Citrus Sinensis ID: 009150
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 542 | ||||||
| 225441345 | 676 | PREDICTED: uncharacterized protein LOC10 | 0.976 | 0.782 | 0.503 | 1e-155 | |
| 297739885 | 666 | unnamed protein product [Vitis vinifera] | 0.909 | 0.740 | 0.500 | 1e-143 | |
| 87241454 | 650 | GCN5-related N-acetyltransferase; BRCT [ | 0.963 | 0.803 | 0.484 | 1e-136 | |
| 186507168 | 612 | N-acetyltransferase [Arabidopsis thalian | 0.944 | 0.836 | 0.455 | 1e-120 | |
| 147836147 | 1945 | hypothetical protein VITISV_041860 [Viti | 0.887 | 0.247 | 0.434 | 1e-112 | |
| 224086906 | 531 | predicted protein [Populus trichocarpa] | 0.719 | 0.734 | 0.506 | 1e-112 | |
| 186507172 | 549 | N-acetyltransferase [Arabidopsis thalian | 0.828 | 0.817 | 0.471 | 1e-109 | |
| 326487546 | 595 | predicted protein [Hordeum vulgare subsp | 0.933 | 0.850 | 0.411 | 1e-103 | |
| 255578461 | 572 | hypothetical protein RCOM_0255070 [Ricin | 0.809 | 0.767 | 0.421 | 2e-98 | |
| 115463567 | 612 | Os05g0376600 [Oryza sativa Japonica Grou | 0.904 | 0.800 | 0.398 | 1e-96 |
| >gi|225441345|ref|XP_002274624.1| PREDICTED: uncharacterized protein LOC100245305 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 556 bits (1432), Expect = e-155, Method: Compositional matrix adjust.
Identities = 314/624 (50%), Positives = 396/624 (63%), Gaps = 95/624 (15%)
Query: 1 MAPKKTSHVSQSPIPIGNCEVTVEAKKFTCESDPNTLQISISRTAKIKIAVREDL--KSS 58
MAPKK+ + S IPIGNCE++++ K TC+SDPN L IS S+ KIK++V ED+ K+
Sbjct: 1 MAPKKS--LQHSSIPIGNCEISIQGKA-TCQSDPNCLLISASKNTKIKVSVMEDVDGKNC 57
Query: 59 NDTTHSKSEEK--------GEEYIFVLVNPKDAEDSCSKSYLQDVLQIYSRELPTMNYAA 110
ND H + EE G+EY F+L+NPKD S SKS LQ+VL IY ELP MNYAA
Sbjct: 58 NDLRHLRLEESVKAERTSFGDEYFFLLINPKDV-CSQSKSLLQEVLNIYKEELPAMNYAA 116
Query: 111 NTGKRSMFLEKCVLNGKYCTLLLKSSFMDDDDVVVAAITYQIVPADTQYAEVPLAAVSSI 170
NTGK SMFLE+CV NGKYC+LLL S+FM+ V+AA+TYQI+PADTQYAE+PL AVSS
Sbjct: 117 NTGKESMFLERCVSNGKYCSLLLLSNFMEGPGKVIAAVTYQIIPADTQYAEIPLTAVSSN 176
Query: 171 YQHKGVGRLLYLELRKRLQSVGIRTIFCWGDKESEGFWHKQ------------------- 211
+Q KG+GRLLY+ELRKRLQ+VGIRTIFCWGDKESEGFW KQ
Sbjct: 177 FQSKGIGRLLYIELRKRLQNVGIRTIFCWGDKESEGFWLKQGFVSIAEVDTKGRARRLPI 236
Query: 212 -----------------------DTSADTAVSLKFCFPVKPCEKSS--------LVTVNR 240
D SA+ + ++K F +KP EKSS L +
Sbjct: 237 RADIRRALCFPGGSTLMVSHLSKDISANFSDAVKKSFSLKPHEKSSSLDVQIQGLGDIGE 296
Query: 241 SLEAER--------------LVMNGCSRDGAKSSGCSRSLEPVHGSGELAAFENVHCSNM 286
SL+ + LV +G +D G + E ++ +L FE V C+NM
Sbjct: 297 SLDTLKAPVQTSLKTFLPHVLVKDGFQKDDDMLDGSFHNHESINVCRDLVPFEEVDCNNM 356
Query: 287 T--VGAAQIGTDTGAKHCSCS-QGTKRR-WEASTSSLKSKKVKGSSCADCHLDSDRSLAS 342
T V +GTD A +CSCS G K+R WEAS SSLKSKKVKGS C LDS+ + S
Sbjct: 357 TNDVRLTGVGTDVEA-NCSCSAHGAKKRVWEASLSSLKSKKVKGSHQIGCQLDSNWDIVS 415
Query: 343 AGG--ETVGLSGC-------KPLREITPSNHVTVDCTGNDAKEDRPVCTTSAAFISKEFQ 393
G + V GC + L E+ P + ++ + ++ RP+ +F E Q
Sbjct: 416 GNGKIDNVCFVGCSLGTTRNESLSEVLPRDILSSSYVEKNVEDCRPLSKDQLSF---ELQ 472
Query: 394 SNGKCFRIMLMNIADDSKKVHLTKVIEDLGGAVTSDGSTSTHVVTGKVRKTLNFLTALCS 453
G+ FRIMLMNIADD+KK HLTK+I+DLGG+VTSDGS THVVTGKVRKTLNF TALCS
Sbjct: 473 EKGEGFRIMLMNIADDTKKAHLTKIIKDLGGSVTSDGSACTHVVTGKVRKTLNFCTALCS 532
Query: 454 GAWIVSPNWLKESFREGRFVDESSYMLNDDDYVLKYRSELKDSVLRAKARPGGLLRGYNI 513
GAWI+SP+WLKESF EGRFVDES+++L D +Y+ KYR+E+K +LRAKARP LL+GY++
Sbjct: 533 GAWILSPSWLKESFHEGRFVDESAFILEDAEYLFKYRAEIKSVILRAKARPRALLKGYSV 592
Query: 514 IMAAHIQPPIKTLSAIVRSAGGNV 537
+A H+QP ++TLS IVR AGG V
Sbjct: 593 CLAPHVQPAVETLSTIVRFAGGKV 616
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297739885|emb|CBI30067.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|87241454|gb|ABD33312.1| GCN5-related N-acetyltransferase; BRCT [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|186507168|ref|NP_181676.2| N-acetyltransferase [Arabidopsis thaliana] gi|330254887|gb|AEC09981.1| N-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147836147|emb|CAN74767.1| hypothetical protein VITISV_041860 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224086906|ref|XP_002308001.1| predicted protein [Populus trichocarpa] gi|222853977|gb|EEE91524.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|186507172|ref|NP_001118498.1| N-acetyltransferase [Arabidopsis thaliana] gi|330254888|gb|AEC09982.1| N-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|326487546|dbj|BAK05445.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|255578461|ref|XP_002530095.1| hypothetical protein RCOM_0255070 [Ricinus communis] gi|223530406|gb|EEF32294.1| hypothetical protein RCOM_0255070 [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|115463567|ref|NP_001055383.1| Os05g0376600 [Oryza sativa Japonica Group] gi|51038084|gb|AAT93887.1| unknown protein [Oryza sativa Japonica Group] gi|113578934|dbj|BAF17297.1| Os05g0376600 [Oryza sativa Japonica Group] gi|215706889|dbj|BAG93349.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 542 | ||||||
| TAIR|locus:2060535 | 612 | AT2G41450 [Arabidopsis thalian | 0.369 | 0.326 | 0.554 | 7.9e-112 | |
| ZFIN|ZDB-GENE-041010-214 | 1122 | paxip1 "PAX interacting (with | 0.225 | 0.108 | 0.411 | 4.5e-15 | |
| UNIPROTKB|A0JNA8 | 984 | PAXIP1 "PAX-interacting protei | 0.215 | 0.118 | 0.378 | 7.4e-13 | |
| UNIPROTKB|F1P482 | 1062 | PAXIP1 "Uncharacterized protei | 0.215 | 0.110 | 0.378 | 8.2e-13 | |
| UNIPROTKB|Q6ZW49 | 1069 | PAXIP1 "PAX-interacting protei | 0.215 | 0.109 | 0.378 | 8.3e-13 | |
| UNIPROTKB|G3MZP9 | 1195 | PAXIP1 "PAX-interacting protei | 0.215 | 0.097 | 0.378 | 9.6e-13 | |
| RGD|1307547 | 994 | Paxip1 "PAX interacting (with | 0.215 | 0.117 | 0.361 | 7.2e-12 | |
| MGI|MGI:1890430 | 1056 | Paxip1 "PAX interacting (with | 0.215 | 0.110 | 0.361 | 1.7e-11 | |
| RGD|1559468 | 1279 | Mdc1 "mediator of DNA damage c | 0.210 | 0.089 | 0.344 | 1.2e-10 | |
| UNIPROTKB|Q5U2M8 | 1279 | Mdc1 "Mediator of DNA damage c | 0.210 | 0.089 | 0.344 | 1.2e-10 |
| TAIR|locus:2060535 AT2G41450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 590 (212.7 bits), Expect = 7.9e-112, Sum P(2) = 7.9e-112
Identities = 117/211 (55%), Positives = 155/211 (73%)
Query: 1 MAPKKTSHVSQSPIPIGNCEVTVEAKKFTCESDPNTLQISISRTAKIKIAVREDLKSSND 60
MAPK+ S + S IG+ EV V+ K FTCES P ++QI R ++KI+ ++ + S
Sbjct: 1 MAPKRASPMQSSLYSIGDYEVAVDGKNFTCESGPKSIQIKFPRNYRVKISEKDKIVSD-- 58
Query: 61 TTHSKSEEKGEEYIFVLVNPKDAEDSCSKSYLQDVLQIYSRELPTMNYAANTGKRSMFLE 120
+ K + +F+L+NP+D ED +KS+LQ+VL++YS+ELP M YA+NTGK+S FLE
Sbjct: 59 --YPKED------MFLLLNPRD-EDDFTKSHLQEVLKLYSKELPDMRYASNTGKQSAFLE 109
Query: 121 KCVLNGKYCTLLLKSSFMDDDDVVVAAITYQIVPADTQYAEVPLAAVSSIYQHKGVGRLL 180
+CV GKYC+L+LKS+ D D ++AAITYQIVPADTQYAE+PLAAV+ +Q KG G+L+
Sbjct: 110 RCVSKGKYCSLVLKSTLGGDSDEILAAITYQIVPADTQYAEIPLAAVTYTHQKKGFGKLV 169
Query: 181 YLELRKRLQSVGIRTIFCWGDKESEGFWHKQ 211
Y EL KRL SVGIRTI+CW DKESEGFW KQ
Sbjct: 170 YEELMKRLHSVGIRTIYCWADKESEGFWLKQ 200
|
|
| ZFIN|ZDB-GENE-041010-214 paxip1 "PAX interacting (with transcription-activation domain) protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A0JNA8 PAXIP1 "PAX-interacting protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P482 PAXIP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZW49 PAXIP1 "PAX-interacting protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MZP9 PAXIP1 "PAX-interacting protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1307547 Paxip1 "PAX interacting (with transcription-activation domain) protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1890430 Paxip1 "PAX interacting (with transcription-activation domain) protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1559468 Mdc1 "mediator of DNA damage checkpoint 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5U2M8 Mdc1 "Mediator of DNA damage checkpoint protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025326001 | SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (830 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 542 | |||
| cd00027 | 72 | cd00027, BRCT, Breast Cancer Suppressor Protein (B | 2e-10 | |
| smart00292 | 78 | smart00292, BRCT, breast cancer carboxy-terminal d | 3e-09 | |
| pfam00533 | 77 | pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | 1e-06 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 4e-05 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 1e-04 | |
| TIGR01575 | 131 | TIGR01575, rimI, ribosomal-protein-alanine acetylt | 4e-04 |
| >gnl|CDD|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
Score = 56.2 bits (136), Expect = 2e-10
Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
Query: 399 FRIMLMNIADDSKKVHLTKVIEDLGGAVTSDGSTS-THVVTGKVRKTLNFLTALCSGAWI 457
++ ++ L ++IE LGG VTS S THV+ G L A+ G I
Sbjct: 2 LTFVITGDLPSEERDELKELIEKLGGKVTSSVSKKTTHVIVGSDAGPKKLLKAIKLGIPI 61
Query: 458 VSPNWLKESFR 468
V+P WL + +
Sbjct: 62 VTPEWLLDCLK 72
|
The BRCT domain is found within many DNA damage repair and cell cycle checkpoint proteins. The unique diversity of this domain superfamily allows BRCT modules to interact forming homo/hetero BRCT multimers, BRCT-non-BRCT interactions, and interactions within DNA strand breaks. Length = 72 |
| >gnl|CDD|214602 smart00292, BRCT, breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 542 | |||
| KOG2043 | 896 | consensus Signaling protein SWIFT and related BRCT | 99.84 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.58 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 99.48 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 99.4 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.33 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.21 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 99.18 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 99.15 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.1 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 99.09 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.08 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 99.08 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.08 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.05 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.02 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 99.02 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 99.02 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 98.98 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 98.96 | |
| PF12738 | 63 | PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W | 98.95 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 98.92 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 98.91 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 98.9 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 98.9 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 98.89 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 98.89 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 98.88 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 98.88 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 98.87 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 98.84 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 98.84 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 98.81 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 98.8 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 98.77 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 98.72 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.66 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.66 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 98.59 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 98.59 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 98.51 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 98.47 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 98.44 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.43 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 98.43 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 98.41 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 98.4 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 98.39 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 98.38 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 98.35 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 98.35 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 98.34 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 98.34 | |
| PHA01807 | 153 | hypothetical protein | 98.33 | |
| KOG3548 | 1176 | consensus DNA damage checkpoint protein RHP9/CRB2/ | 98.32 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.3 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 98.3 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 98.29 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 98.26 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 98.23 | |
| KOG3226 | 508 | consensus DNA repair protein [Replication, recombi | 98.18 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 98.13 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 98.05 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 97.99 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 97.89 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.87 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 97.86 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 97.81 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 97.81 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 97.8 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 97.75 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 97.65 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 97.55 | |
| KOG1929 | 811 | consensus Nucleotide excision repair factor NEF2, | 97.54 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 97.39 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 97.3 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 97.24 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 96.91 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 96.91 | |
| KOG3524 | 850 | consensus Predicted guanine nucleotide exchange fa | 96.88 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 96.83 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 96.48 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 96.11 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 96.05 | |
| PRK06195 | 309 | DNA polymerase III subunit epsilon; Validated | 95.83 | |
| KOG0966 | 881 | consensus ATP-dependent DNA ligase IV [Replication | 95.82 | |
| PRK06063 | 313 | DNA polymerase III subunit epsilon; Provisional | 95.62 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 95.44 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 95.43 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 95.38 | |
| PF00533 | 78 | BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP | 95.36 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 95.16 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 94.74 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 94.69 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 94.69 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 94.58 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 94.53 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 94.25 | |
| smart00292 | 80 | BRCT breast cancer carboxy-terminal domain. | 94.08 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 93.91 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 93.83 | |
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 93.65 | |
| KOG2481 | 570 | consensus Protein required for normal rRNA process | 93.55 | |
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 93.01 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 92.77 | |
| KOG2535 | 554 | consensus RNA polymerase II elongator complex, sub | 92.73 | |
| cd04265 | 99 | DUF619-NAGS-U DUF619 domain of various N-acetylglu | 92.65 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 91.99 | |
| COG5163 | 591 | NOP7 Protein required for biogenesis of the 60S ri | 91.81 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 91.03 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 89.97 | |
| cd00027 | 72 | BRCT Breast Cancer Suppressor Protein (BRCA1), car | 88.8 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 87.72 | |
| COG5275 | 276 | BRCT domain type II [General function prediction o | 87.66 | |
| KOG2036 | 1011 | consensus Predicted P-loop ATPase fused to an acet | 85.02 | |
| PF04377 | 128 | ATE_C: Arginine-tRNA-protein transferase, C termin | 84.06 |
| >KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=99.84 E-value=1.7e-20 Score=214.49 Aligned_cols=383 Identities=22% Similarity=0.239 Sum_probs=247.3
Q ss_pred EEEEEEeeecc-CCCceeEeeeeeeccCccccChHHHHHHHHHHHHHHcCCcEEEEEccccchhhhhhcCccccccc---
Q 009150 144 VVAAITYQIVP-ADTQYAEVPLAAVSSIYQHKGVGRLLYLELRKRLQSVGIRTIFCWGDKESEGFWHKQDTSADTAV--- 219 (542)
Q Consensus 144 VIg~i~~~i~~-~d~~~aeI~~~AV~~~~QgkGiG~~Lv~~l~~~lk~~GI~~I~l~a~~~A~~Fw~KqGF~~~~~~--- 219 (542)
.-+.|++..++ .+.++......++..+-+-+|+++.............+.+.+..+..+..+.||.++++....+.
T Consensus 343 ~~~~it~~~~~~~~~~~~~~~i~~~~~~~~~~~~ss~~~~~~qs~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~s~~~~e 422 (896)
T KOG2043|consen 343 NMAAITLQNFPDDQTQGNAQPIENIPSDPPQKKYSSMVTYSPQSPNEKKDSRMVQPFPIPENVNSLLKLDGIKFSEFDPE 422 (896)
T ss_pred cccccccccccccCcCcCccccccccCCcccccccCcceeccccccccCCccccccCCcccccccccccccccccccCCC
Confidence 68899999999 56689999999999999889999999888888888889999999999999999999999877654
Q ss_pred -------------------cc--cccCCCCCCCceeEEEEecccch--hhhcccc----ccCCCC-----------C--C
Q 009150 220 -------------------SL--KFCFPVKPCEKSSLVTVNRSLEA--ERLVMNG----CSRDGA-----------K--S 259 (542)
Q Consensus 220 -------------------~~--~~~~~~~~c~ea~lm~l~~~~~~--~~~~~~~----~~~~~~-----------~--~ 259 (542)
.+ ..+|... ..+|--+.+.+. .+.+++. ....+. . .
T Consensus 423 ~~~~~d~~~~~~~~~iks~~~e~e~s~~~~----s~~~~~hv~~~~~s~tq~~~s~~~~~~~~~~~~~~~i~~~~~~~~~ 498 (896)
T KOG2043|consen 423 SPEKLDKLRKASEEVIKSNSGELENSFDSK----SELFGKHVIDEHGSNTQMEDSVSDQKRESEVFNDVKITSYPAPPKQ 498 (896)
T ss_pred cccccchhhhcccccccccchhhhhcccCC----ccccccccccCCCCccccccchhhhhhhccccccccccccCCCccc
Confidence 11 3344442 333321111100 0111110 000000 0 0
Q ss_pred CCCCCCCCCc-CCCcccccc---------------ccccccccc--ccccccccCCCCceeecCCCccchhhcccccccc
Q 009150 260 SGCSRSLEPV-HGSGELAAF---------------ENVHCSNMT--VGAAQIGTDTGAKHCSCSQGTKRRWEASTSSLKS 321 (542)
Q Consensus 260 ~~~~~~~~~~-~~~~~~~~~---------------~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~kr~~~~s~~~l~s 321 (542)
...+...... -.-.+..++ ....++++. ....|.. ++..--.+..|.++.|.+|+++..|
T Consensus 499 ~~~~~~~~~~~id~k~~~~~t~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~--~d~~t~~~~~~~~~~~~~s~~~~~s 576 (896)
T KOG2043|consen 499 NNERQPVKGDDIDLKGEESSTESVRQLLAKSKREKLTSKSNRKEKETIASQIE--ADVVTPESQWGLSTKNLASSSDETS 576 (896)
T ss_pred cccccccccccccccccCCCCcchhhhhccCcccccccccccccccccchhhh--hcccCcccccCcccccccccccccc
Confidence 0000000000 000011111 111112222 2233333 3333333348889999999999999
Q ss_pred ccccCCCCCcccccccccccc-cCCccccCCCCCCCCC-CCCCCCccccccCCCccCCCcccccccccccccccCCC---
Q 009150 322 KKVKGSSCADCHLDSDRSLAS-AGGETVGLSGCKPLRE-ITPSNHVTVDCTGNDAKEDRPVCTTSAAFISKEFQSNG--- 396 (542)
Q Consensus 322 k~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-~~~~~~~~l~~~~k~~~~~~~~~~~~~~~is~~~~s~~--- 396 (542)
|+++.++.---+..+..+.+. ..++......-....+ .+... ..++...-+... ..+-..+++..+..+..
T Consensus 577 ~~~~~~~~~~~~~n~~~~~qi~~~s~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~-~sr~~~t~~~~e~~s~~~~~ 652 (896)
T KOG2043|consen 577 KDERKNFKRLTRSNSDNDAQLNVSSKSSKPKTSQSSSQGESCPD---VPTICVRTNYSG-ASRLASTPAASELRSSSANL 652 (896)
T ss_pred hhhhccccccccccccchhhhhccccccCcccccccccCCCCCC---cccccccccccc-cchhccccchhhhhhhhhcc
Confidence 999997766555544433332 1111111111000000 00000 011111100000 00001111111111111
Q ss_pred -----CCeEEEEcccCChhhHHHHHHHHHHcCcEEeccCCceeEEEECCCCCcHHHHHHHhcCCeEeCHHHHHHHHHcCC
Q 009150 397 -----KCFRIMLMNIADDSKKVHLTKVIEDLGGAVTSDGSTSTHVVTGKVRKTLNFLTALCSGAWIVSPNWLKESFREGR 471 (542)
Q Consensus 397 -----k~~rVlfSG~~de~kk~~L~kiIkkLGG~V~~d~~~~THLIt~k~~RTlKfL~AIA~G~wIVSpsWL~dSlk~Gk 471 (542)
..+.++|++..+.. .++..++.|||.+......+||+|+.+++||.|||+||++|+|||+++||.+|++.|.
T Consensus 653 ~e~~~~r~~~lfs~~~~~~---~~k~~~k~lg~s~~ss~~e~Th~i~~rirRT~k~Leai~~G~~ivT~~wL~s~~k~g~ 729 (896)
T KOG2043|consen 653 NELASKRIEVLFSDKNDGK---NYKLAKKFLGGSVASSDSEATHFIADRIRRTLKFLEAISSGKPLVTPQWLVSSLKSGE 729 (896)
T ss_pred chhhccceeeeeeeccCch---hhhhHHhhccceeecccccceeeeehhhhccHHHHhhhccCCcccchHHHHHHhhccc
Confidence 12689999998754 4889999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCcccCCchhhhhcCCChHHHHHHhhcCCCCCCCCeEEEEeCCCCCCHHHHHHHHHhCCCEEeccC
Q 009150 472 FVDESSYMLNDDDYVLKYRSELKDSVLRAKARPGGLLRGYNIIMAAHIQPPIKTLSAIVRSAGGNVSSKY 541 (542)
Q Consensus 472 ~LdEe~YeL~d~~~e~~~g~~L~~sl~rAr~~~~~LF~G~~f~Is~~v~p~~~~L~~LIeagGG~V~~~L 541 (542)
|+||++|.+.|.+.+++|++++..++.||+.+ ++|.|+.|++++.+.++...+..||+.+||.|+..+
T Consensus 730 ~~dek~yil~D~ekEk~~gf~l~ssl~RAr~~--plL~g~~v~vtp~v~p~~~~v~eiie~~ggnvv~~~ 797 (896)
T KOG2043|consen 730 KLDEKPYILHDEEKEKEFGFRLKSSLLRARAD--PLLEGINVHVTPSVTPSPKTVVEIIEISGGNVVSDS 797 (896)
T ss_pred cccCccccccCHHHHhccCcchhhHHHHhhcc--hhhcCceEEeccccccCcchhHHHHhhcCcceeccc
Confidence 99999999999999999999999999999875 799999999999999999999999999999998653
|
|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3226 consensus DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06195 DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06063 DNA polymerase III subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00292 BRCT breast cancer carboxy-terminal domain | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >COG5275 BRCT domain type II [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 542 | ||||
| 3sqd_A | 219 | Crystal Structure Of Human Ptip Brct56-Gamma H2ax C | 5e-17 | ||
| 2etx_A | 209 | Crystal Structure Of Mdc1 Tandem Brct Domains Lengt | 8e-15 | ||
| 3k05_A | 200 | The Crystal Structure Of Mdc1 Brct T2067d In Comple | 2e-14 | ||
| 2ado_A | 196 | Crystal Structure Of The Brct Repeat Region From Th | 2e-14 | ||
| 2azm_A | 207 | Crystal Structure Of The Mdc1 Brct Repeat In Comple | 7e-11 | ||
| 3l40_A | 220 | Crystal Structure Of S. Pombe Brc1 Brct5-Brct6 Doma | 5e-10 | ||
| 3szm_A | 199 | Structure Of Human Microcephalin (Mcph1) Tandem Brc | 4e-07 | ||
| 3sht_A | 206 | Crystal Structure Of Human Mcph1 Tandem Brct Domain | 1e-06 |
| >pdb|3SQD|A Chain A, Crystal Structure Of Human Ptip Brct56-Gamma H2ax Complex Length = 219 | Back alignment and structure |
|
| >pdb|2ETX|A Chain A, Crystal Structure Of Mdc1 Tandem Brct Domains Length = 209 | Back alignment and structure |
| >pdb|3K05|A Chain A, The Crystal Structure Of Mdc1 Brct T2067d In Complex With A Minimal Recognition Tetrapeptide With An Amidated C-Terminus Length = 200 | Back alignment and structure |
| >pdb|2ADO|A Chain A, Crystal Structure Of The Brct Repeat Region From The Mediator Of Dna Damage Checkpoint Protein 1, Mdc1 Length = 196 | Back alignment and structure |
| >pdb|2AZM|A Chain A, Crystal Structure Of The Mdc1 Brct Repeat In Complex With The Histone Tail Of Gamma-H2ax Length = 207 | Back alignment and structure |
| >pdb|3L40|A Chain A, Crystal Structure Of S. Pombe Brc1 Brct5-Brct6 Domains Length = 220 | Back alignment and structure |
| >pdb|3SZM|A Chain A, Structure Of Human Microcephalin (Mcph1) Tandem Brct Domains In Complex With A Gamma-H2ax Phosphopeptide Length = 199 | Back alignment and structure |
| >pdb|3SHT|A Chain A, Crystal Structure Of Human Mcph1 Tandem Brct Domains Length = 206 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 542 | |||
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 3e-36 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 5e-36 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 7e-32 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 5e-26 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 7e-26 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 2e-23 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 4e-23 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 3e-22 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 4e-22 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 3e-20 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 2e-19 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 2e-19 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 3e-11 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 3e-10 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 2e-09 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 1e-08 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 4e-08 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 7e-08 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 3e-07 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 3e-07 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 5e-07 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 3e-05 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 2e-06 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 4e-06 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 4e-06 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 9e-06 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 2e-05 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 2e-05 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 3e-05 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 3e-05 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 4e-05 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 6e-05 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 2e-04 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 8e-04 |
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 | Back alignment and structure |
|---|
Score = 133 bits (336), Expect = 3e-36
Identities = 35/143 (24%), Positives = 68/143 (47%), Gaps = 6/143 (4%)
Query: 400 RIMLMNIADDSKKVHLTKVIEDLGGAVTSDGSTSTHVVTGKVRKTLNFLTALCSGAWIVS 459
I ++ L ++TS+ S TH++ ++ +T FL ++ G +V+
Sbjct: 10 YITFTGYDKKPSI----DNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVT 65
Query: 460 PNWLKESFREGRFVDESSYMLNDDDYVLKYRSELKDSVLRAKARPGGLLRGYNIIMAAHI 519
+W+ + VDE Y+LND + L+ L+ ++ RA+A+ LL Y + + +
Sbjct: 66 MDWINSCLKTHEIVDEEPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKT 125
Query: 520 QPP--IKTLSAIVRSAGGNVSSK 540
P + + +IV+S GG S+
Sbjct: 126 VAPENVPAVISIVKSNGGVCSTL 148
|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Length = 209 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Length = 259 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Length = 241 | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Length = 264 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 542 | |||
| 3l41_A | 220 | BRCT-containing protein 1; BRC1, BRCT domain, tand | 99.96 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 99.96 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 99.95 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.94 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 99.92 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 99.91 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 99.9 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 99.9 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 99.78 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 99.71 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.6 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.57 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.56 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.55 | |
| 3t7k_A | 256 | RTT107, regulator of TY1 transposition protein 107 | 99.55 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 99.49 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.48 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 99.44 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 99.4 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 99.39 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.35 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.33 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.31 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.3 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.29 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.29 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 99.29 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.28 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.28 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.28 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.28 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.27 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.26 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.26 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.26 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 99.26 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.26 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.25 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.24 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.24 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.22 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.22 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.22 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 99.22 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.22 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.21 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.21 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.2 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.2 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.2 | |
| 3olc_X | 298 | DNA topoisomerase 2-binding protein 1; BRCT domain | 99.19 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.19 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.19 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.19 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.19 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.19 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.19 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.18 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.17 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.17 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.17 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.17 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.17 | |
| 3pa6_A | 107 | Microcephalin; BRCT domain, cell cycle; HET: MSE; | 99.16 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.16 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.16 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.16 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.16 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.15 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.15 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.15 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.15 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.15 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.14 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.13 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.13 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.13 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.13 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.13 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.13 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.12 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 99.12 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.12 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 99.12 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.12 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.12 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.11 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.11 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.11 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.1 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.1 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.1 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.1 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.09 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.09 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.09 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.09 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.09 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.09 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.08 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.08 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.08 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.08 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.08 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 99.08 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.07 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.06 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.06 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 99.06 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.05 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.05 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.05 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.04 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.04 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.04 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.03 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 99.03 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.02 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 99.02 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 99.02 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.02 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.01 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.01 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.0 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.0 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 98.99 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 98.99 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 98.98 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 98.98 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 98.98 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 98.97 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 98.97 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 98.97 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 98.96 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 98.95 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 98.95 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 98.93 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 98.93 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 98.93 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 98.93 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 98.91 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 98.9 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 98.9 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.89 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 98.88 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 98.88 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 98.88 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 98.87 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 98.87 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 98.86 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 98.86 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 98.82 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.81 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 98.81 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.75 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 98.74 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 98.73 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 98.72 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 98.72 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 98.71 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 98.7 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.69 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 98.65 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 98.63 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 98.62 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 98.62 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 98.62 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.61 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 98.6 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 98.59 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 98.59 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 98.57 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.55 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 98.52 | |
| 2jw5_A | 106 | DNA polymerase lambda; BRCT domain, family X polym | 98.52 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 98.45 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 98.43 | |
| 3ii6_X | 263 | DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter | 98.43 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 98.4 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 98.39 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 98.38 | |
| 2coe_A | 120 | Deoxynucleotidyltransferase, terminal variant; BRC | 98.36 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 98.34 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 98.34 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.31 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 98.31 | |
| 1z56_C | 264 | DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA | 98.26 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 98.13 | |
| 2dun_A | 133 | POL MU, DNA polymerase MU; layers A/B/A, parallel | 98.12 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 98.1 | |
| 3u3z_A | 199 | Microcephalin; DNA repair, cell cycle regulation, | 98.02 | |
| 1l0b_A | 229 | BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu | 98.0 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 97.97 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 97.97 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 97.93 | |
| 1t15_A | 214 | Breast cancer type 1 susceptibility protein; prote | 97.9 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 97.85 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 97.81 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 97.71 | |
| 2nte_A | 210 | BARD-1, BRCA1-associated ring domain protein 1; BR | 97.65 | |
| 2etx_A | 209 | Mediator of DNA damage checkpoint protein 1; tande | 97.62 | |
| 1kzy_C | 259 | Tumor suppressor P53-binding protein 1; tandem-BRC | 97.59 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 97.5 | |
| 3al2_A | 235 | DNA topoisomerase 2-binding protein 1; BRCT domain | 96.5 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 96.39 | |
| 3sqd_A | 219 | PAX-interacting protein 1; tandem BRCT domains, ce | 96.2 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 95.91 | |
| 4id3_A | 92 | DNA repair protein REV1; BRCT domain, protein bind | 95.89 | |
| 2vxb_A | 241 | DNA repair protein RHP9; BRCT, nucleus, cell cycle | 95.77 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 95.55 | |
| 2ebw_A | 97 | DNA repair protein REV1; A/B/A 3 layers, parallel | 95.21 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 95.19 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 95.06 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 93.11 | |
| 1wf6_A | 132 | Similar to S.pombe -RAD4+/CUT5+product (A40727); B | 92.6 | |
| 2ep8_A | 100 | Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r | 92.5 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 92.16 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 91.95 | |
| 1l7b_A | 92 | DNA ligase; BRCT, autostructure, structural genomi | 91.61 | |
| 3l46_A | 112 | Protein ECT2; alternative splicing, guanine-nucleo | 91.39 | |
| 3l3e_A | 107 | DNA topoisomerase 2-binding protein 1; BRCT domain | 91.35 | |
| 2d8m_A | 129 | DNA-repair protein XRCC1; parallel beta-sheet, DNA | 91.31 | |
| 3pc6_A | 104 | DNA repair protein XRCC1; BRCT domain, protein:pro | 90.43 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 89.89 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 89.31 | |
| 2cou_A | 109 | ECT2 protein; BRCT domain, RHO GTPase, structural | 89.3 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 88.44 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 87.98 | |
| 2l42_A | 106 | DNA-binding protein RAP1; BRCT domain, protein bin | 87.98 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 87.1 | |
| 2cok_A | 113 | Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r | 87.02 | |
| 3pc7_A | 88 | DNA ligase 3; DNA repair, BRCT domain, protein:pro | 85.31 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 84.81 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 84.27 | |
| 3oq4_A | 134 | DBF4, protein DNA52; DDK, BRCT, RAD53, replication | 83.9 | |
| 2k6g_A | 109 | Replication factor C subunit 1; protein, BRCT, DNA | 83.48 | |
| 2ebu_A | 112 | Replication factor C subunit 1; A/B/A 3 layers, pa | 81.82 |
| >3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=1.5e-29 Score=247.53 Aligned_cols=140 Identities=25% Similarity=0.451 Sum_probs=131.8
Q ss_pred CCCeEEEEcccCChhhHHHHHHHHHHcCcEEeccCCceeEEEECCCCCcHHHHHHHhcCCeEeCHHHHHHHHHcCCCCCC
Q 009150 396 GKCFRIMLMNIADDSKKVHLTKVIEDLGGAVTSDGSTSTHVVTGKVRKTLNFLTALCSGAWIVSPNWLKESFREGRFVDE 475 (542)
Q Consensus 396 ~k~~rVlfSG~~de~kk~~L~kiIkkLGG~V~~d~~~~THLIt~k~~RTlKfL~AIA~G~wIVSpsWL~dSlk~Gk~LdE 475 (542)
.++++|+|||+.+.+ +.++|++|||.|++++.+|||||++++.||.|||+|++.|+|||+|+||.+|+++|+++||
T Consensus 6 ~~~~~v~fSG~~~~~----~~~~i~~lGg~v~~~~~~~THlV~~~~~RT~K~l~Aia~g~~IVs~~Wl~~~~~~~~~l~e 81 (220)
T 3l41_A 6 SKRVYITFTGYDKKP----SIDNLKKLDMSITSNPSKCTHLIAPRILRTSKFLCSIPYGPCVVTMDWINSCLKTHEIVDE 81 (220)
T ss_dssp -CCEEEEECSCSSCC----CCGGGGGGTEEECSCTTTCSEEECSSCCCBHHHHHHGGGCCEEECHHHHHHHHHHTSCCCS
T ss_pred cceEEEEEeccCCCC----CcchHhhcceeeccCchhhhhhhhhhHhhhcceeecCCCCCeEEEhHHHHhhhhhhhcccc
Confidence 457999999999865 3889999999999999899999999999999999999999999999999999999999999
Q ss_pred CCcccCCchhhhhcCCChHHHHHHhhcCCCCCCCCeEEEEeCCC--CCCHHHHHHHHHhCCCEEec
Q 009150 476 SSYMLNDDDYVLKYRSELKDSVLRAKARPGGLLRGYNIIMAAHI--QPPIKTLSAIVRSAGGNVSS 539 (542)
Q Consensus 476 e~YeL~d~~~e~~~g~~L~~sl~rAr~~~~~LF~G~~f~Is~~v--~p~~~~L~~LIeagGG~V~~ 539 (542)
++|+|.+.+.+..+++++.+++.|+++++.+||+|++|||++++ .|++++|+.||++|||+|+.
T Consensus 82 ~~y~l~d~~~e~~~~~~l~~~~~rar~~~~~LF~G~~f~it~~~~~~p~~~~l~~iI~~~GG~v~~ 147 (220)
T 3l41_A 82 EPYLLNDPEKELELGCTLESALKRARAQGPSLLEDYVVYLTSKTVAPENVPAVISIVKSNGGVCST 147 (220)
T ss_dssp GGGBCCCHHHHHHHTSCHHHHHHHHHHHCSCTTTTSEEEEETTSSCGGGHHHHHHHHHHTTCEEEE
T ss_pred CccccCCcHHHhhccccHHHHHHHHHhcCchhhhheeEEEeccccCCCCCceEEEEEecCCcEech
Confidence 99999999999999999999999998877899999999999998 78899999999999999986
|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* | Back alignment and structure |
|---|
| >1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A | Back alignment and structure |
|---|
| >2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A | Back alignment and structure |
|---|
| >1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 | Back alignment and structure |
|---|
| >2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 | Back alignment and structure |
|---|
| >3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A | Back alignment and structure |
|---|
| >3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A | Back alignment and structure |
|---|
| >2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 542 | ||||
| d1z4ra1 | 162 | d.108.1.1 (A:497-658) Catalytic domain of GCN5 his | 3e-14 | |
| d1kzyc1 | 153 | c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) | 2e-13 | |
| d1qsra_ | 162 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 6e-13 | |
| d1t15a1 | 109 | c.15.1.3 (A:1649-1757) Breast cancer associated pr | 3e-11 | |
| d1ygha_ | 164 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 6e-10 | |
| d1cdza_ | 96 | c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom | 2e-07 | |
| d1wf6a_ | 132 | c.15.1.5 (A:) DNA topoisomerase II binding protein | 2e-06 | |
| d1t15a2 | 102 | c.15.1.3 (A:1758-1859) Breast cancer associated pr | 3e-05 | |
| d2aj6a1 | 118 | d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S | 0.002 |
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.2 bits (166), Expect = 3e-14
Identities = 30/139 (21%), Positives = 57/139 (41%), Gaps = 16/139 (11%)
Query: 75 FVLVNPKDAEDSC--SKSYLQDVLQIYSRELPTMNYAANTGKRSMFLEKCVLNGKYCTLL 132
F ++ + +L + ++S +LP M ++ + V + K+ TL
Sbjct: 5 FHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRM--------PKEYIARLVFDPKHKTLA 56
Query: 133 LKSSFMDDDDVVVAAITYQIVPADTQYAEVPLAAVSSIYQHKGVGRLLYLELRKRLQSVG 192
L D V+ I +++ P + E+ AV+S Q KG G L L++
Sbjct: 57 LI-----KDGRVIGGICFRMFP-TQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHN 110
Query: 193 IRTIFCWGDKESEGFWHKQ 211
I + D+ + G++ KQ
Sbjct: 111 ILYFLTYADEYAIGYFKKQ 129
|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 542 | |||
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.93 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.89 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.88 | |
| d1t15a1 | 109 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.73 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 99.49 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.4 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.39 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 99.36 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.35 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.35 | |
| d1kzyc1 | 153 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.35 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.34 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.32 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.31 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.31 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.3 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.3 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.3 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.27 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.26 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.24 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.2 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.19 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.18 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.17 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.16 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.15 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.14 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.14 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.14 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.12 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.12 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.12 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.12 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.11 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.1 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.1 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 99.08 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.07 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.07 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.05 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.04 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.03 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 98.99 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 98.95 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 98.89 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.84 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 98.81 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 98.68 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 98.68 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 98.67 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 98.66 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 98.64 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 98.63 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 98.59 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 98.57 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 98.55 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 98.53 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 98.46 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 98.3 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 98.0 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 97.48 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 97.27 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 97.19 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 97.1 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 96.82 | |
| d1t15a2 | 102 | Breast cancer associated protein, BRCA1 {Human (Ho | 96.73 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 95.99 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 95.61 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 95.39 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 95.01 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 93.82 | |
| d1wf6a_ | 132 | DNA topoisomerase II binding protein 1, TopBP1 {Hu | 93.45 | |
| d1cdza_ | 96 | DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta | 93.28 | |
| d1in1a_ | 88 | DNA ligase III alpha {Human (Homo sapiens) [TaxId: | 92.03 | |
| d1l0ba2 | 97 | Breast cancer associated protein, BRCA1 {Rat (Ratt | 91.23 | |
| d1l7ba_ | 92 | NAD+-dependent DNA ligase, domain 4 {Thermus therm | 90.88 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 86.02 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 83.62 |
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=1e-25 Score=208.35 Aligned_cols=149 Identities=23% Similarity=0.346 Sum_probs=128.6
Q ss_pred eEEeeCCCCcc--ccchhhhHHHHHHHHhhccCCchhhhhcCccccceeeeecccceeEEEeeecccCCCCcEEEEEEee
Q 009150 74 IFVLVNPKDAE--DSCSKSYLQDVLQIYSRELPTMNYAANTGKRSMFLEKCVLNGKYCTLLLKSSFMDDDDVVVAAITYQ 151 (542)
Q Consensus 74 ~~~~~~~~~~~--~~~~~~~l~d~~~i~~~~lp~m~~~a~~g~~~~~i~r~v~~~~~~~l~~~~~~~~~~~~VIg~i~~~ 151 (542)
.|.++++.... +.+...+|..++++|.++||+|+ ++||+|+++|..+.+++++. +|+|||+++++
T Consensus 4 ~~~~~~n~~~~~~~~~~~~~L~~~~~iF~~~lp~m~--------~~yi~r~~~d~~~~~~v~~~-----~~~iIG~i~~~ 70 (162)
T d1z4ra1 4 EFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMP--------KEYIARLVFDPKHKTLALIK-----DGRVIGGICFR 70 (162)
T ss_dssp EEEEECCSSCTTSCHHHHHHHHHHHHHHHHHCTTSC--------HHHHHHHHTCTTCEEEEEEE-----TTEEEEEEEEE
T ss_pred EEEEecCCCCCccCHHHHHHHHHHHHHHHHhCCCCc--------HHHHHHHhcCCCceEEEEEE-----CCEEEEEEEEE
Confidence 46677775441 45778899999999999999999 99999999999999998874 67999999999
Q ss_pred eccCCCceeEeeeeeeccCccccChHHHHHHHHHHHHHHcCCcEEEEEccccchhhhhhcCccccccccccccCCCC--C
Q 009150 152 IVPADTQYAEVPLAAVSSIYQHKGVGRLLYLELRKRLQSVGIRTIFCWGDKESEGFWHKQDTSADTAVSLKFCFPVK--P 229 (542)
Q Consensus 152 i~~~d~~~aeI~~~AV~~~~QgkGiG~~Lv~~l~~~lk~~GI~~I~l~a~~~A~~Fw~KqGF~~~~~~~~~~~~~~~--~ 229 (542)
+++ +.+++||.++||+++|||+|+|+.||+++++++++.|++++++.+++.|.+||+|+||++...+... .|-+. |
T Consensus 71 ~~~-~~~~aeI~~laV~~~~qgkGiG~~Lm~~l~~~~~~~g~~~i~~~~~~~A~~fY~k~GF~~~~~~~~~-~~~~~ikd 148 (162)
T d1z4ra1 71 MFP-TQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKS-RYLGYIKD 148 (162)
T ss_dssp EET-TTTEEEEEEEEECGGGCSSSHHHHHHHHHHHHHHHTTCCEEEEEECGGGHHHHHHTTEESCCCSCHH-HHTTTSCC
T ss_pred EEC-CCCEEEEEEEEEChhhhhhhHHHHHHHHHHHHHHHCCCcEEEEecCcchHHHHHhCCCeEeccCchh-HhcCCccC
Confidence 988 6689999999999999999999999999999999999999999999999999999999876554221 12222 5
Q ss_pred CCceeEEE
Q 009150 230 CEKSSLVT 237 (542)
Q Consensus 230 c~ea~lm~ 237 (542)
|+.+++|.
T Consensus 149 y~~~~lm~ 156 (162)
T d1z4ra1 149 YEGATLME 156 (162)
T ss_dssp CTTCEEEE
T ss_pred CCCeEEEE
Confidence 77799998
|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|