG4987573 CydC ABC-type transport system involved in cytochr 99.13
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.13
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.13
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.13
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.13
COG4133209 CcmA ABC-type transport system involved in cytochr 99.13
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.13
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.13
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.13
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.13
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.12
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.12
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.12
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.12
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.12
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.12
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.12
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.12
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.12
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.12
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.12
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.12
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.11
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.11
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.11
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.11
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.11
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.1
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.1
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.1
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.1
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.09
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.09
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.09
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.09
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.09
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.09
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.08
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.08
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.08
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.08
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.08
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.07
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.07
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.06
PRK11147 635 ABC transporter ATPase component; Reviewed 99.06
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.06
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.06
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.06
PLN03130 1622 ABC transporter C family member; Provisional 99.06
PLN032321495 ABC transporter C family member; Provisional 99.05
PRK10938490 putative molybdenum transport ATP-binding protein 99.05
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.04
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.03
PLN03211 659 ABC transporter G-25; Provisional 99.03
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.03
PLN03073718 ABC transporter F family; Provisional 99.02
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.02
PRK13409 590 putative ATPase RIL; Provisional 99.02
PRK13409590 putative ATPase RIL; Provisional 99.02
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.02
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.02
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.02
COG0488530 Uup ATPase components of ABC transporters with dup 99.01
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.01
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.01
COG1123 539 ATPase components of various ABC-type transport sy 99.0
COG4619223 ABC-type uncharacterized transport system, ATPase 98.99
PTZ002431560 ABC transporter; Provisional 98.99
PLN03073 718 ABC transporter F family; Provisional 98.98
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 98.98
COG4525259 TauB ABC-type taurine transport system, ATPase com 98.98
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 98.98
COG4161242 ArtP ABC-type arginine transport system, ATPase co 98.97
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 98.97
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 98.97
COG4167267 SapF ABC-type antimicrobial peptide transport syst 98.97
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 98.96
cd03114148 ArgK-like The function of this protein family is u 98.96
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.96
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 98.93
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 98.93
COG4559259 ABC-type hemin transport system, ATPase component 98.92
COG1101263 PhnK ABC-type uncharacterized transport system, AT 98.91
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 98.91
PRK10535 648 macrolide transporter ATP-binding /permease protei 98.9
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 98.87
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 98.87
PLN03232 1495 ABC transporter C family member; Provisional 98.83
PRK13849231 putative crown gall tumor protein VirC1; Provision 98.83
PLN03130 1622 ABC transporter C family member; Provisional 98.83
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 98.81
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 98.8
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.79
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 98.79
PRK09435 332 membrane ATPase/protein kinase; Provisional 98.78
PLN03140 1470 ABC transporter G family member; Provisional 98.77
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 98.77
COG4674249 Uncharacterized ABC-type transport system, ATPase 98.76
PTZ00243 1560 ABC transporter; Provisional 98.76
KOG0059 885 consensus Lipid exporter ABCA1 and related protein 98.72
COG4172534 ABC-type uncharacterized transport system, duplica 98.71
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 98.71
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 98.7
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 98.7
PHA02518211 ParA-like protein; Provisional 98.7
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 98.68
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 98.67
PLN03140 1470 ABC transporter G family member; Provisional 98.67
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.66
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 98.65
smart00382148 AAA ATPases associated with a variety of cellular 98.64
COG4172 534 ABC-type uncharacterized transport system, duplica 98.64
KOG0062 582 consensus ATPase component of ABC transporters wit 98.62
PF09140 261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 98.62
COG4136213 ABC-type uncharacterized transport system, ATPase 98.61
KOG00541381 consensus Multidrug resistance-associated protein/ 98.6
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.6
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.6
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 98.59
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 98.56
cd02040 270 NifH NifH gene encodes component II (iron protein) 98.51
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 98.48
PRK13185 270 chlL protochlorophyllide reductase iron-sulfur ATP 98.47
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.47
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.45
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.45
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 98.45
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 98.45
COG4178604 ABC-type uncharacterized transport system, permeas 98.44
KOG0927 614 consensus Predicted transporter (ABC superfamily) 98.43
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.43
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.42
cd02117212 NifH_like This family contains the NifH (iron prot 98.42
PRK13230 279 nitrogenase reductase-like protein; Reviewed 98.41
KOG0927614 consensus Predicted transporter (ABC superfamily) 98.41
KOG2355291 consensus Predicted ABC-type transport, ATPase com 98.39
TIGR03371 246 cellulose_yhjQ cellulose synthase operon protein Y 98.39
cd02032 267 Bchl_like This family of proteins contains bchL an 98.39
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 98.36
cd03271 261 ABC_UvrA_II The excision repair protein UvrA domai 98.36
PRK06067234 flagellar accessory protein FlaH; Validated 98.36
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.35
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 98.35
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 98.35
TIGR01281 268 DPOR_bchL light-independent protochlorophyllide re 98.34
PRK13232 273 nifH nitrogenase reductase; Reviewed 98.34
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 98.34
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 98.33
PRK10818 270 cell division inhibitor MinD; Provisional 98.33
PRK11670 369 antiporter inner membrane protein; Provisional 98.33
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 98.33
PRK13235 274 nifH nitrogenase reductase; Reviewed 98.33
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 98.32
PRK12337475 2-phosphoglycerate kinase; Provisional 98.31
COG4615546 PvdE ABC-type siderophore export system, fused ATP 98.31
PRK11519719 tyrosine kinase; Provisional 98.31
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.3
TIGR03029274 EpsG chain length determinant protein tyrosine kin 98.29
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.29
COG1192 259 Soj ATPases involved in chromosome partitioning [C 98.29
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 98.29
TIGR01969 251 minD_arch cell division ATPase MinD, archaeal. Thi 98.28
TIGR01968 261 minD_bact septum site-determining protein MinD. Th 98.28
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 98.26
PRK10037 250 cell division protein; Provisional 98.26
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 98.25
PRK13768 253 GTPase; Provisional 98.25
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.25
CHL00175 281 minD septum-site determining protein; Validated 98.24
TIGR01287 275 nifH nitrogenase iron protein. This model describe 98.24
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 98.23
PRK13233 275 nifH nitrogenase reductase; Reviewed 98.22
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 98.22
PRK09183259 transposase/IS protein; Provisional 98.22
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 98.21
CHL00072 290 chlL photochlorophyllide reductase subunit L 98.21
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.21
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 98.2
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.19
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.19
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 98.19
PRK13869 405 plasmid-partitioning protein RepA; Provisional 98.18
PRK04220301 2-phosphoglycerate kinase; Provisional 98.18
PRK13231 264 nitrogenase reductase-like protein; Reviewed 98.17
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.16
PHA02519 387 plasmid partition protein SopA; Reviewed 98.16
cd02034116 CooC The accessory protein CooC, which contains a 98.16
PF06564 243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 98.16
PRK13234 295 nifH nitrogenase reductase; Reviewed 98.14
cd03111106 CpaE_like This protein family consists of proteins 98.14
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 98.13
PRK06526254 transposase; Provisional 98.13
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 98.13
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.12
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.11
PF0288175 SRP54_N: SRP54-type protein, helical bundle domain 98.11
KOG0054 1381 consensus Multidrug resistance-associated protein/ 98.1
COG0003 322 ArsA Predicted ATPase involved in chromosome parti 98.1
PRK13705 388 plasmid-partitioning protein SopA; Provisional 98.1
PRK13236 296 nitrogenase reductase; Reviewed 98.09
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.08
PRK04296190 thymidine kinase; Provisional 98.07
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.07
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.07
cd00550 254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 98.06
COG3640 255 CooC CO dehydrogenase maturation factor [Cell divi 98.06
cd02036179 MinD Bacterial cell division requires the formatio 98.06
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.06
TIGR03453 387 partition_RepA plasmid partitioning protein RepA. 98.05
COG0489265 Mrp ATPases involved in chromosome partitioning [C 98.05
cd03110179 Fer4_NifH_child This protein family's function is 98.05
PF02374 305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 98.04
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-87  Score=696.62  Aligned_cols=483  Identities=45%  Similarity=0.693  Sum_probs=361.6

Q ss_pred             CcceEEEeecCcEEEEeecccCCCCCCCcHHHHHHHhhhhcccCCCceeeccCCCceeeEEEEecccceEEEEEeccccc
Q 008816            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (552)
Q Consensus         1 MlD~~~IftkgGiVLWs~~~~~~~~~~~~in~lI~~vlleer~~~~~~~~~~~~~~y~lkw~~~ne~~Lvfv~vyq~il~   80 (552)
                      |||+|.||||||+|||.|+.....+.+ |||+||++||++||++..+|.+    +.|||+|+++|+++||||||||+|++
T Consensus         1 Mld~faIFtkgG~vLw~~~~~~~~~~~-~in~lI~~~ll~er~~~~~~~~----~~yTlk~q~~N~~~lvfvvvfqki~~   75 (587)
T KOG0781|consen    1 MLDQFAIFTKGGLVLWCYQEVGDNLKG-PINALIRSVLLSERGGVNSFTF----EAYTLKYQLDNQYSLVFVVVFQKILT   75 (587)
T ss_pred             CcceeeeecCCcEEEEEecccchhccc-hHHHHHHHHHHHhhcCcccCch----hheeEeeeecCCccEEEEEEEeccch
Confidence            999999999999999987766666667 9999999999999999999999    99999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCcCC--CCcchHHHHHHHHHHHHHHHHHH---hhhhcccccccccccccCCccCCCCCCC
Q 008816           81 LLYVDDLLAMMKQSFSEIYDPKRT--DYSDFDEMFRQLRKEAEARAEEL---KKSKQVTKPMNNLKKQGGQLQKGGFERG  155 (552)
Q Consensus        81 l~yvd~ll~~v~~~F~~~y~~~~~--~~~~f~~~f~~~l~~~e~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (552)
                      |.|+|+||++++..|+..|.+...  .+-+|.+.+..+|+.........   .+.+..++.++++++....         
T Consensus        76 L~yv~~ll~~v~~~f~e~~~~~~~~~l~~n~~~~~~e~lk~rq~~ne~t~~k~~~pi~~~~~~~~~K~~~~---------  146 (587)
T KOG0781|consen   76 LTYVDKLLNDVLNLFREKYDTQSALSLLNNTFDFQEELLKLRQVANEATEYKIRAPITMKKSEDLEKAKDP---------  146 (587)
T ss_pred             hhhHHHHHHHHHHHHHHHhccchHHHhhhhhHHHHHHHHHHhhcccccchhhhcccchhhhhhcchhhhhh---------
Confidence            999999999999999999987532  34456666666666544322111   1111112223333322110         


Q ss_pred             CCCCCCCCCCCCCCCC-cccCcccCCCCCCCCCcccccccccccCCCCCCCCCCcchhhhHHHHHhhhcCCCCcccccCC
Q 008816          156 SNRSGGGSANDDGDSD-NMRGRKLENGHSNVGNVEIEESRVTGVANGKENTSSNIGAFDVSKLQKLRNKGGKKTDTVVSK  234 (552)
Q Consensus       156 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (552)
                       +.   ...+++++.. ....+.+.+++.+.                    + +.     ..++++-+..+++.   +..
T Consensus       147 -v~---~~~e~~~d~s~kk~~nt~kng~~~~--------------------~-h~-----~~~kk~~~~tkkKg---~~s  193 (587)
T KOG0781|consen  147 -VR---SPIETNGDKSAKKKKNTKKNGAKKE--------------------G-HD-----EEFKKKHRETKKKG---NKS  193 (587)
T ss_pred             -hc---cccccccccchhcccccccCCCccc--------------------c-hh-----hhhhhhhccccccc---ccC
Confidence             11   1111111110 00000011111111                    0 01     11122212111111   112


Q ss_pred             CCCCCCCccccccCccCCCCC--CCCccccCCCCCCCCCch-hhhhhhcCCCccccccc---cCCCCcchhhhhhccCCC
Q 008816          235 GSNPDPKKKITKKNRVWDDSP--PESKLDFTDPAGGNGSNI-EVEAADHGESMMDKEEV---FSSDSESEEDEEVGKHNK  308 (552)
Q Consensus       235 ~~~~~~~~k~~K~~r~W~~~~--~~~~Ld~s~~~~~~~~~~-~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~  308 (552)
                      ++.+.|++|.+|++|+||+.+  +...||||++..+++.+. +.+...++.++.+-.+.   +++++++.++. ...++.
T Consensus       194 ~~~~~p~kKGkk~~RvWdd~g~~d~~~ld~sss~sn~e~a~~e~vn~~~~~s~~~~~~~l~~~~~d~~~s~~~-~~~~~~  272 (587)
T KOG0781|consen  194 TKVDAPKKKGKKAPRVWDDAGCEDEKVLDYSSSTSNGENALSETVNLDQGESMGGQLQDLDKDSSDDEGSADN-STDPAA  272 (587)
T ss_pred             CCCCCchhhcccccchhhhccchhhcccccCCccccccchhHHHhhhhhhccccccccccccccccccccccc-ccchhh
Confidence            233455566667799999855  778999999885554332 22333333333221111   11111111111 111223


Q ss_pred             CCchhhhHHHHHHHHhccCCcCChhchHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCCCCCccchhHHHHHHHHH
Q 008816          309 PDAKKTGWFSSMFQSIAGKANLDKADLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEE  388 (552)
Q Consensus       309 ~~~~~~~~~~~~~~~~~g~~~l~~~~l~~~l~~l~~~Ll~~~V~~~va~~l~~~v~~~l~g~~~~~f~~~~~~v~~~l~~  388 (552)
                      ..+..++||+ +|+++.|++.|.++|+.|++++|++|||.+||++++|++||++|...|.|+++++|+++...++++|++
T Consensus       273 ~~k~~g~aFg-~fkglvG~K~L~eeDL~pvL~kM~ehLitKNVA~eiA~~LcEsV~a~Legkkv~sfs~V~~Tvk~Al~d  351 (587)
T KOG0781|consen  273 TKKTVGGAFG-LFKGLVGSKSLSEEDLNPVLDKMTEHLITKNVAAEIAEKLCESVAASLEGKKVGSFSTVESTVKEALRD  351 (587)
T ss_pred             hhcchhhHHH-HHHhhcccccccHhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHhhhcccccchHHHHHHHHHHHH
Confidence            3445567776 999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCCcccccccccccccCCCcEEEEEEcCCCCChhHHHHHHHHHHhhCCceEEEeeecCCcchHHHHHHHHHHH
Q 008816          389 ALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAVEQLRTHARR  468 (552)
Q Consensus       389 ~L~~il~~~~~~diL~di~~~~~~g~p~vI~lvG~nGvGKTTll~kLA~~l~~~ggkVll~~~D~~r~ga~eqL~~~~~~  468 (552)
                      +|++||+|.+++|+|++|.-...+++||+|+|||+|||||||+|++||+||.+++.+|+|++|||||.||+|||++|.++
T Consensus       352 aLvQILTP~~sVDlLRdI~sar~~krPYVi~fvGVNGVGKSTNLAKIayWLlqNkfrVLIAACDTFRsGAvEQLrtHv~r  431 (587)
T KOG0781|consen  352 ALVQILTPQRSVDLLRDIMSARRRKRPYVISFVGVNGVGKSTNLAKIAYWLLQNKFRVLIAACDTFRSGAVEQLRTHVER  431 (587)
T ss_pred             HHHHHcCCCchhhHHHHHHHHHhcCCCeEEEEEeecCccccchHHHHHHHHHhCCceEEEEeccchhhhHHHHHHHHHHH
Confidence            99999999999999999999888999999999999999999999999999999999999999999999999999999999


Q ss_pred             c------CCceeecCCCCCHHHHHHHHHHHHHhCCCCEEEEeCCCCCCChHHHHHHHHHHhhhhccccEE
Q 008816          469 L------QVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQVIIEYYLFLLHIYLHTVCEHFV  532 (552)
Q Consensus       469 l------~v~~~~~~~~~dp~~iar~aIa~a~~~~~DvVIIDtpGr~~~~~~lm~eL~kl~~~~~~~~~~  532 (552)
                      +      .|++|++||+.|++.++++||++|..+++||||||||||||++++||..|.+++.+....+.+
T Consensus       432 l~~l~~~~v~lfekGYgkd~a~vak~AI~~a~~~gfDVvLiDTAGR~~~~~~lm~~l~k~~~~~~pd~i~  501 (587)
T KOG0781|consen  432 LSALHGTMVELFEKGYGKDAAGVAKEAIQEARNQGFDVVLIDTAGRMHNNAPLMTSLAKLIKVNKPDLIL  501 (587)
T ss_pred             HHHhccchhHHHhhhcCCChHHHHHHHHHHHHhcCCCEEEEeccccccCChhHHHHHHHHHhcCCCceEE
Confidence            8      789999999999999999999999999999999999999999999999999998765554443

>PF04086 SRP-alpha_N: Signal recognition particle, alpha subunit, N-terminal; InterPro: IPR007222 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF02881 SRP54_N: SRP54-type protein, helical bundle domain; InterPro: IPR013822 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
3dmd_B328 Structures And Conformations In Solution Of The Sig 2e-30
3dm9_B328 Structures And Conformations In Solution Of The Sig 2e-30
2fh5_A185 The Structure Of The Mammalian Srp Receptor Length 6e-14
1fts_A295 Signal Recognition Particle Receptor From E. Coli L 3e-12
2xxa_B302 The Crystal Structure Of The Signal Recognition Par 3e-12
2qy9_A309 Structure Of The Ng+1 Construct Of The E. Coli Srp 3e-12
2j37_W 504 Model Of Mammalian Srp Bound To 80s Rncs Length = 5 4e-12
2yhs_A503 Structure Of The E. Coli Srp Receptor Ftsy Length = 2e-11
4ak9_A318 Structure Of Chloroplast Ftsy From Physcomitrella P 9e-11
3dm5_A 443 Structures Of Srp54 And Srp19, The Two Proteins Ass 1e-10
2iy3_A 432 Structure Of The E. Coli Signal Recognition Particl 3e-10
2og2_A359 Crystal Structure Of Chloroplast Ftsy From Arabidop 3e-10
1okk_D303 Homo-Heterodimeric Complex Of The Srp Gtpases Lengt 3e-10
2q9a_A304 Structure Of Apo Ftsy Length = 304 3e-10
3b9q_A302 The Crystal Structure Of Cpftsy From Arabidopsis Th 3e-10
2j7p_D283 Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpa 4e-10
2cnw_D284 Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Len 4e-10
1jpj_A296 Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 7e-10
1o87_A297 A New Mggdp Complex Of The Ffh Ng Domain Length = 2 7e-10
3ng1_A294 N And Gtpase Domains Of The Signal Sequence Recogni 8e-10
1ls1_A295 T. Aquaticus Ffh Ng Domain At 1.1a Resolution Lengt 8e-10
2c03_A297 Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 29 2e-09
2ng1_A293 N And Gtpase Domains Of The Signal Sequence Recogni 2e-09
1ffh_A294 N And Gtpase Domains Of The Signal Sequence Recogni 2e-09
2ffh_A 425 The Signal Sequence Binding Protein Ffh From Thermu 3e-09
1rj9_B300 Structure Of The Heterodimer Of The Conserved Gtpas 3e-09
1rj9_A304 Structure Of The Heterodimer Of The Conserved Gtpas 5e-09
2xxa_A 433 The Crystal Structure Of The Signal Recognition Par 1e-08
2j28_9 430 Model Of E. Coli Srp Bound To 70s Rncs Length = 430 1e-08
1zu4_A320 Crystal Structure Of Ftsy From Mycoplasma Mycoides- 2e-08
2v3c_C 432 Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna C 1e-07
3ndb_B 454 Crystal Structure Of A Signal Sequence Bound To The 1e-07
1qzw_A 440 Crystal Structure Of The Complete Core Of Archaeal 7e-07
3kl4_A 433 Recognition Of A Signal Peptide By The Signal Recog 8e-07
2px0_A296 Crystal Structure Of Flhf Complexed With GmppnpMG(2 2e-06
1j8m_F297 Signal Recognition Particle Conserved Gtpase Domain 3e-06
1j8y_F297 Signal Recognition Particle Conserved Gtpase Domain 3e-06
1vma_A306 Crystal Structure Of Cell Division Protein Ftsy (Tm 3e-05
>pdb|3DMD|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 106/177 (59%), Gaps = 3/177 (1%)
Query: 334 DLEPALKALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRI 393
           D++ AL  L+  L+  +VA E+ + L E +   L GKK+   T    I++ A++EA+  I
Sbjct: 51  DVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEI 110
Query: 394 LTPRRSIDILRDVHAAKEQRKPYXXXXXXXXXXXKSTNLAKVAYWLLQHKVSVMMAACDT 453
           L   R ID++ ++  A+   KPY           K+T +AK+A WL  H  SV++AA DT
Sbjct: 111 LETSRRIDLIEEIRKAE---KPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDT 167
Query: 454 FRSGAVEQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQ 510
           FR+GA+EQL  HA+R+ V + +  Y  DPA VA +AIQ A   G DVVL+DTAGR +
Sbjct: 168 FRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSE 224
>pdb|3DM9|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 Back     alignment and structure
>pdb|2FH5|A Chain A, The Structure Of The Mammalian Srp Receptor Length = 185 Back     alignment and structure
>pdb|1FTS|A Chain A, Signal Recognition Particle Receptor From E. Coli Length = 295 Back     alignment and structure
>pdb|2XXA|B Chain B, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 302 Back     alignment and structure
>pdb|2QY9|A Chain A, Structure Of The Ng+1 Construct Of The E. Coli Srp Receptor Ftsy Length = 309 Back     alignment and structure
>pdb|2J37|W Chain W, Model Of Mammalian Srp Bound To 80s Rncs Length = 504 Back     alignment and structure
>pdb|2YHS|A Chain A, Structure Of The E. Coli Srp Receptor Ftsy Length = 503 Back     alignment and structure
>pdb|4AK9|A Chain A, Structure Of Chloroplast Ftsy From Physcomitrella Patens Length = 318 Back     alignment and structure
>pdb|3DM5|A Chain A, Structures Of Srp54 And Srp19, The Two Proteins Assembling The Ribonucleic Core Of The Signal Recognition Particle From The Archaeon Pyrococcus Furiosus. Length = 443 Back     alignment and structure
>pdb|2IY3|A Chain A, Structure Of The E. Coli Signal Recognition Particle Bound To A Translating Ribosome Length = 432 Back     alignment and structure
>pdb|2OG2|A Chain A, Crystal Structure Of Chloroplast Ftsy From Arabidopsis Thaliana Length = 359 Back     alignment and structure
>pdb|1OKK|D Chain D, Homo-Heterodimeric Complex Of The Srp Gtpases Length = 303 Back     alignment and structure
>pdb|2Q9A|A Chain A, Structure Of Apo Ftsy Length = 304 Back     alignment and structure
>pdb|3B9Q|A Chain A, The Crystal Structure Of Cpftsy From Arabidopsis Thaliana Length = 302 Back     alignment and structure
>pdb|2J7P|D Chain D, Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpases Ffh And Ftsy Length = 283 Back     alignment and structure
>pdb|2CNW|D Chain D, Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Length = 284 Back     alignment and structure
>pdb|1JPJ|A Chain A, Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 Back     alignment and structure
>pdb|1O87|A Chain A, A New Mggdp Complex Of The Ffh Ng Domain Length = 297 Back     alignment and structure
>pdb|3NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 Back     alignment and structure
>pdb|1LS1|A Chain A, T. Aquaticus Ffh Ng Domain At 1.1a Resolution Length = 295 Back     alignment and structure
>pdb|2C03|A Chain A, Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 297 Back     alignment and structure
>pdb|2NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 293 Back     alignment and structure
>pdb|1FFH|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 Back     alignment and structure
>pdb|2FFH|A Chain A, The Signal Sequence Binding Protein Ffh From Thermus Aquaticus Length = 425 Back     alignment and structure
>pdb|1RJ9|B Chain B, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 300 Back     alignment and structure
>pdb|1RJ9|A Chain A, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 304 Back     alignment and structure
>pdb|2XXA|A Chain A, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 433 Back     alignment and structure
>pdb|2J28|9 Chain 9, Model Of E. Coli Srp Bound To 70s Rncs Length = 430 Back     alignment and structure
>pdb|1ZU4|A Chain A, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group P21212 Length = 320 Back     alignment and structure
>pdb|2V3C|C Chain C, Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna Complex Of M. Jannaschii Length = 432 Back     alignment and structure
>pdb|3NDB|B Chain B, Crystal Structure Of A Signal Sequence Bound To The Signal Recognition Particle Length = 454 Back     alignment and structure
>pdb|1QZW|A Chain A, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication Length = 440 Back     alignment and structure
>pdb|3KL4|A Chain A, Recognition Of A Signal Peptide By The Signal Recognition Particle Length = 433 Back     alignment and structure
>pdb|2PX0|A Chain A, Crystal Structure Of Flhf Complexed With GmppnpMG(2+) Length = 296 Back     alignment and structure
>pdb|1J8M|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens Length = 297 Back     alignment and structure
>pdb|1J8Y|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens T112a Mutant Length = 297 Back     alignment and structure
>pdb|1VMA|A Chain A, Crystal Structure Of Cell Division Protein Ftsy (Tm0570) From Thermotoga Maritima At 1.60 A Resolution Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 8e-66
2fh5_A185 Signal recognition particle receptor alpha subunit 4e-42
2og2_A359 Putative signal recognition particle receptor; nuc 8e-39
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 6e-38
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 9e-37
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 4e-35
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 1e-34
1vma_A306 Cell division protein FTSY; TM0570, structural gen 2e-34
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 6e-34
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 1e-33
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 7e-33
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 3e-31
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 4e-31
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 2e-29
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 3e-28
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 2e-27
2xxa_A 433 Signal recognition particle protein; protein trans 3e-27
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Length = 328 Back     alignment and structure
 Score =  215 bits (551), Expect = 8e-66
 Identities = 90/231 (38%), Positives = 131/231 (56%), Gaps = 9/231 (3%)

Query: 280 HGESMMDKEEVFSSDSESEEDEEVGKHNKPDAKKTGWFSSMFQSIAGKANLDKADLEPAL 339
           H  SM  K            +EEV K  + + +K G    +      +      D++ AL
Sbjct: 3   HMASMFGKLREKLKSFVKRVEEEVEK-EEEEVEKKGLLDRILTVEIKEK-----DVDKAL 56

Query: 340 KALKDRLMTKNVAEEIAEKLCESVAASLEGKKLASFTRISSIVQAAMEEALVRILTPRRS 399
             L+  L+  +VA E+ + L E +   L GKK+   T    I++ A++EA+  IL   R 
Sbjct: 57  DELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRR 116

Query: 400 IDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLLQHKVSVMMAACDTFRSGAV 459
           ID++ ++  A+   KPYV++FVG NG GK+T +AK+A WL  H  SV++AA DTFR+GA+
Sbjct: 117 IDLIEEIRKAE---KPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAI 173

Query: 460 EQLRTHARRLQVPIFEKGYEKDPAIVAKEAIQEATRNGSDVVLVDTAGRMQ 510
           EQL  HA+R+ V + +  Y  DPA VA +AIQ A   G DVVL+DTAGR +
Sbjct: 174 EQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSE 224
>2fh5_A Signal recognition particle receptor alpha subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Homo sapiens} SCOP: d.110.4.4 PDB: 2go5_1 Length = 185 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Length = 359 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Length = 302 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Length = 296 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Length = 320 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Length = 306 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Length = 304 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Length = 297 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Length = 433 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Length = 443 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Length = 295 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Length = 432 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Length = 425 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Length = 433 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
2fh5_A185 Signal recognition particle receptor alpha subunit 100.0
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 99.96
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 99.95
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 99.95
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.95
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 99.95
2xxa_A 433 Signal recognition particle protein; protein trans 99.94
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 99.94
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.92
1vma_A306 Cell division protein FTSY; TM0570, structural gen 99.92
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 99.92
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.92
2og2_A359 Putative signal recognition particle receptor; nuc 99.92
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 99.92
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 99.91
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.91
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 99.85
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.46
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.45
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.45
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.45
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.45
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.44
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.42
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.42
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.41
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.4
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.39
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.39
2vx8_A169 Nucleoporin-like protein RIP, vesicle-associated m 99.39
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.39
1g6h_A257 High-affinity branched-chain amino acid transport 99.39
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.38
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.38
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.37
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.37
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.37
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.37
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.37
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.36
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.36
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.35
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.35
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.34
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.34
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.33
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.33
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.32
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.32
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.31
2ghi_A260 Transport protein; multidrug resistance protein, M 99.31
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.29
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.28
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.27
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.22
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.21
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.21
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.21
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.19
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.19
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.19
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.1
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.05
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.05
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.03
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.03
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.02
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.99
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 98.99
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.98
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.97
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.97
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.96
2eyu_A 261 Twitching motility protein PILT; pilus retraction 98.95
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.95
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.94
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.93
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.91
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 98.91
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.89
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.85
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.84
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.82
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.8
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.74
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.7
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.67
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.67
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.65
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 98.64
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.63
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 98.61
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 98.6
2ewv_A 372 Twitching motility protein PILT; pilus retraction 98.59
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.59
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 98.57
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.56
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.55
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.54
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 98.53
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 98.52
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.48
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.48
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 98.47
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.46
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.45
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 98.45
1hyq_A 263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 98.44
3end_A 307 Light-independent protochlorophyllide reductase ir 98.43
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 98.42
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 98.42
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 98.41
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.41
3ea0_A 245 ATPase, para family; alpha-beta-alpha sandwich, st 98.39
1cp2_A 269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 98.38
3q9l_A 260 Septum site-determining protein MIND; ATPase, bact 98.38
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.38
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.38
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 98.38
3kjh_A 254 CO dehydrogenase/acetyl-COA synthase complex, acce 98.38
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.33
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.31
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 98.31
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 98.3
2r6a_A 454 DNAB helicase, replicative helicase; replication, 98.3
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.29
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.29
2afh_E 289 Nitrogenase iron protein 1; nitrogen fixation, iro 98.29
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 98.28
3cwq_A209 Para family chromosome partitioning protein; alpha 98.26
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 98.26
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 98.26
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.24
1wcv_1 257 SOJ, segregation protein; ATPase, bacterial, chrom 98.24
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 98.23
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.23
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.21
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 98.21
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.21
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 98.19
3fwy_A 314 Light-independent protochlorophyllide reductase I 98.18
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.17
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 98.16
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.14
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 98.11
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 98.11
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.1
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 98.09
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.08
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.08
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 98.08
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 98.07
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.07
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.05
1nrj_A158 Signal recognition particle receptor alpha subunit 97.96
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.96
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 97.95
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.94
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.93
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.93
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.92
1e69_A 322 Chromosome segregation SMC protein; structural mai 97.92
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.91
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 97.91
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.91
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.9
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.89
3ez9_A 403 Para; DNA binding, winged-HTH, partition, biosynth 97.89
2z43_A324 DNA repair and recombination protein RADA; archaea 97.89
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.89
3igf_A 374 ALL4481 protein; two-domained protein consisting o 97.88
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.87
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.85
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.84
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.84
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.83
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 97.82
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.8
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.77
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.77
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.77
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 97.75
3bos_A242 Putative DNA replication factor; P-loop containing 97.74
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.72
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.71
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.71
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 97.71
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.7
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.68
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.67
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.66
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.65
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 97.65
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.65
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.64
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.61
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 97.59
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.59
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.58
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.58
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.57
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.57
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.57
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.56
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.56
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.54
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.51
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.51
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.5
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.5
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 97.5
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.47
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.47
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.46
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.45
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.45
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 97.44
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.43
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.4
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.39
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.36
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.36
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.36
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.35
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.35
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.34
3kta_A182 Chromosome segregation protein SMC; structural mai 97.34
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.32
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.32
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.3
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.3
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.29
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.28
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.25
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.24
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.24
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.24
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 97.23
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.23
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.21
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.2
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.2
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.17
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.17
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.15
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.14
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.11
3io5_A 333 Recombination and repair protein; storage dimer, i 97.1
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.1
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.09
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.08
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.07
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.07
4afi_A173 AP-3 complex subunit delta-1, vesicle-associated p 97.06
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.05
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.04
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.04
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.03
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.03
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.02
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.01
3ice_A422 Transcription termination factor RHO; transcriptio 97.0
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.99
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 96.99
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.99
2qgz_A308 Helicase loader, putative primosome component; str 96.98
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.96
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.96
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.95
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.94
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.94
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.89
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.87
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.85
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.84
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.84
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.83
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.83
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.82
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.81
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.78
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 96.76
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.73
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.71
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.7
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.7
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.7
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 96.7
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 96.68
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 96.68
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.68
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.66
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.63
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.63
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.62
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.62
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.61
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.61
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.6
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.6
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.59
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.58
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 96.57
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.57
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 96.56
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.55
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 96.54
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.52
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.48
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 96.48
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.47
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.47
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.47
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.47
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 96.46
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.45
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.45
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.45
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.43
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 96.41
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.41
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.41
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.41
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.4
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.4
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 96.38
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.38
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.37
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.36
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.36
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.35
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 96.32
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.3
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.29
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 96.27
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.26
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.23
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.23
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.23
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.23
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.22
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.22
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.2
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.2
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.18
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.18
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 96.18
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.18
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 96.18
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.17
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.17
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.14
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.13
3pvs_A 447 Replication-associated recombination protein A; ma 96.13
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.12
1via_A175 Shikimate kinase; structural genomics, transferase 96.11
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.1
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.1
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.09
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 96.06
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.05
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.05
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.03
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 96.02
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.02
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 95.99
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.97
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 95.97
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 95.96
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.93
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 95.92
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 95.91
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 95.9
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.89
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.88
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 95.88
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.87
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.86
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.86
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 95.84
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.83
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.83
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.83
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 95.81
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.79
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.76
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 95.75
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.75
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.73
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.73
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.7
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.68
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.68
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.68
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.66
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.64
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.64
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.63
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 95.63
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.6
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.6
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.57
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 95.57
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.51
2ged_A193 SR-beta, signal recognition particle receptor beta 95.5
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.44
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 95.42
2chq_A 319 Replication factor C small subunit; DNA-binding pr 95.41
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.41
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.39
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.37
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.34
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 95.33
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.33
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.33
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.32
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.3
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.27
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.26
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 95.25
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 95.24
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.22
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.21
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.21
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 95.2
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 95.17
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.14
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.12
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.08
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.05
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.04
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 95.01
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 94.98
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 94.96
4b93_A189 Vesicle-associated membrane protein 7; endocytosis 94.95
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.91
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 94.85
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 94.84
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 94.78
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.77
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 94.76
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.73
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 94.71
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.7
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.68
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.66
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.63
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 94.63
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.61
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.61
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 94.61
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 94.59
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.55
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 94.51
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 94.51
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 94.49
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 94.43
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 94.42
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.42
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 94.41
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 94.39
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 94.37
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 94.36
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.36
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 94.33
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.32
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.31
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 94.28
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.28
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 94.27
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.27
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.26
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.26
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 94.26
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 94.26
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.2
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.2
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.19
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.17
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.17
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.16
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.16
3co5_A143 Putative two-component system transcriptional RES 94.16
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 94.13
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 94.11
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.01
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.99
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 93.97
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 93.96
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 93.96
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.95
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.94
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 93.92
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 93.92
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.91
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 93.89
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 93.89
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 93.88
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 93.86
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.85
>2fh5_A Signal recognition particle receptor alpha subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Homo sapiens} SCOP: d.110.4.4 PDB: 2go5_1 Back     alignment and structure
Probab=100.00  E-value=1.1e-43  Score=337.23  Aligned_cols=138  Identities=35%  Similarity=0.559  Sum_probs=103.6

Q ss_pred             CcceEEEeecCcEEEEeecccCCCCCCCcHHHHHHHhhhhcccCCCceeeccCCCceeeEEEEecccceEEEEEeccccc
Q 008816            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (552)
Q Consensus         1 MlD~~~IftkgGiVLWs~~~~~~~~~~~~in~lI~~vlleer~~~~~~~~~~~~~~y~lkw~~~ne~~Lvfv~vyq~il~   80 (552)
                      |.|+|+|||||||||||++ +.++++++|||+||++||||||+++++|.+    |+|+|||+|+||||||||||||+|||
T Consensus        10 ~~D~~~IfTkGGvVLWs~~-~~~~~~~~~IN~LIr~VlLEER~~~~~y~~----d~ytlkW~l~NEl~LVFVvVYQ~iL~   84 (185)
T 2fh5_A           10 MVDFFTIFSKGGLVLWCFQ-GVSDSCTGPVNALIRSVLLQERGGNNSFTH----EALTLKYKLDNQFELVFVVGFQKILT   84 (185)
T ss_dssp             SCSEEEEEETTSBEEEEEB-TTTBSCCCHHHHHHHHTGGGC-------CC----CCCEEEEEEETTTTEEEEEEESCGGG
T ss_pred             ceeEEEEEeCCeEEEEeec-CCcccccchHHHHHHHhhhccccCCCceeE----cCeEEEEEEeccCCEEEEEEEccccc
Confidence            8999999999999999753 445689999999999999999999999999    99999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCcCC---------CCcchHHHHHHHHHHHHHHHHHHhhhhcccccccccccccC
Q 008816           81 LLYVDDLLAMMKQSFSEIYDPKRT---------DYSDFDEMFRQLRKEAEARAEELKKSKQVTKPMNNLKKQGG  145 (552)
Q Consensus        81 l~yvd~ll~~v~~~F~~~y~~~~~---------~~~~f~~~f~~~l~~~e~~~~~~~~~~~~~~~~~~~~~~~~  145 (552)
                      |+|||+||++|++.|+++|++.+.         .+.+||++|+++|+++|+.++..+  +..|++|+++.++++
T Consensus        85 L~YiD~LL~~v~~~Fv~~Y~~~L~~~~~~~~~~~~~~Fd~~F~~~l~~~e~~~~~~~--~k~mr~fees~ks~k  156 (185)
T 2fh5_A           85 LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRA--PTTMKKFEDSEKAKK  156 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHSSSTHHHHSCCCCCHHHHHHHHHHHHHHTC--------------------
T ss_pred             chHHHHHHHHHHHHHHHHHHHHhhcccccccccccCchhHHHHHHHHHHHHHHHhhh--HHhhccHhhhhhhhh
Confidence            999999999999999999976521         345899999999999998875433  345899998887543
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2vx8_A Nucleoporin-like protein RIP, vesicle-associated membrane protein 7; endocytosis,exocytosis, endocytosis, exocytosis, acetylation, coiled coil; 2.2A {Homo sapiens} PDB: 2dmw_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1nrj_A Signal recognition particle receptor alpha subunit homolog; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: d.110.4.4 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4afi_A AP-3 complex subunit delta-1, vesicle-associated protein 7; endocytosis, exocytosis, clathrin adaptor, chimera, fusion P; 2.80A {Homo sapiens} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 552
d2fh5a1129 d.110.4.4 (A:1-129) Signal recognition particle re 1e-44
d2qy9a2211 c.37.1.10 (A:285-495) GTPase domain of the signal 8e-24
d1vmaa2213 c.37.1.10 (A:82-294) GTPase domain of the signal r 1e-23
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 5e-23
d1j8yf2211 c.37.1.10 (F:87-297) GTPase domain of the signal s 5e-21
d1ls1a2207 c.37.1.10 (A:89-295) GTPase domain of the signal s 5e-19
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 4e-18
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 7e-14
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 2e-09
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 5e-08
d2p67a1 327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 4e-04
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 0.001
d4tmka_210 c.37.1.1 (A:) Thymidylate kinase {Escherichia coli 0.004
>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: SNARE-like
family: SRP alpha N-terminal domain-like
domain: Signal recognition particle receptor alpha subunit, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  151 bits (384), Expect = 1e-44
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 14/134 (10%)

Query: 1   MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLK 60
           M++   IF++GGL+LW  + + ++    P++ LIRS LL+ER G  SF +++     TLK
Sbjct: 1   MVDFFTIFSKGGLVLWCFQGVSDS-CTGPVNALIRSVLLQERGGNNSFTHEA----LTLK 55

Query: 61  WTFHNELGLVFVAVYQRILHLLYVDDLLAMMKQSFSEIYDPKRTDYS---------DFDE 111
           +   N+  LVFV  +Q+IL L YVD L+  + + F + Y  +    S         DF  
Sbjct: 56  YKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQN 115

Query: 112 MFRQLRKEAEARAE 125
            F +L +EAE  ++
Sbjct: 116 DFLRLLREAEESSK 129
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
d2fh5a1129 Signal recognition particle receptor alpha subunit 100.0
d1vmaa2213 GTPase domain of the signal recognition particle r 99.91
d2qy9a2211 GTPase domain of the signal recognition particle r 99.9
d1okkd2207 GTPase domain of the signal recognition particle r 99.89
d1ls1a2207 GTPase domain of the signal sequence recognition p 99.88
d1j8yf2211 GTPase domain of the signal sequence recognition p 99.88
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.59
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.57
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.57
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.55
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.55
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.54
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.54
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.52
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.51
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.5
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.48
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.48
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.46
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.45
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.44
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.43
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.42
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.42
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.37
d1ls1a188 Signal sequence recognition protein Ffh {Thermus a 98.97
d1wgwa_99 Signal recognition particle 54 kDa protein, SRP54 98.85
d1j8yf184 Signal sequence recognition protein Ffh {Archaeon 98.83
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.72
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.41
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 98.39
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 98.39
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 98.38
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 98.35
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 98.21
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.15
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.0
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.99
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.98
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.89
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.88
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.87
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 97.86
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.78
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 97.77
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 97.75
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.71
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 97.6
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.54
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.47
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.43
d1nrja_155 Srx domain of the signal recognition particle rece 97.37
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.35
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.31
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.3
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.29
d2qy9a184 Signal recognition particle receptor, FtsY {Escher 97.28
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.28
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.24
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.24
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.23
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.23
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.18
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.17
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 97.17
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.11
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.09
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 97.08
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.07
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.07
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.07
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.07
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.07
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 97.05
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.04
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.99
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.98
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.95
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.92
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.9
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.85
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.84
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.83
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.83
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.8
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.79
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.79
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.79
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.76
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.71
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.71
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.71
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.69
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.68
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.64
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.62
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.58
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.57
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.53
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.52
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.5
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.5
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.45
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.4
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.35
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.35
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.32
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.29
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.29
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.28
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.28
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.28
d1okkd158 Signal recognition particle receptor, FtsY {Thermu 96.28
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.27
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.26
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.24
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.22
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.22
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.21
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.13
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 96.12
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.12
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.11
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.02
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.02
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.99
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.99
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.94
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.91
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.87
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.86
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.83
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.8
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.77
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.71
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.71
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.62
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.57
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.48
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.48
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.45
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.44
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.42
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.39
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.37
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.37
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.28
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.26
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.21
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.21
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.2
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.19
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.12
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.02
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.01
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 94.98
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.98
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.97
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.95
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.9
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.82
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.67
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.65
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.57
d1vmaa181 Signal recognition particle receptor, FtsY {Thermo 94.56
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.45
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.44
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.39
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.38
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.35
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.35
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 94.3
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.24
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.21
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.18
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.1
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.03
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 94.02
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.98
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 93.92
d2vglm2141 Mu2 adaptin (clathrin coat assembly protein AP50) 93.92
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.87
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.76
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.74
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.74
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.74
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.69
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.66
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.65
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.64
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.6
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.57
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.55
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.54
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.5
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.44
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.39
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.37
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.36
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.36
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.3
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.26
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.2
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.19
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.18
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.1
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 93.08
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.03
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.03
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.99
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.99
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.95
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.83
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.81
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.77
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 92.77
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.67
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.66
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.59
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.51
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.48
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.48
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.34
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.32
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 92.29
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.15
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.14
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.08
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.05
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.99
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.95
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.78
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 91.69
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.66
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 91.59
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.57
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 91.41
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 91.37
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.34
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 91.04
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.95
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.95
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 90.93
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.93
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.74
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.36
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.36
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 90.25
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 90.04
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.03
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 89.65
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 89.47
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.91
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.9
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 88.75
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 88.74
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 88.71
d1ifqa_127 Sec22b {Mouse (Mus musculus) [TaxId: 10090]} 88.58
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.4
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 88.11
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.93
d2vgls_142 Sigma2 adaptin (clathrin coat assembly protein AP1 87.84
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 87.02
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 86.7
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.73
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.53
d1vcoa2272 CTP synthase PyrG, N-terminal domain {Thermus ther 85.45
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 85.07
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 85.06
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 84.7
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.26
d1p3da3215 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.18
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 84.01
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 83.85
d1s1ma2266 CTP synthase PyrG, N-terminal domain {Escherichia 83.66
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 83.57
d2gc6a2 296 Folylpolyglutamate synthetase {Lactobacillus casei 83.13
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 82.79
d1tuea_205 Replication protein E1 helicase domain {Human papi 81.68
d1o5za2 296 Folylpolyglutamate synthetase {Thermotoga maritima 80.66
>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: SNARE-like
family: SRP alpha N-terminal domain-like
domain: Signal recognition particle receptor alpha subunit, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.7e-43  Score=312.84  Aligned_cols=119  Identities=39%  Similarity=0.643  Sum_probs=102.9

Q ss_pred             CcceEEEeecCcEEEEeecccCCCCCCCcHHHHHHHhhhhcccCCCceeeccCCCceeeEEEEecccceEEEEEeccccc
Q 008816            1 MLEQLLIFTRGGLILWTCKELGNALKGSPIDTLIRSCLLEERSGLASFNYDSAGAAYTLKWTFHNELGLVFVAVYQRILH   80 (552)
Q Consensus         1 MlD~~~IftkgGiVLWs~~~~~~~~~~~~in~lI~~vlleer~~~~~~~~~~~~~~y~lkw~~~ne~~Lvfv~vyq~il~   80 (552)
                      |||+|+|||||||||||++ +.++.+++|||+||++||||||+++++|.+    |+|+|||+++||+|||||||||++||
T Consensus         1 MiD~f~IftkGGiVLW~~~-~~~~~~~~~IN~LI~~vlLEER~~~~~~~~----d~y~lkw~~~Ne~~lvfV~vYQ~il~   75 (129)
T d2fh5a1           1 MVDFFTIFSKGGLVLWCFQ-GVSDSCTGPVNALIRSVLLQERGGNNSFTH----EALTLKYKLDNQFELVFVVGFQKILT   75 (129)
T ss_dssp             SCSEEEEEETTSBEEEEEB-TTTBSCCCHHHHHHHHTGGGC-------CC----CCCEEEEEEETTTTEEEEEEESCGGG
T ss_pred             CccEEEEEeCCeEEEEeec-CCCcccchhHHHHHHHhheecccCCCceeE----CCEEEEEEEeccCCEEEEEEEhhhhc
Confidence            9999999999999999754 445889999999999999999999999999    99999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHhcCCcC---------CCCcchHHHHHHHHHHHHHHH
Q 008816           81 LLYVDDLLAMMKQSFSEIYDPKR---------TDYSDFDEMFRQLRKEAEARA  124 (552)
Q Consensus        81 l~yvd~ll~~v~~~F~~~y~~~~---------~~~~~f~~~f~~~l~~~e~~~  124 (552)
                      |+|+|+||++|+++|+++|++..         ..+++||++|+++|+++|+++
T Consensus        76 l~yvd~lL~~i~~~F~~~y~~~l~~~~~~~~~~~~~~Fd~~F~~~l~~~e~~~  128 (129)
T d2fh5a1          76 LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESS  128 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHTHHHHHSSSTHHHHSCCCCCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcccccccccccccchHHHHHHHHHHHHHhc
Confidence            99999999999999999998753         135589999999999999764
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrja_ d.110.4.4 (A:) Srx domain of the signal recognition particle receptor alpha-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a1 a.24.13.1 (A:201-284) Signal recognition particle receptor, FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ifqa_ d.110.4.1 (A:) Sec22b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure